A0A077ZJQ3_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZJQ3, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 80 aa.

						>A0A077ZJQ3_TRITR|A0A077ZJQ3
MNEVHTRPNTEAQSMVMGAPEAETSPAAAEAMAKVCGEEKESTRTAATTSNAAVASAHDPADEPCHRRSTRLRSSGSRHQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	54.6	Low	59.7	Low	226 Å²	226	144.8 Å²	144.8	100%	1.113	74%	0.741	S	S	*	*				0	105.7	0	-70.3	157.1	173.5	0	0	105.7	E3	M1-E3 PolarHBondContact O-N 3.08Å
2	N	53.5	Low	59.5	Low	163 Å²	163	138.3 Å²	138.3	87%	0.872	73%	0.725	S	S	*	*			trans	-83.1	91.1	-175	-76.7	-15.9	0	0	0	108.9	V4	N2-V4 PolarHBondContact O-N 3.18Å; N2-V4 VanDerWaalsContact O-N 3.08Å
3	E	54.9	Low	59.3	Low	152 Å²	152	138.5 Å²	138.5	71%	0.71	72%	0.72	S	S	*	*			trans	-74.4	95.8	171.4	-68.7	175.5	114.3	0	0	108.5	M1 H5	M1-E3 PolarHBondContact O-N 3.08Å; E3-H5 VanDerWaalsContact C-N 3.28Å; E3-H5 PolarHBondContact O-N 2.95Å; E3-H5 PolarHBondContact O-ND1 2.86Å
4	V	61.1	Low	59.2	Low	121 Å²	121	134.5 Å²	134.5	73%	0.733	71%	0.71	S	S	*	*			trans	-67	93.2	167.4	175.7	0	0	0	0	106.9	N2 T6	N2-V4 PolarHBondContact O-N 3.18Å; N2-V4 VanDerWaalsContact O-N 3.08Å; V4-T6 VanDerWaalsContact C-N 3.27Å; V4-T6 HydrophobicContact CG1-CG2 4.3Å; V4-T6 PolarHBondContact O-N 3.09Å
5	H	60.8	Low	59.1	Low	150 Å²	150	136.5 Å²	136.5	69%	0.694	72%	0.716	S	S	*	*			trans	-71.5	87.8	169.6	-65.2	86.4	0	0	0	107.9	E3 R7	E3-H5 VanDerWaalsContact C-N 3.28Å; E3-H5 PolarHBondContact O-N 2.95Å; E3-H5 PolarHBondContact O-ND1 2.86Å; H5-R7 VanDerWaalsContact C-N 3.27Å; H5-R7 PolarHBondContact O-N 2.93Å
6	T	62.7	Low	59.1	Low	124 Å²	124	135.6 Å²	135.6	76%	0.761	72%	0.718	S	S	*	*			trans	-60.2	93.7	164	36.1	0	0	0	0	107.9	V4	V4-T6 VanDerWaalsContact C-N 3.27Å; V4-T6 HydrophobicContact CG1-CG2 4.3Å; V4-T6 PolarHBondContact O-N 3.09Å
7	R	64.7	Low	58.9	Low	222 Å²	222	137.8 Å²	137.8	84%	0.838	73%	0.726	S	S	*	*			trans	-57.6	130.1	170.2	-67.4	-178.9	82.7	-177.8	5.5	107.5	H5 N9	H5-R7 VanDerWaalsContact C-N 3.27Å; H5-R7 PolarHBondContact O-N 2.93Å; R7-N9 PolarHBondContact O-N 2.94Å
8	P	63.3	Low	58.4	Low	99 Å²	99	133.6 Å²	133.6	64%	0.643	72%	0.721	S	S	*	*			trans	-60.2	130.7	171.7	23	-29.1	0	0	0	108.5	T10	P8-T10 PolarHBondContact O-N 3.22Å
9	N	63.2	Low	58.4	Low	88 Å²	88	131.2 Å²	131.2	47%	0.471	72%	0.722	S	S	.	*			trans	-62.2	99.7	177.6	178	-85.8	0	0	0	108.5	R7 E11 A12	R7-N9 PolarHBondContact O-N 2.94Å; N9-E11 PolarHBondContact ND2-OE2 2.83Å; N9-E11 VanDerWaalsContact ND2-OE2 3.09Å; N9-E11 PolarHBondContact O-N 3.41Å; N9-E11 WeakPolarHBondContact OD1-CB 3.37Å; N9-E11 PolarHBondContact OD1-N 3.18Å; N9-A12 PolarHBondContact O-N 2.94Å; N9-A12 WeakPolarHBondContact OD1-CB 3.4Å; N9-A12 PolarHBondContact OD1-N 3.31Å
10	T	59.5	Low	58.3	Low	107 Å²	107	130.4 Å²	130.4	66%	0.656	72%	0.723	S	S	*	*	H	α-helix	trans	-63.3	-18.8	-179.2	-23.5	0	0	0	0	112.1	P8 Q13 S14	P8-T10 PolarHBondContact O-N 3.22Å; T10-Q13 PolarHBondContact O-N 3.32Å; T10-S14 PolarHBondContact O-N 3.49Å
11	E	58.6	Low	58.2	Low	141 Å²	141	132.9 Å²	132.9	66%	0.659	73%	0.729	S	S	*	*	H	α-helix	trans	-72.1	-32.9	178.8	-52.2	174.3	121.9	0	0	111.7	N9 Q13	N9-E11 PolarHBondContact ND2-OE2 2.83Å; N9-E11 VanDerWaalsContact ND2-OE2 3.09Å; N9-E11 PolarHBondContact O-N 3.41Å; N9-E11 WeakPolarHBondContact OD1-CB 3.37Å; N9-E11 PolarHBondContact OD1-N 3.18Å; E11-Q13 VanDerWaalsContact C-N 3.32Å
12	A	56.9	Low	58.4	Low	66 Å²	66	126 Å²	126	55%	0.545	71%	0.708	S	S	.	*	H	α-helix	trans	-75.1	-19.4	175	0	0	0	0	0	113.4	N9	N9-A12 PolarHBondContact O-N 2.94Å; N9-A12 WeakPolarHBondContact OD1-CB 3.4Å; N9-A12 PolarHBondContact OD1-N 3.31Å
13	Q	57.1	Low	58.3	Low	141 Å²	141	127.4 Å²	127.4	66%	0.659	71%	0.71	S	S	*	*	H	α-helix	trans	-90.4	-15.6	177.2	-66.1	-165.3	-11.4	0	0	113.5	T10 E11 M15	T10-Q13 PolarHBondContact O-N 3.32Å; E11-Q13 VanDerWaalsContact C-N 3.32Å; Q13-M15 VanDerWaalsContact C-N 3.32Å; Q13-M15 PolarHBondContact O-N 3.4Å
14	S	57.9	Low	58.5	Low	83 Å²	83	124.6 Å²	124.6	58%	0.58	70%	0.703	S	S	*	*	G	3₁₀ helix	trans	-74.9	-20.4	178.9	-165.4	0	0	0	0	113.2	T10 V16	T10-S14 PolarHBondContact O-N 3.49Å; S14-V16 VanDerWaalsContact C-N 3.3Å; S14-V16 PolarHBondContact O-N 3.39Å
15	M	57.6	Low	58.7	Low	164 Å²	164	121.8 Å²	121.8	81%	0.808	69%	0.689	S	S	*	*	G	3₁₀ helix	trans	-82.7	1	-172.9	-58.8	-166.5	-166.5	0	0	115	Q13	Q13-M15 VanDerWaalsContact C-N 3.32Å; Q13-M15 PolarHBondContact O-N 3.4Å
16	V	59.5	Low	59	Low	122 Å²	122	119.3 Å²	119.3	74%	0.739	69%	0.686	S	S	*	*	G	3₁₀ helix	trans	-93.7	2.3	-178.2	-151	0	0	0	0	112.6	S14 G18	S14-V16 VanDerWaalsContact C-N 3.3Å; S14-V16 PolarHBondContact O-N 3.39Å; V16-G18 PolarHBondContact O-N 3.32Å
17	M	55.2	Low	59.3	Low	173 Å²	173	116.4 Å²	116.4	85%	0.852	67%	0.674	S	S	*	*	S	Bend	trans	-99.7	63.1	-177.4	-160.7	170.6	48.1	0	0	110.4
18	G	50.3	Low	59.4	Low	63 Å²	63	107.8 Å²	107.8	65%	0.649	65%	0.651	S	S	*	*			trans	-179.1	31.6	-177.5	0	0	0	0	0	113.5	V16 P20	V16-G18 PolarHBondContact O-N 3.32Å; G18-P20 WeakPolarHBondContact O-CD 3.37Å
19	A	58	Low	59.6	Low	88 Å²	88	105.3 Å²	105.3	73%	0.727	64%	0.639	S	S	*	*			trans	-60.6	120.8	161.1	0	0	0	0	0	106	E21	A19-E21 PolarHBondContact O-N 2.75Å; A19-E21 VanDerWaalsContact O-N 3.11Å
20	P	57.3	Low	59.8	Low	114 Å²	114	108 Å²	108	74%	0.74	65%	0.648	S	S	*	*			trans	-55	126.7	170.1	24.1	-30.8	0	0	0	105.5	G18 A22	G18-P20 WeakPolarHBondContact O-CD 3.37Å; P20-A22 VanDerWaalsContact C-N 3.26Å; P20-A22 PolarHBondContact O-N 2.75Å
21	E	55.7	Low	60.4	Low	184 Å²	184	105.5 Å²	105.5	86%	0.86	64%	0.639	S	S	*	*			trans	-48.3	108	162	-67.6	-172.5	117	0	0	104.1	A19 E23	A19-E21 PolarHBondContact O-N 2.75Å; A19-E21 VanDerWaalsContact O-N 3.11Å; E21-E23 VanDerWaalsContact C-N 3.3Å; E21-E23 PolarHBondContact O-N 2.77Å
22	A	58.3	Low	60.9	Low	82 Å²	82	104 Å²	104	68%	0.678	63%	0.633	S	S	*	*			trans	-57.4	107.6	-176.2	0	0	0	0	0	104.1	P20 T24	P20-A22 VanDerWaalsContact C-N 3.26Å; P20-A22 PolarHBondContact O-N 2.75Å; A22-T24 PolarHBondContact O-N 3.42Å
23	E	52.4	Low	61.3	Low	192 Å²	192	103.9 Å²	103.9	90%	0.897	63%	0.632	S	S	*	*			trans	-62.8	92.9	175.7	-69.6	-165.8	125.8	0	0	104.5	E21 S25	E21-E23 VanDerWaalsContact C-N 3.3Å; E21-E23 PolarHBondContact O-N 2.77Å; E23-S25 PolarHBondContact O-N 3.11Å
24	T	59.5	Low	61.5	Low	93 Å²	93	104.1 Å²	104.1	57%	0.571	63%	0.631	S	S	*	*			trans	-62.8	94.7	171.5	4.4	0	0	0	0	104.6	A22 M32	A22-T24 PolarHBondContact O-N 3.42Å; T24-M32 HydrophobicContact CG2-CE 3.85Å
25	S	64.4	Low	61.8	Low	62 Å²	62	104.9 Å²	104.9	43%	0.434	63%	0.632	S	S	.	*			trans	-49.7	139.5	171.5	178.5	0	0	0	0	107.6	E23 A27 A28 A29	E23-S25 PolarHBondContact O-N 3.11Å; S25-A27 PolarHBondContact O-N 3.02Å; S25-A28 WeakPolarHBondContact O-CA 3.37Å; S25-A28 WeakPolarHBondContact O-CB 3.41Å; S25-A28 PolarHBondContact O-N 2.89Å; S25-A29 PolarHBondContact O-N 3.35Å
26	P	66.4	Low	61.8	Low	98 Å²	98	101.2 Å²	101.2	64%	0.636	62%	0.621	S	S	*	*	H	α-helix	trans	-52.1	-30.5	175.7	17.5	-29.8	0	0	0	111.8	A29 E30	P26-A29 PolarHBondContact O-N 2.95Å; P26-E30 WeakPolarHBondContact O-CB 3.32Å; P26-E30 WeakPolarHBondContact O-CG 3.39Å; P26-E30 PolarHBondContact O-N 2.78Å
27	A	69.1	Low	61.7	Low	62 Å²	62	97.3 Å²	97.3	51%	0.512	61%	0.606	S	S	.	*	H	α-helix	trans	-64.7	-36.7	172.6	0	0	0	0	0	113.8	S25 A31	S25-A27 PolarHBondContact O-N 3.02Å; A27-A31 WeakPolarHBondContact O-CB 3.47Å; A27-A31 PolarHBondContact O-N 3.38Å
28	A	67.8	Low	61.6	Low	42 Å²	42	95 Å²	95	35%	0.347	59%	0.593	S	S	.	*	H	α-helix	trans	-73.1	-36.6	175.4	0	0	0	0	0	111.6	S25 A31 M32	S25-A28 WeakPolarHBondContact O-CA 3.37Å; S25-A28 WeakPolarHBondContact O-CB 3.41Å; S25-A28 PolarHBondContact O-N 2.89Å; A28-A31 PolarHBondContact O-N 3.08Å; A28-M32 WeakPolarHBondContact O-CG 3.39Å; A28-M32 PolarHBondContact O-N 2.98Å
29	A	67.9	Low	61.8	Low	47 Å²	47	98.7 Å²	98.7	39%	0.388	59%	0.593	S	S	.	*	H	α-helix	trans	-64.7	-43.4	172.9	0	0	0	0	0	111.7	S25 P26 M32 A33	S25-A29 PolarHBondContact O-N 3.35Å; P26-A29 PolarHBondContact O-N 2.95Å; A29-M32 PolarHBondContact O-N 3.32Å; A29-A33 WeakPolarHBondContact O-CB 3.41Å; A29-A33 PolarHBondContact O-N 2.68Å
30	E	67.1	Low	61.6	Low	143 Å²	143	102.9 Å²	102.9	67%	0.668	60%	0.595	S	S	*	*	H	α-helix	trans	-64.4	-39.7	173.9	-76	-179.5	176.9	0	0	112.2	P26 A33 K34	P26-E30 WeakPolarHBondContact O-CB 3.32Å; P26-E30 WeakPolarHBondContact O-CG 3.39Å; P26-E30 PolarHBondContact O-N 2.78Å; E30-A33 PolarHBondContact O-N 3.38Å; E30-K34 WeakPolarHBondContact O-CB 3.33Å; E30-K34 PolarHBondContact O-N 3.42Å
31	A	70.5	Confident	61.4	Low	56 Å²	56	104.5 Å²	104.5	46%	0.463	59%	0.593	S	S	.	*	H	α-helix	trans	-62.5	-44.6	175	0	0	0	0	0	112	A27 A28 K34 V35	A27-A31 WeakPolarHBondContact O-CB 3.47Å; A27-A31 PolarHBondContact O-N 3.38Å; A28-A31 PolarHBondContact O-N 3.08Å; A31-K34 PolarHBondContact O-N 3.4Å; A31-V35 WeakPolarHBondContact O-CG2 3.47Å; A31-V35 PolarHBondContact O-N 3.19Å; A31-V35 VanDerWaalsContact O-N 3.08Å
32	M	69.4	Low	61.2	Low	109 Å²	109	99.9 Å²	99.9	54%	0.537	58%	0.581	S	S	.	*	H	α-helix	trans	-67.3	-37.6	175.6	-71.1	-169.6	-67.1	0	0	112.4	T24 A28 A29 K34 V35 C36	T24-M32 HydrophobicContact CG2-CE 3.85Å; A28-M32 WeakPolarHBondContact O-CG 3.39Å; A28-M32 PolarHBondContact O-N 2.98Å; A29-M32 PolarHBondContact O-N 3.32Å; M32-K34 VanDerWaalsContact C-N 3.28Å; M32-K34 PolarHBondContact O-N 3.41Å; M32-V35 PolarHBondContact O-N 3.17Å; M32-C36 WeakPolarHBondContact O-CB 3.41Å; M32-C36 PolarHBondContact O-N 3.04Å
33	A	66.7	Low	61	Low	63 Å²	63	100.7 Å²	100.7	52%	0.521	58%	0.577	S	S	.	*	H	α-helix	trans	-63.2	-36.7	174.9	0	0	0	0	0	111.7	A29 E30 G37	A29-A33 WeakPolarHBondContact O-CB 3.41Å; A29-A33 PolarHBondContact O-N 2.68Å; E30-A33 PolarHBondContact O-N 3.38Å; A33-G37 PolarHBondContact O-N 3.31Å
34	K	60.8	Low	60.9	Low	146 Å²	146	100.9 Å²	100.9	64%	0.635	57%	0.57	S	S	*	*	H	α-helix	trans	-68.4	-43.5	176.5	-163.5	169.1	-178.1	-177	0	112	E30 A31 M32 G37 E38	E30-K34 WeakPolarHBondContact O-CB 3.33Å; E30-K34 PolarHBondContact O-N 3.42Å; A31-K34 PolarHBondContact O-N 3.4Å; M32-K34 VanDerWaalsContact C-N 3.28Å; M32-K34 PolarHBondContact O-N 3.41Å; K34-G37 PolarHBondContact O-N 2.92Å; K34-E38 PolarHBondContact O-N 2.92Å; K34-E38 VanDerWaalsContact O-N 3.17Å
35	V	63.4	Low	60.5	Low	100 Å²	100	100.5 Å²	100.5	61%	0.606	57%	0.568	S	S	*	*	H	α-helix	trans	-62.8	-43.3	175.5	175.6	0	0	0	0	111.6	A31 M32	A31-V35 WeakPolarHBondContact O-CG2 3.47Å; A31-V35 PolarHBondContact O-N 3.19Å; A31-V35 VanDerWaalsContact O-N 3.08Å; M32-V35 PolarHBondContact O-N 3.17Å
36	C	58.7	Low	60	Low	87 Å²	87	100.4 Å²	100.4	59%	0.588	57%	0.57	S	S	*	*	H	α-helix	trans	-75.7	-21.7	178.2	-75.4	0	0	0	0	114.1	M32	M32-C36 WeakPolarHBondContact O-CB 3.41Å; M32-C36 PolarHBondContact O-N 3.04Å
37	G	56.8	Low	59.4	Low	40 Å²	40	98.7 Å²	98.7	41%	0.412	56%	0.564	S	S	.	*	H	α-helix	trans	-80.9	-36	-180	0	0	0	0	0	113.5	A33 K34 E39 K40	A33-G37 PolarHBondContact O-N 3.31Å; K34-G37 PolarHBondContact O-N 2.92Å; G37-E39 VanDerWaalsContact C-N 3.31Å; G37-E39 PolarHBondContact O-N 2.85Å; G37-K40 PolarHBondContact O-N 3.44Å
38	E	53.9	Low	58.6	Low	125 Å²	125	99.9 Å²	99.9	58%	0.584	57%	0.565	S	S	*	*	H	α-helix	trans	-68.4	-27.6	-177	-80	-178.1	72.7	0	0	113.1	K34 K40 E41 S42	K34-E38 PolarHBondContact O-N 2.92Å; K34-E38 VanDerWaalsContact O-N 3.17Å; E38-K40 VanDerWaalsContact C-N 3.32Å; E38-K40 PolarHBondContact O-N 3.35Å; E38-E41 PolarHBondContact O-N 2.88Å; E38-S42 PolarHBondContact O-N 2.96Å
39	E	53.5	Low	57.9	Low	140 Å²	140	102.4 Å²	102.4	65%	0.654	58%	0.577	S	S	*	*	H	α-helix	trans	-70.8	-29.1	179.6	-49.5	-161.6	121.3	0	0	112.8	G37 T43	G37-E39 VanDerWaalsContact C-N 3.31Å; G37-E39 PolarHBondContact O-N 2.85Å; E39-T43 PolarHBondContact O-OG1 3.17Å
40	K	54.1	Low	57.1	Low	175 Å²	175	103.9 Å²	103.9	76%	0.761	58%	0.584	S	S	*	*	H	α-helix	trans	-79.7	-25.8	179.2	-73.8	-173.6	172.7	173.5	0	113	G37 E38	G37-K40 PolarHBondContact O-N 3.44Å; E38-K40 VanDerWaalsContact C-N 3.32Å; E38-K40 PolarHBondContact O-N 3.35Å
41	E	52.2	Low	56.2	Low	149 Å²	149	102.4 Å²	102.4	70%	0.696	58%	0.581	S	S	*	*	H	α-helix	trans	-83.5	-38.8	177.2	-162.1	155.1	115.8	0	0	111.7	E38 T43 R44 T45	E38-E41 PolarHBondContact O-N 2.88Å; E41-T43 PolarHBondContact O-N 3.17Å; E41-R44 PolarHBondContact O-N 3.42Å; E41-R44 VanDerWaalsContact O-N 3.15Å; E41-T45 PolarHBondContact O-N 2.93Å; E41-T45 PolarHBondContact O-OG1 3.22Å
42	S	53.2	Low	55.3	Low	87 Å²	87	102.5 Å²	102.5	61%	0.608	58%	0.581	S	S	*	*	H	α-helix	trans	-63.7	-28.4	178.3	-156.6	0	0	0	0	113.3	E38 A46	E38-S42 PolarHBondContact O-N 2.96Å; S42-A46 PolarHBondContact O-N 3.36Å
43	T	52.4	Low	54.4	Low	99 Å²	99	100.9 Å²	100.9	61%	0.607	59%	0.585	S	S	*	*	H	α-helix	trans	-80.2	-30.7	177.7	-41.7	0	0	0	0	112.3	E39 E41 A47	E39-T43 PolarHBondContact O-OG1 3.17Å; E41-T43 PolarHBondContact O-N 3.17Å; T43-A47 WeakPolarHBondContact O-CB 3.45Å; T43-A47 PolarHBondContact O-N 3.09Å; T43-A47 VanDerWaalsContact O-N 3.09Å
44	R	51.8	Low	53.8	Low	196 Å²	196	102.4 Å²	102.4	74%	0.74	59%	0.588	S	S	*	*	H	α-helix	trans	-70.7	-38.6	177.3	-170.6	174.6	179.5	141	-0.6	111.2	E41 A47 T48	E41-R44 PolarHBondContact O-N 3.42Å; E41-R44 VanDerWaalsContact O-N 3.15Å; R44-A47 PolarHBondContact O-N 3.35Å; R44-T48 WeakPolarHBondContact O-CB 3.49Å; R44-T48 PolarHBondContact O-N 3.06Å; R44-T48 PolarHBondContact O-OG1 3.21Å
45	T	50.1	Low	53.1	Low	85 Å²	85	98.9 Å²	98.9	52%	0.521	59%	0.586	S	S	.	*	H	α-helix	trans	-71.7	-37	179.8	-25.8	0	0	0	0	111.7	E41 T48 T49	E41-T45 PolarHBondContact O-N 2.93Å; E41-T45 PolarHBondContact O-OG1 3.22Å; T45-T48 PolarHBondContact O-N 3.22Å; T45-T49 WeakPolarHBondContact O-CG2 3.45Å; T45-T49 PolarHBondContact O-N 3.15Å; T45-T49 PolarHBondContact O-OG1 3.13Å
46	A	54.2	Low	52.4	Low	59 Å²	59	99.3 Å²	99.3	49%	0.488	59%	0.593	S	S	.	*	H	α-helix	trans	-69.4	-35.2	174.3	0	0	0	0	0	113.4	S42 T48 T49 S50	S42-A46 PolarHBondContact O-N 3.36Å; A46-T48 VanDerWaalsContact C-N 3.34Å; A46-T49 PolarHBondContact O-OG1 3.44Å; A46-S50 WeakPolarHBondContact O-CB 3.41Å; A46-S50 PolarHBondContact O-N 3.13Å; A46-S50 VanDerWaalsContact O-N 3.13Å
47	A	53.2	Low	51.9	Low	62 Å²	62	99 Å²	99	51%	0.512	60%	0.598	S	S	.	*	H	α-helix	trans	-70.2	-31.6	173.9	0	0	0	0	0	112.3	T43 R44 N51	T43-A47 WeakPolarHBondContact O-CB 3.45Å; T43-A47 PolarHBondContact O-N 3.09Å; T43-A47 VanDerWaalsContact O-N 3.09Å; R44-A47 PolarHBondContact O-N 3.35Å; A47-N51 WeakPolarHBondContact O-CB 3.36Å; A47-N51 PolarHBondContact O-N 2.64Å; A47-N51 VanDerWaalsContact O-N 3.13Å
48	T	52.6	Low	51.2	Low	87 Å²	87	104.5 Å²	104.5	53%	0.534	61%	0.612	S	S	.	*	H	α-helix	trans	-78.6	-33.9	-179.9	-46.3	0	0	0	0	111.8	R44 T45 A46 A52	R44-T48 WeakPolarHBondContact O-CB 3.49Å; R44-T48 PolarHBondContact O-N 3.06Å; R44-T48 PolarHBondContact O-OG1 3.21Å; T45-T48 PolarHBondContact O-N 3.22Å; A46-T48 VanDerWaalsContact C-N 3.34Å; T48-A52 WeakPolarHBondContact O-CB 3.18Å; T48-A52 PolarHBondContact O-N 3.04Å; T48-A52 VanDerWaalsContact O-N 3.13Å
49	T	53	Low	50.7	Low	96 Å²	96	103.9 Å²	103.9	59%	0.589	61%	0.613	S	S	*	*	H	α-helix	trans	-75.1	-27.6	173.4	54.2	0	0	0	0	113.1	T45 A46	T45-T49 WeakPolarHBondContact O-CG2 3.45Å; T45-T49 PolarHBondContact O-N 3.15Å; T45-T49 PolarHBondContact O-OG1 3.13Å; A46-T49 PolarHBondContact O-OG1 3.44Å
50	S	51.3	Low	50.5	Low	77 Å²	77	102.5 Å²	102.5	54%	0.538	62%	0.616	S	S	.	*	H	α-helix	trans	-72.2	-40.7	173.2	-165.2	0	0	0	0	111.2	A46 A52 A53 V54	A46-S50 WeakPolarHBondContact O-CB 3.41Å; A46-S50 PolarHBondContact O-N 3.13Å; A46-S50 VanDerWaalsContact O-N 3.13Å; S50-A52 VanDerWaalsContact C-N 3.34Å; S50-A52 PolarHBondContact O-N 3.49Å; S50-A53 PolarHBondContact O-N 3.46Å; S50-V54 WeakPolarHBondContact O-CG2 3.49Å; S50-V54 PolarHBondContact O-N 3.4Å
51	N	48.5	Very low	50.2	Low	112 Å²	112	97.5 Å²	97.5	60%	0.599	61%	0.608	S	S	*	*	H	α-helix	trans	-74.4	-22.3	178.8	-146.4	16.9	0	0	0	113.7	A47 A53 V54 A55	A47-N51 WeakPolarHBondContact O-CB 3.36Å; A47-N51 PolarHBondContact O-N 2.64Å; A47-N51 VanDerWaalsContact O-N 3.13Å; N51-A53 VanDerWaalsContact C-N 3.32Å; N51-V54 PolarHBondContact O-N 3.13Å; N51-A55 WeakPolarHBondContact O-CB 3.14Å; N51-A55 PolarHBondContact O-N 3.41Å
52	A	50.6	Low	50	Low	58 Å²	58	97.1 Å²	97.1	48%	0.479	61%	0.61	S	S	.	*	H	α-helix	trans	-72.2	-24.6	170.9	0	0	0	0	0	112.9	T48 S50 S56	T48-A52 WeakPolarHBondContact O-CB 3.18Å; T48-A52 PolarHBondContact O-N 3.04Å; T48-A52 VanDerWaalsContact O-N 3.13Å; S50-A52 VanDerWaalsContact C-N 3.34Å; S50-A52 PolarHBondContact O-N 3.49Å; A52-S56 PolarHBondContact O-OG 2.92Å
53	A	52.5	Low	50	Low	75 Å²	75	101.3 Å²	101.3	62%	0.62	62%	0.62	S	S	*	*	H	α-helix	trans	-80.5	-25.5	173.7	0	0	0	0	0	112.8	S50 N51	S50-A53 PolarHBondContact O-N 3.46Å; N51-A53 VanDerWaalsContact C-N 3.32Å
54	V	53	Low	50.2	Low	96 Å²	96	101.4 Å²	101.4	58%	0.582	62%	0.622	S	S	*	*	H	α-helix	trans	-92.8	-23.2	176.4	-139.8	0	0	0	0	112.8	S50 N51	S50-V54 WeakPolarHBondContact O-CG2 3.49Å; S50-V54 PolarHBondContact O-N 3.4Å; N51-V54 PolarHBondContact O-N 3.13Å
55	A	47.1	Very low	50.2	Low	71 Å²	71	97.7 Å²	97.7	59%	0.587	63%	0.625	S	S	*	*	H	α-helix	trans	-81.3	-17	177.1	0	0	0	0	0	114.1	N51	N51-A55 WeakPolarHBondContact O-CB 3.14Å; N51-A55 PolarHBondContact O-N 3.41Å
56	S	47.3	Very low	50.3	Low	109 Å²	109	102.3 Å²	102.3	76%	0.762	64%	0.64	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91.5	1.2	172.5	-62.8	0	0	0	0	114	A52	A52-S56 PolarHBondContact O-OG 2.92Å
57	A	49.1	Very low	50.1	Low	82 Å²	82	110.9 Å²	110.9	68%	0.678	66%	0.66	S	S	*	*	S	Bend	trans	-100.9	1.4	177.9	0	0	0	0	0	113.7
58	H	42.7	Very low	50.2	Low	154 Å²	154	119.5 Å²	119.5	71%	0.713	68%	0.679	S	S	*	*			trans	-104.5	66	172.5	-161.7	-76.9	0	0	0	109.5	P60	H58-P60 WeakPolarHBondContact O-CD 2.98Å
59	D	41.7	Very low	50.2	Low	112 Å²	112	120.6 Å²	120.6	60%	0.599	69%	0.691	S	S	*	*			trans	-79.1	108.5	161.1	-170.1	-4.8	0	0	0	107.8	A61	D59-A61 PolarHBondContact O-N 2.83Å; D59-A61 VanDerWaalsContact O-N 3.16Å; D59-A61 WeakPolarHBondContact OD1-CA 3.44Å; D59-A61 WeakPolarHBondContact OD1-CB 3.2Å; D59-A61 PolarHBondContact OD1-N 3.16Å
60	P	50	Low	50.3	Low	112 Å²	112	122.2 Å²	122.2	73%	0.727	70%	0.701	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72.8	9.4	170.7	32.7	-34.3	0	0	0	112.5	H58 D62	H58-P60 WeakPolarHBondContact O-CD 2.98Å; P60-D62 VanDerWaalsContact C-N 3.28Å
61	A	46.8	Very low	50.5	Low	70 Å²	70	129.7 Å²	129.7	58%	0.579	72%	0.717	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84.6	9.8	173.7	0	0	0	0	0	114.5	D59 E63	D59-A61 PolarHBondContact O-N 2.83Å; D59-A61 VanDerWaalsContact O-N 3.16Å; D59-A61 WeakPolarHBondContact OD1-CA 3.44Å; D59-A61 WeakPolarHBondContact OD1-CB 3.2Å; D59-A61 PolarHBondContact OD1-N 3.16Å; A61-E63 PolarHBondContact O-N 3.14Å
62	D	49.6	Very low	51.1	Low	141 Å²	141	131.7 Å²	131.7	75%	0.754	73%	0.727	S	S	*	*			trans	-75.7	58.5	165.8	-140.9	-86.8	0	0	0	110.5	P60 P64	P60-D62 VanDerWaalsContact C-N 3.28Å; D62-P64 VanDerWaalsContact O-CD 3.26Å; D62-P64 WeakPolarHBondContact O-CD 3.26Å
63	E	52.9	Low	51.2	Low	174 Å²	174	140 Å²	140	81%	0.813	75%	0.746	S	S	*	*			trans	-69.1	112.2	158.5	-113.4	-94.7	114.6	0	0	106.2	A61 C65	A61-E63 PolarHBondContact O-N 3.14Å; E63-C65 PolarHBondContact O-N 2.96Å
64	P	56.9	Low	51.4	Low	101 Å²	101	142.5 Å²	142.5	66%	0.656	76%	0.759	S	S	*	*			trans	-70.7	110.9	-174	-15.4	30.2	0	0	0	110.6	D62	D62-P64 VanDerWaalsContact O-CD 3.26Å; D62-P64 WeakPolarHBondContact O-CD 3.26Å
65	C	51.1	Low	51.6	Low	118 Å²	118	143.5 Å²	143.5	80%	0.797	77%	0.77	S	S	*	*			trans	74.5	95.6	141.4	-68.4	0	0	0	0	117.8	E63 R67	E63-C65 PolarHBondContact O-N 2.96Å; C65-R67 PolarHBondContact O-N 2.87Å; C65-R67 VanDerWaalsContact O-N 3.14Å
66	H	52.9	Low	52	Low	182 Å²	182	143.9 Å²	143.9	84%	0.843	78%	0.781	S	S	*	*			trans	-28.3	113.5	141.9	-68.7	-53.5	0	0	0	114.4
67	R	48.4	Very low	52.6	Low	239 Å²	239	144.3 Å²	144.3	90%	0.902	78%	0.784	S	S	*	*				47.1	81.6	118.3	-145.6	-171.5	-155.4	-160.7	8.2	115.3	C65	C65-R67 PolarHBondContact O-N 2.87Å; C65-R67 VanDerWaalsContact O-N 3.14Å
68	R	56.8	Low	53	Low	243 Å²	243	151.4 Å²	151.4	92%	0.917	79%	0.793	S	S	*	*			trans	-129.2	100	155.4	-69.1	-175.6	100	163.5	3.8	111.1
69	S	51.2	Low	53.8	Low	110 Å²	110	152.6 Å²	152.6	77%	0.769	80%	0.798	S	S	*	*			trans	-3.4	134.9	147.3	-62	0	0	0	0	117.9
70	T	56.6	Low	54.3	Low	130 Å²	130	160 Å²	160	80%	0.798	83%	0.83	S	S	*	*				179.3	101.3	107.3	41.7	0	0	0	0	108.3
71	R	55.1	Low	54.6	Low	234 Å²	234	162.5 Å²	162.5	88%	0.883	84%	0.835	S	S	*	*				28.6	107.8	108.7	-73.3	-168.7	-159.9	-170.6	6.1	114
72	L	60.6	Low	55	Low	154 Å²	154	167.3 Å²	167.3	81%	0.806	85%	0.848	S	S	*	*				154.3	112.7	115.8	-83.7	148.5	0	0	0	111.3
73	R	53.5	Low	55.3	Low	233 Å²	233	168.8 Å²	168.8	88%	0.879	85%	0.854	S	S	*	*			trans	21.6	117.6	139.7	-65.3	-179.1	163.2	-170.5	-5.7	116.9
74	S	55.8	Low	55.4	Low	127 Å²	127	168.5 Å²	168.5	89%	0.888	86%	0.856	S	S	*	*			trans	-143.1	110.4	131.6	-132.4	0	0	0	0	110.4
75	S	57.5	Low	55.3	Low	117 Å²	117	172.7 Å²	172.7	82%	0.818	87%	0.869	S	S	*	*			trans	-69	139.6	173.4	38.5	0	0	0	0	111.4
76	G	55.7	Low	55.6	Low	79 Å²	79	176.3 Å²	176.3	81%	0.814	87%	0.873	S	S	*	*			trans	112.3	111.3	149	0	0	0	0	0	115.5
77	S	59.5	Low	55.8	Low	118 Å²	118	175.9 Å²	175.9	83%	0.825	88%	0.876	S	S	*	*				-167.7	115.7	114.1	-168.6	0	0	0	0	109
78	R	57.6	Low	56.4	Low	231 Å²	231	171.1 Å²	171.1	87%	0.872	87%	0.874	S	S	*	*			trans	-120.7	99.9	167.4	-177.6	-163.4	-69.9	-145.2	1.7	104.8
79	H	60.3	Low	56.3	Low	179 Å²	179	165.1 Å²	165.1	83%	0.829	87%	0.87	S	S	*	*			trans	-169.2	109.4	161.8	-84.9	101.5	0	0	0	107.3
80	Q	52.7	Low	56.8	Low	269 Å²	269	170.1 Å²	170.1	100%	1.257	88%	0.879	S	S	*	*				-174.5	0	100.4	-80.6	-150.9	100.4	0	0	108.9

Retrieved 80 of 80 residues in 79.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).