A0A077ZJV3_TRITR Loading...

Trehalase

AlphaFold DB , UniProt , Accession A0A077ZJV3, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 61 aa.

						>A0A077ZJV3_TRITR|A0A077ZJV3
MNARLLAELNKKLAKKVLKYVHWNEKNGVWYDYDLDWKEHMKSYYISNAVPLYNRCFDNEN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	66.3	Low	92.3	Very high	161 Å²	161	103 Å²	103	79%	0.793	54%	0.538	S	S	*	.				0	125.9	0	177.1	167	62	0	0	108.1	L5 L6 L9	M1-L5 HydrophobicContact CG-CB 4.15Å; M1-L5 HydrophobicContact CG-CD2 4.06Å; M1-L5 HydrophobicContact CG-CG 4.14Å; M1-L5 HydrophobicContact SD-CG 4.45Å; M1-L6 HydrophobicContact CE-CB 4.04Å; M1-L6 HydrophobicContact CE-CD1 3.73Å; M1-L6 HydrophobicContact CE-CD2 4.38Å; M1-L6 HydrophobicContact CE-CG 4.25Å; M1-L6 HydrophobicContact CG-CB 4.37Å; M1-L6 HydrophobicContact SD-CB 4.14Å; M1-L6 HydrophobicContact SD-CD1 4.39Å; M1-L9 HydrophobicContact SD-CD1 4.03Å
2	N	90	Very high	92.4	Very high	102 Å²	102	102.3 Å²	102.3	55%	0.545	53%	0.527	S	S	.	.			trans	-82	162.8	177.6	85.3	-1	0	0	0	111	R4 L5 L6	N2-R4 PolarHBondContact O-N 3.5Å; N2-R4 WeakPolarHBondContact OD1-CB 3.49Å; N2-R4 PolarHBondContact OD1-N 2.98Å; N2-L5 PolarHBondContact O-N 3.31Å; N2-L5 PolarHBondContact OD1-N 3.27Å; N2-L6 PolarHBondContact O-N 2.79Å
3	A	95	Very high	92.6	Very high	85 Å²	85	102.5 Å²	102.5	70%	0.702	53%	0.529	S	S	*	.	H	α-helix	trans	-58.2	-34.6	-177	0	0	0	0	0	113.3	L6 A7	A3-L6 PolarHBondContact O-N 3.3Å; A3-A7 WeakPolarHBondContact O-CB 3.31Å; A3-A7 PolarHBondContact O-N 3.38Å
4	R	96.5	Very high	92.7	Very high	177 Å²	177	98.8 Å²	98.8	67%	0.668	52%	0.521	S	S	*	.	H	α-helix	trans	-64.1	-47.4	178.1	178.2	179.6	170.2	176.3	-0.5	112	N2 L6 A7 E8	N2-R4 PolarHBondContact O-N 3.5Å; N2-R4 WeakPolarHBondContact OD1-CB 3.49Å; N2-R4 PolarHBondContact OD1-N 2.98Å; R4-L6 VanDerWaalsContact C-N 3.33Å; R4-L6 PolarHBondContact O-N 2.9Å; R4-A7 PolarHBondContact O-N 2.88Å; R4-E8 IonicContact CZ-OE1 3.62Å; R4-E8 IonicContact NE-OE1 2.89Å; R4-E8 PolarHBondContact NE-OE1 2.9Å; R4-E8 IonicContact NH2-OE1 3.44Å; R4-E8 PolarHBondContact NH2-OE1 2.93Å; R4-E8 WeakPolarHBondContact O-CG 3.3Å; R4-E8 PolarHBondContact O-N 3.33Å
5	L	96	Very high	92.9	Very high	80 Å²	80	94.5 Å²	94.5	42%	0.419	50%	0.496	S	S	.	.	H	α-helix	trans	-63.4	-41.1	179.8	179.1	58.2	0	0	0	111.3	M1 N2 A7 E8 L9	M1-L5 HydrophobicContact CG-CB 4.15Å; M1-L5 HydrophobicContact CG-CD2 4.06Å; M1-L5 HydrophobicContact CG-CG 4.14Å; M1-L5 HydrophobicContact SD-CG 4.45Å; N2-L5 PolarHBondContact O-N 3.31Å; N2-L5 PolarHBondContact OD1-N 3.27Å; L5-A7 PolarHBondContact O-N 2.91Å; L5-E8 PolarHBondContact O-N 3.44Å; L5-L9 HydrophobicContact CD1-CD1 4.27Å; L5-L9 HydrophobicContact CD1-CG 4.27Å; L5-L9 HydrophobicContact CG-CD1 4.15Å; L5-L9 WeakPolarHBondContact O-CB 3.39Å; L5-L9 VanDerWaalsContact O-CG 3.29Å; L5-L9 WeakPolarHBondContact O-CG 3.28Å; L5-L9 PolarHBondContact O-N 2.88Å
6	L	96.9	Very high	93	Very high	75 Å²	75	98.1 Å²	98.1	39%	0.393	51%	0.506	S	S	.	.	H	α-helix	trans	-62.2	-42.7	174.8	179	58.4	0	0	0	111.7	M1 N2 A3 R4 L9 N10	M1-L6 HydrophobicContact CE-CB 4.04Å; M1-L6 HydrophobicContact CE-CD1 3.73Å; M1-L6 HydrophobicContact CE-CD2 4.38Å; M1-L6 HydrophobicContact CE-CG 4.25Å; M1-L6 HydrophobicContact CG-CB 4.37Å; M1-L6 HydrophobicContact SD-CB 4.14Å; M1-L6 HydrophobicContact SD-CD1 4.39Å; N2-L6 PolarHBondContact O-N 2.79Å; A3-L6 PolarHBondContact O-N 3.3Å; R4-L6 VanDerWaalsContact C-N 3.33Å; R4-L6 PolarHBondContact O-N 2.9Å; L6-L9 PolarHBondContact O-N 2.71Å; L6-N10 WeakPolarHBondContact O-CB 3.44Å; L6-N10 VanDerWaalsContact O-CG 3.25Å; L6-N10 PolarHBondContact O-N 3.12Å; L6-N10 PolarHBondContact O-ND2 2.99Å
7	A	95.9	Very high	93.1	Very high	58 Å²	58	96.7 Å²	96.7	48%	0.479	50%	0.503	S	S	.	.	H	α-helix	trans	-63.7	-42.1	177.1	0	0	0	0	0	112.4	A3 R4 L5 N10 K11	A3-A7 WeakPolarHBondContact O-CB 3.31Å; A3-A7 PolarHBondContact O-N 3.38Å; R4-A7 PolarHBondContact O-N 2.88Å; L5-A7 PolarHBondContact O-N 2.91Å; A7-N10 PolarHBondContact O-N 2.84Å; A7-K11 WeakPolarHBondContact O-CB 3.05Å; A7-K11 PolarHBondContact O-N 3.34Å
8	E	94.9	Very high	93.2	Very high	83 Å²	83	94.2 Å²	94.2	39%	0.388	49%	0.49	S	S	.	.	H	α-helix	trans	-63.9	-43.6	176.2	-73.1	173	-177.9	0	0	111.5	R4 L5 K11 K12	R4-E8 IonicContact CZ-OE1 3.62Å; R4-E8 IonicContact NE-OE1 2.89Å; R4-E8 PolarHBondContact NE-OE1 2.9Å; R4-E8 IonicContact NH2-OE1 3.44Å; R4-E8 PolarHBondContact NH2-OE1 2.93Å; R4-E8 WeakPolarHBondContact O-CG 3.3Å; R4-E8 PolarHBondContact O-N 3.33Å; L5-E8 PolarHBondContact O-N 3.44Å; E8-K11 PolarHBondContact O-N 2.86Å; E8-K12 WeakPolarHBondContact O-CG 3.46Å; E8-K12 PolarHBondContact O-N 2.92Å
9	L	94.7	Very high	93.2	Very high	89 Å²	89	92.2 Å²	92.2	47%	0.466	48%	0.477	S	S	.	.	H	α-helix	trans	-63.4	-46.2	175.6	-72.3	171.1	0	0	0	112.1	M1 L5 L6 K11 K12 L13	M1-L9 HydrophobicContact SD-CD1 4.03Å; L5-L9 HydrophobicContact CD1-CD1 4.27Å; L5-L9 HydrophobicContact CD1-CG 4.27Å; L5-L9 HydrophobicContact CG-CD1 4.15Å; L5-L9 WeakPolarHBondContact O-CB 3.39Å; L5-L9 VanDerWaalsContact O-CG 3.29Å; L5-L9 WeakPolarHBondContact O-CG 3.28Å; L5-L9 PolarHBondContact O-N 2.88Å; L6-L9 PolarHBondContact O-N 2.71Å; L9-K11 VanDerWaalsContact C-N 3.32Å; L9-K11 PolarHBondContact O-N 3.18Å; L9-K12 PolarHBondContact O-N 3.06Å; L9-L13 WeakPolarHBondContact O-CB 3.48Å; L9-L13 PolarHBondContact O-N 2.92Å
10	N	95.2	Very high	93.3	Very high	90 Å²	90	97.8 Å²	97.8	48%	0.481	49%	0.493	S	S	.	.	H	α-helix	trans	-61.1	-41.3	177.2	-75.7	-15.7	0	0	0	111.6	L6 A7 L13 A14	L6-N10 WeakPolarHBondContact O-CB 3.44Å; L6-N10 VanDerWaalsContact O-CG 3.25Å; L6-N10 PolarHBondContact O-N 3.12Å; L6-N10 PolarHBondContact O-ND2 2.99Å; A7-N10 PolarHBondContact O-N 2.84Å; N10-L13 PolarHBondContact O-N 3.4Å; N10-A14 VanDerWaalsContact O-CB 3.29Å; N10-A14 WeakPolarHBondContact O-CB 3.49Å; N10-A14 PolarHBondContact O-N 3.38Å
11	K	94.2	Very high	93.4	Very high	133 Å²	133	95 Å²	95	58%	0.578	48%	0.481	S	S	*	.	H	α-helix	trans	-61.9	-45.7	175.5	-177.3	177.8	-179.6	177.8	0	111.6	A7 E8 L9 A14 K15	A7-K11 WeakPolarHBondContact O-CB 3.05Å; A7-K11 PolarHBondContact O-N 3.34Å; E8-K11 PolarHBondContact O-N 2.86Å; L9-K11 VanDerWaalsContact C-N 3.32Å; L9-K11 PolarHBondContact O-N 3.18Å; K11-A14 PolarHBondContact O-N 3.15Å; K11-K15 WeakPolarHBondContact O-CG 3.13Å; K11-K15 PolarHBondContact O-N 3.35Å
12	K	93.8	Very high	94.8	Very high	94 Å²	94	89.4 Å²	89.4	41%	0.409	45%	0.453	S	S	.	.	H	α-helix	trans	-62.9	-42.9	177.5	-73.2	-175.7	-176.6	-146.5	0	111.8	E8 L9 K16 N61	E8-K12 WeakPolarHBondContact O-CG 3.46Å; E8-K12 PolarHBondContact O-N 2.92Å; L9-K12 PolarHBondContact O-N 3.06Å; K12-K16 WeakPolarHBondContact O-CG 3.29Å; K12-K16 PolarHBondContact O-N 3Å; K12-N61 VanDerWaalsContact CE-OXT 3.23Å; K12-N61 WeakPolarHBondContact CE-OXT 3.5Å; K12-N61 PolarHBondContact NZ-OXT 3.24Å
13	L	94.9	Very high	95.2	Very high	106 Å²	106	88.1 Å²	88.1	56%	0.555	44%	0.441	S	S	*	.	H	α-helix	trans	-63.8	-46.8	176.5	-177.9	61.6	0	0	0	111.3	L9 N10 K15 K16 V17	L9-L13 WeakPolarHBondContact O-CB 3.48Å; L9-L13 PolarHBondContact O-N 2.92Å; N10-L13 PolarHBondContact O-N 3.4Å; L13-K15 VanDerWaalsContact C-N 3.34Å; L13-K15 PolarHBondContact O-N 3.23Å; L13-K16 WeakPolarHBondContact O-CB 3.38Å; L13-K16 PolarHBondContact O-N 3.25Å; L13-K16 VanDerWaalsContact O-N 3.13Å; L13-V17 HydrophobicContact CD1-CG2 4.22Å; L13-V17 HydrophobicContact CG-CG2 4.36Å; L13-V17 WeakPolarHBondContact O-CG2 3.32Å; L13-V17 PolarHBondContact O-N 2.74Å
14	A	94.3	Very high	95.2	Very high	50 Å²	50	85.5 Å²	85.5	41%	0.413	42%	0.415	S	S	.	.	H	α-helix	trans	-58.1	-43.8	178.5	0	0	0	0	0	112.1	N10 K11 K16 V17 L18	N10-A14 VanDerWaalsContact O-CB 3.29Å; N10-A14 WeakPolarHBondContact O-CB 3.49Å; N10-A14 PolarHBondContact O-N 3.38Å; K11-A14 PolarHBondContact O-N 3.15Å; A14-K16 VanDerWaalsContact C-N 3.34Å; A14-K16 PolarHBondContact O-N 2.89Å; A14-V17 PolarHBondContact O-N 2.87Å; A14-L18 WeakPolarHBondContact O-CB 3.35Å; A14-L18 VanDerWaalsContact O-CG 3.32Å; A14-L18 WeakPolarHBondContact O-CG 3.3Å; A14-L18 PolarHBondContact O-N 3.17Å
15	K	94.8	Very high	95.1	Very high	34 Å²	34	84.4 Å²	84.4	15%	0.148	42%	0.417	C	S	.	.	H	α-helix	trans	-58.4	-44.7	174.7	-74.1	-174.4	169.5	-148.5	0	112.6	K11 L13 K19 N54 R55	K11-K15 WeakPolarHBondContact O-CG 3.13Å; K11-K15 PolarHBondContact O-N 3.35Å; L13-K15 VanDerWaalsContact C-N 3.34Å; L13-K15 PolarHBondContact O-N 3.23Å; K15-K19 PolarHBondContact O-N 2.93Å; K15-N54 WeakPolarHBondContact CE-O 3.46Å; K15-N54 PolarHBondContact NZ-O 3.44Å; K15-R55 PolarHBondContact NZ-O 2.94Å
16	K	94	Very high	95.1	Very high	153 Å²	153	89.7 Å²	89.7	67%	0.665	44%	0.437	S	S	*	.	H	α-helix	trans	-64.6	-44.4	178.6	-73.3	178.7	176	-174.9	0	111.8	K12 L13 A14 K19 Y20	K12-K16 WeakPolarHBondContact O-CG 3.29Å; K12-K16 PolarHBondContact O-N 3Å; L13-K16 WeakPolarHBondContact O-CB 3.38Å; L13-K16 PolarHBondContact O-N 3.25Å; L13-K16 VanDerWaalsContact O-N 3.13Å; A14-K16 VanDerWaalsContact C-N 3.34Å; A14-K16 PolarHBondContact O-N 2.89Å; K16-K19 PolarHBondContact O-N 3.35Å; K16-Y20 WeakPolarHBondContact O-CB 3.05Å; K16-Y20 PolarHBondContact O-N 2.67Å
17	V	94.6	Very high	95	Very high	74 Å²	74	89.8 Å²	89.8	45%	0.448	44%	0.437	S	S	.	.	H	α-helix	trans	-64.1	-46.6	177.8	171.7	0	0	0	0	110.7	L13 A14 K19 Y20 V21	L13-V17 HydrophobicContact CD1-CG2 4.22Å; L13-V17 HydrophobicContact CG-CG2 4.36Å; L13-V17 WeakPolarHBondContact O-CG2 3.32Å; L13-V17 PolarHBondContact O-N 2.74Å; A14-V17 PolarHBondContact O-N 2.87Å; V17-K19 VanDerWaalsContact C-N 3.31Å; V17-K19 PolarHBondContact O-N 3.28Å; V17-Y20 PolarHBondContact O-N 2.8Å; V17-V21 HydrophobicContact CG1-CG2 4.09Å; V17-V21 WeakPolarHBondContact O-CB 3.5Å; V17-V21 WeakPolarHBondContact O-CG2 3.32Å; V17-V21 PolarHBondContact O-N 3.03Å
18	L	94.9	Very high	95	Very high	51 Å²	51	88.9 Å²	88.9	27%	0.267	43%	0.434	S	S	.	.	H	α-helix	trans	-53.7	-52.8	175.2	-75.8	170.6	0	0	0	109.5	A14 Y20 V21 H22 W30	A14-L18 WeakPolarHBondContact O-CB 3.35Å; A14-L18 VanDerWaalsContact O-CG 3.32Å; A14-L18 WeakPolarHBondContact O-CG 3.3Å; A14-L18 PolarHBondContact O-N 3.17Å; L18-Y20 PolarHBondContact O-N 3.35Å; L18-V21 PolarHBondContact O-N 3.01Å; L18-H22 WeakPolarHBondContact O-CB 3.22Å; L18-H22 PolarHBondContact O-N 3.38Å; L18-W30 VanDerWaalsContact C-CZ3 3.42Å; L18-W30 HydrophobicContact CB-CZ3 4.3Å; L18-W30 VanDerWaalsContact O-CZ3 3.24Å; L18-W30 WeakPolarHBondContact O-CZ3 3.24Å
19	K	94.8	Very high	95	Very high	56 Å²	56	87 Å²	87	24%	0.243	43%	0.429	C	S	.	.	H	α-helix	trans	-57.8	-46.8	179	-168.9	174.2	-174.1	165	0	112.7	K15 K16 V17 W23 W30 C56 F57 N59	K15-K19 PolarHBondContact O-N 2.93Å; K16-K19 PolarHBondContact O-N 3.35Å; V17-K19 VanDerWaalsContact C-N 3.31Å; V17-K19 PolarHBondContact O-N 3.28Å; K19-W23 HydrophobicContact CG-CB 4.46Å; K19-W23 WeakPolarHBondContact O-CB 3.44Å; K19-W23 PolarHBondContact O-N 3.35Å; K19-W30 HydrophobicContact CB-CH2 3.7Å; K19-W30 HydrophobicContact CB-CZ3 4.25Å; K19-W30 HydrophobicContact CG-CH2 3.89Å; K19-C56 WeakPolarHBondContact CD-O 3.48Å; K19-F57 PolarHBondContact NZ-O 3.5Å; K19-F57 VanDerWaalsContact NZ-O 3.1Å; K19-N59 PolarHBondContact NZ-OD1 3.1Å
20	Y	94.6	Very high	95.1	Very high	204 Å²	204	83.3 Å²	83.3	80%	0.8	41%	0.408	S	S	*	.	H	α-helix	trans	-65	-42.1	-177.9	-179.6	-99.9	0	0	0	113.1	K16 V17 L18	K16-Y20 WeakPolarHBondContact O-CB 3.05Å; K16-Y20 PolarHBondContact O-N 2.67Å; V17-Y20 PolarHBondContact O-N 2.8Å; L18-Y20 PolarHBondContact O-N 3.35Å
21	V	95.6	Very high	95.1	Very high	39 Å²	39	80.3 Å²	80.3	24%	0.236	39%	0.39	C	S	.	.	H	α-helix	trans	-85.5	-44.5	-172.5	175.6	0	0	0	0	112	V17 L18 Y33 H40	V17-V21 HydrophobicContact CG1-CG2 4.09Å; V17-V21 WeakPolarHBondContact O-CB 3.5Å; V17-V21 WeakPolarHBondContact O-CG2 3.32Å; V17-V21 PolarHBondContact O-N 3.03Å; L18-V21 PolarHBondContact O-N 3.01Å; V21-Y33 HydrophobicContact CG1-CD1 4.05Å; V21-Y33 HydrophobicContact CG1-CD2 4.41Å; V21-Y33 HydrophobicContact CG1-CG 3.75Å; V21-H40 PolarHBondContact O-NE2 3.13Å
22	H	96.3	Very high	95.3	Very high	44 Å²	44	76.1 Å²	76.1	20%	0.204	37%	0.374	C	S	.	.	H	α-helix	trans	-99.1	-20.4	-166.1	-67.7	-89.2	0	0	0	113.8	L18 N24 W30 Y31	L18-H22 WeakPolarHBondContact O-CB 3.22Å; L18-H22 PolarHBondContact O-N 3.38Å; H22-N24 PolarHBondContact O-N 3.41Å; H22-W30 HydrophobicContact CB-CE3 3.68Å; H22-W30 HydrophobicContact CB-CZ3 4.25Å; H22-W30 CarbonylContact O-C 3.54Å; H22-W30 VanDerWaalsContact O-CA 3.3Å; H22-W30 WeakPolarHBondContact O-CA 3.25Å; H22-Y31 WeakPolarHBondContact CA-O 3.35Å; H22-Y31 WeakPolarHBondContact CB-O 3.41Å; H22-Y31 PolarHBondContact ND1-O 3.41Å; H22-Y31 PolarHBondContact O-N 3.27Å
23	W	96.6	Very high	95.4	Very high	76 Å²	76	75.4 Å²	75.4	29%	0.288	37%	0.369	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.6	122.8	178.5	179.6	-114.3	0	0	0	111	K19 E25 G28 W30 H40	K19-W23 HydrophobicContact CG-CB 4.46Å; K19-W23 WeakPolarHBondContact O-CB 3.44Å; K19-W23 PolarHBondContact O-N 3.35Å; W23-E25 PolarHBondContact NE1-OE2 3.23Å; W23-G28 VanDerWaalsContact CH2-O 3.28Å; W23-G28 WeakPolarHBondContact CH2-O 3.47Å; W23-G28 VanDerWaalsContact CZ3-O 3.3Å; W23-G28 WeakPolarHBondContact CZ3-O 3.16Å; W23-W30 HydrophobicContact CB-CD2 4.45Å; W23-W30 HydrophobicContact CB-CE3 4.26Å; W23-W30 HydrophobicContact CB-CH2 4.34Å; W23-W30 HydrophobicContact CB-CZ2 4.46Å; W23-W30 HydrophobicContact CB-CZ3 4.25Å; W23-W30 AromaticContact CE3-CD1 3.72Å; W23-W30 AromaticContact CE3-CD2 3.99Å; W23-W30 HydrophobicContact CE3-CD2 3.99Å; W23-W30 AromaticContact CE3-CE2 3.61Å; W23-W30 HydrophobicContact CE3-CG 4.06Å; W23-W30 HydrophobicContact CE3-CZ2 4.2Å; W23-W30 AromaticContact CE3-NE1 3.4Å; W23-W30 AromaticContact CZ3-CD1 3.84Å; W23-W30 AromaticContact CZ3-NE1 3.57Å; W23-H40 PolarHBondContact O-CE1 2.9Å
24	N	96.3	Very high	95.4	Very high	30 Å²	30	72 Å²	72	16%	0.16	35%	0.352	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.2	104.6	170.1	-174.1	-78.6	0	0	0	109.8	H22 K26 N27 G28 V29 Y31 H40	H22-N24 PolarHBondContact O-N 3.41Å; N24-K26 VanDerWaalsContact C-N 3.25Å; N24-K26 PolarHBondContact O-N 2.9Å; N24-K26 WeakPolarHBondContact OD1-CB 3.33Å; N24-K26 PolarHBondContact OD1-N 3.43Å; N24-N27 PolarHBondContact O-N 2.86Å; N24-N27 WeakPolarHBondContact OD1-CB 3.29Å; N24-N27 PolarHBondContact OD1-N 3.19Å; N24-G28 PolarHBondContact O-N 3.45Å; N24-V29 WeakPolarHBondContact CB-O 3.46Å; N24-V29 PolarHBondContact N-O 3.04Å; N24-Y31 HydrophobicContact CB-CD2 3.63Å; N24-Y31 HydrophobicContact CB-CE2 3.75Å; N24-H40 PolarHBondContact ND2-ND1 3.21Å
25	E	94.7	Very high	95.5	Very high	154 Å²	154	76.1 Å²	76.1	72%	0.72	37%	0.366	S	S	*	.	T	Hydrogen-bonded Turn	trans	-57.8	-37	-178.4	-171.6	66.6	-163.6	0	0	112.7	W23	W23-E25 PolarHBondContact NE1-OE2 3.23Å
26	K	95.4	Very high	95.6	Very high	190 Å²	190	81.5 Å²	81.5	83%	0.826	40%	0.397	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66.8	-42.4	-177.2	-180	179.4	177.8	177.2	0	112.3	N24	N24-K26 VanDerWaalsContact C-N 3.25Å; N24-K26 PolarHBondContact O-N 2.9Å; N24-K26 WeakPolarHBondContact OD1-CB 3.33Å; N24-K26 PolarHBondContact OD1-N 3.43Å
27	N	95.2	Very high	95.7	Very high	77 Å²	77	83.6 Å²	83.6	41%	0.412	40%	0.401	S	S	.	.	T	Hydrogen-bonded Turn	trans	-94.8	-15.8	-175.7	-65.2	-5.3	0	0	0	112.5	N24 V29 Y31	N24-N27 PolarHBondContact O-N 2.86Å; N24-N27 WeakPolarHBondContact OD1-CB 3.29Å; N24-N27 PolarHBondContact OD1-N 3.19Å; N27-V29 VanDerWaalsContact C-N 3.3Å; N27-V29 HydrophobicContact CB-CB 4.47Å; N27-V29 PolarHBondContact O-N 3.47Å; N27-Y31 HydrophobicContact CB-CE2 4.09Å; N27-Y31 PolarHBondContact ND2-OH 2.88Å
28	G	94.6	Very high	95.8	Very high	40 Å²	40	87.5 Å²	87.5	41%	0.412	41%	0.411	S	S	.	.	T	Hydrogen-bonded Turn	trans	67.7	29.5	-174.7	0	0	0	0	0	113.2	W23 N24	W23-G28 VanDerWaalsContact CH2-O 3.28Å; W23-G28 WeakPolarHBondContact CH2-O 3.47Å; W23-G28 VanDerWaalsContact CZ3-O 3.3Å; W23-G28 WeakPolarHBondContact CZ3-O 3.16Å; N24-G28 PolarHBondContact O-N 3.45Å
29	V	94.8	Very high	95.9	Very high	44 Å²	44	90.5 Å²	90.5	27%	0.267	42%	0.424	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.1	148.6	-173	178	0	0	0	0	110.3	N24 N27 Y31 Y44	N24-V29 WeakPolarHBondContact CB-O 3.46Å; N24-V29 PolarHBondContact N-O 3.04Å; N27-V29 VanDerWaalsContact C-N 3.3Å; N27-V29 HydrophobicContact CB-CB 4.47Å; N27-V29 PolarHBondContact O-N 3.47Å; V29-Y31 HydrophobicContact CB-CE2 3.98Å; V29-Y31 HydrophobicContact CG1-CD1 4.41Å; V29-Y31 HydrophobicContact CG1-CE1 4.01Å; V29-Y31 HydrophobicContact CG1-CE2 4.18Å; V29-Y44 HydrophobicContact CG1-CD2 3.72Å; V29-Y44 HydrophobicContact CG1-CE2 3.37Å
30	W	96.6	Very high	96	Very high	11 Å²	11	89.6 Å²	89.6	4%	0.042	42%	0.421	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.3	125.9	170.2	-62.3	84.3	0	0	0	109.4	L18 K19 H22 W23 Y44 N48 P51 C56	L18-W30 VanDerWaalsContact C-CZ3 3.42Å; L18-W30 HydrophobicContact CB-CZ3 4.3Å; L18-W30 VanDerWaalsContact O-CZ3 3.24Å; L18-W30 WeakPolarHBondContact O-CZ3 3.24Å; K19-W30 HydrophobicContact CB-CH2 3.7Å; K19-W30 HydrophobicContact CB-CZ3 4.25Å; K19-W30 HydrophobicContact CG-CH2 3.89Å; H22-W30 HydrophobicContact CB-CE3 3.68Å; H22-W30 HydrophobicContact CB-CZ3 4.25Å; H22-W30 CarbonylContact O-C 3.54Å; H22-W30 VanDerWaalsContact O-CA 3.3Å; H22-W30 WeakPolarHBondContact O-CA 3.25Å; W23-W30 HydrophobicContact CB-CD2 4.45Å; W23-W30 HydrophobicContact CB-CE3 4.26Å; W23-W30 HydrophobicContact CB-CH2 4.34Å; W23-W30 HydrophobicContact CB-CZ2 4.46Å; W23-W30 HydrophobicContact CB-CZ3 4.25Å; W23-W30 AromaticContact CE3-CD1 3.72Å; W23-W30 AromaticContact CE3-CD2 3.99Å; W23-W30 HydrophobicContact CE3-CD2 3.99Å; W23-W30 AromaticContact CE3-CE2 3.61Å; W23-W30 HydrophobicContact CE3-CG 4.06Å; W23-W30 HydrophobicContact CE3-CZ2 4.2Å; W23-W30 AromaticContact CE3-NE1 3.4Å; W23-W30 AromaticContact CZ3-CD1 3.84Å; W23-W30 AromaticContact CZ3-NE1 3.57Å; W30-Y44 VanDerWaalsContact O-CE2 3.31Å; W30-Y44 WeakPolarHBondContact O-CE2 3.32Å; W30-N48 VanDerWaalsContact CB-O 3.32Å; W30-N48 WeakPolarHBondContact CB-O 3.29Å; W30-N48 WeakPolarHBondContact O-CB 3.41Å; W30-P51 HydrophobicContact CD2-CB 3.63Å; W30-P51 HydrophobicContact CD2-CG 3.87Å; W30-P51 HydrophobicContact CE3-CB 3.51Å; W30-P51 HydrophobicContact CE3-CG 3.52Å; W30-P51 HydrophobicContact CG-CB 4.27Å; W30-P51 HydrophobicContact CG-CG 4.28Å; W30-P51 HydrophobicContact CH2-CB 3.8Å; W30-P51 HydrophobicContact CZ2-CB 3.98Å; W30-P51 HydrophobicContact CZ3-CB 3.53Å; W30-P51 HydrophobicContact CZ3-CG 3.87Å; W30-C56 HydrophobicContact CH2-CB 3.79Å; W30-C56 HydrophobicContact CZ2-CB 4.31Å
31	Y	96.9	Very high	96	Very high	27 Å²	27	83.5 Å²	83.5	11%	0.106	40%	0.401	C	S	.	.			trans	-119.5	160.8	175	-66.5	-71.5	0	0	0	110.2	H22 N24 N27 V29 H40 M41 Y44	H22-Y31 WeakPolarHBondContact CA-O 3.35Å; H22-Y31 WeakPolarHBondContact CB-O 3.41Å; H22-Y31 PolarHBondContact ND1-O 3.41Å; H22-Y31 PolarHBondContact O-N 3.27Å; N24-Y31 HydrophobicContact CB-CD2 3.63Å; N24-Y31 HydrophobicContact CB-CE2 3.75Å; N27-Y31 HydrophobicContact CB-CE2 4.09Å; N27-Y31 PolarHBondContact ND2-OH 2.88Å; V29-Y31 HydrophobicContact CB-CE2 3.98Å; V29-Y31 HydrophobicContact CG1-CD1 4.41Å; V29-Y31 HydrophobicContact CG1-CE1 4.01Å; V29-Y31 HydrophobicContact CG1-CE2 4.18Å; Y31-H40 HydrophobicContact CD2-CB 3.77Å; Y31-H40 HydrophobicContact CG-CB 4.01Å; Y31-M41 WeakPolarHBondContact CB-O 3.45Å; Y31-M41 WeakPolarHBondContact CD1-O 3.5Å; Y31-Y44 HydrophobicContact CD1-CD2 4.46Å; Y31-Y44 HydrophobicContact CE1-CD2 4.41Å
32	D	96.7	Very high	95.9	Very high	45 Å²	45	90.1 Å²	90.1	24%	0.241	43%	0.426	C	S	.	.			trans	-66.5	152	159.1	-65.2	-36.5	0	0	0	109.8	H40 M41 N48	D32-H40 WeakPolarHBondContact O-CA 3.45Å; D32-M41 HydrophobicContact CB-CE 3.28Å; D32-M41 PolarHBondContact O-N 3.49Å; D32-N48 PolarHBondContact N-ND2 3.42Å; D32-N48 PolarHBondContact OD1-ND2 2.86Å; D32-N48 PolarHBondContact OD2-ND2 3.4Å
33	Y	96	Very high	95.8	Very high	78 Å²	78	91.4 Å²	91.4	31%	0.306	44%	0.44	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.1	122.2	-177.5	-168.9	-97.1	0	0	0	109.5	V21 L35 K38 H40	V21-Y33 HydrophobicContact CG1-CD1 4.05Å; V21-Y33 HydrophobicContact CG1-CD2 4.41Å; V21-Y33 HydrophobicContact CG1-CG 3.75Å; Y33-L35 HydrophobicContact CD1-CD2 3.99Å; Y33-L35 HydrophobicContact CE1-CD2 4.32Å; Y33-K38 VanDerWaalsContact CZ-C 3.42Å; Y33-K38 WeakPolarHBondContact OH-CA 3.37Å; Y33-K38 WeakPolarHBondContact OH-CB 3.32Å; Y33-K38 PolarHBondContact OH-O 2.94Å; Y33-H40 AromaticContact CD2-CD2 3.76Å; Y33-H40 AromaticContact CD2-NE2 3.88Å
34	D	96.4	Very high	95.7	Very high	34 Å²	34	93.6 Å²	93.6	18%	0.182	45%	0.449	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.8	120.9	176.1	-167.1	-56.6	0	0	0	109.4	D36 W37 K38 E39 M41	D34-D36 WeakPolarHBondContact OD1-CA 3.03Å; D34-D36 WeakPolarHBondContact OD1-CB 3.39Å; D34-D36 PolarHBondContact OD1-N 2.83Å; D34-W37 HydrophobicContact CB-CB 4.35Å; D34-W37 VanDerWaalsContact CG-CD1 3.5Å; D34-W37 PolarHBondContact OD1-N 2.95Å; D34-K38 WeakPolarHBondContact O-CA 3.49Å; D34-K38 PolarHBondContact O-N 3.16Å; D34-E39 PolarHBondContact N-O 2.99Å; D34-E39 PolarHBondContact O-N 3.34Å; D34-M41 HydrophobicContact CB-CG 3.87Å; D34-M41 HydrophobicContact CB-SD 4.35Å
35	L	95.4	Very high	95.7	Very high	138 Å²	138	99 Å²	99	72%	0.723	47%	0.468	S	S	*	.	T	Hydrogen-bonded Turn	trans	-79.9	-25.6	-176.9	-65.2	175.9	0	0	0	113.1	Y33	Y33-L35 HydrophobicContact CD1-CD2 3.99Å; Y33-L35 HydrophobicContact CE1-CD2 4.32Å
36	D	97.5	Very high	95.6	Very high	146 Å²	146	99.2 Å²	99.2	78%	0.781	47%	0.473	S	S	*	.	T	Hydrogen-bonded Turn	trans	-78.5	-46.6	-179	-64.6	-39.5	0	0	0	109.7	D34	D34-D36 WeakPolarHBondContact OD1-CA 3.03Å; D34-D36 WeakPolarHBondContact OD1-CB 3.39Å; D34-D36 PolarHBondContact OD1-N 2.83Å
37	W	96.8	Very high	95.6	Very high	198 Å²	198	93.3 Å²	93.3	75%	0.75	46%	0.455	S	S	*	.	T	Hydrogen-bonded Turn	trans	-88.3	-13	179.4	-60.3	102.8	0	0	0	113.7	D34 E39	D34-W37 HydrophobicContact CB-CB 4.35Å; D34-W37 VanDerWaalsContact CG-CD1 3.5Å; D34-W37 PolarHBondContact OD1-N 2.95Å; W37-E39 VanDerWaalsContact C-N 3.31Å; W37-E39 HydrophobicContact CB-CG 3.82Å; W37-E39 PolarHBondContact O-N 3.06Å
38	K	95.7	Very high	95.6	Very high	155 Å²	155	89.9 Å²	89.9	67%	0.674	44%	0.437	S	S	*	.	T	Hydrogen-bonded Turn	trans	56.9	40.8	-178.2	-57.6	-173.3	-177.7	-179.5	0	113.3	Y33 D34	Y33-K38 VanDerWaalsContact CZ-C 3.42Å; Y33-K38 WeakPolarHBondContact OH-CA 3.37Å; Y33-K38 WeakPolarHBondContact OH-CB 3.32Å; Y33-K38 PolarHBondContact OH-O 2.94Å; D34-K38 WeakPolarHBondContact O-CA 3.49Å; D34-K38 PolarHBondContact O-N 3.16Å
39	E	96.2	Very high	95.6	Very high	115 Å²	115	89.6 Å²	89.6	54%	0.537	43%	0.431	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.7	162.6	-177.8	65.9	175	-166.6	0	0	113.2	D34 W37	D34-E39 PolarHBondContact N-O 2.99Å; D34-E39 PolarHBondContact O-N 3.34Å; W37-E39 VanDerWaalsContact C-N 3.31Å; W37-E39 HydrophobicContact CB-CG 3.82Å; W37-E39 PolarHBondContact O-N 3.06Å
40	H	97.1	Very high	95.6	Very high	37 Å²	37	91 Å²	91	17%	0.171	44%	0.44	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.5	123.4	171.4	-71.2	122.6	0	0	0	110.6	V21 W23 N24 Y31 D32 Y33 K42	V21-H40 PolarHBondContact O-NE2 3.13Å; W23-H40 PolarHBondContact O-CE1 2.9Å; N24-H40 PolarHBondContact ND2-ND1 3.21Å; Y31-H40 HydrophobicContact CD2-CB 3.77Å; Y31-H40 HydrophobicContact CG-CB 4.01Å; D32-H40 WeakPolarHBondContact O-CA 3.45Å; Y33-H40 AromaticContact CD2-CD2 3.76Å; Y33-H40 AromaticContact CD2-NE2 3.88Å; H40-K42 PolarHBondContact O-N 3.43Å
41	M	96	Very high	95.5	Very high	76 Å²	76	90.9 Å²	90.9	37%	0.374	44%	0.44	S	S	.	.			trans	-70.6	120.9	173.8	-65.6	-165.1	-72.9	0	0	109.9	Y31 D32 D34 S43	Y31-M41 WeakPolarHBondContact CB-O 3.45Å; Y31-M41 WeakPolarHBondContact CD1-O 3.5Å; D32-M41 HydrophobicContact CB-CE 3.28Å; D32-M41 PolarHBondContact O-N 3.49Å; D34-M41 HydrophobicContact CB-CG 3.87Å; D34-M41 HydrophobicContact CB-SD 4.35Å; M41-S43 VanDerWaalsContact C-N 3.26Å; M41-S43 PolarHBondContact O-N 2.87Å
42	K	93.1	Very high	95.3	Very high	178 Å²	178	93.5 Å²	93.5	77%	0.774	46%	0.455	S	S	*	.			trans	-75.8	-9.5	-174.2	-64.9	-179.7	-175.2	169.3	0	114.9	H40	H40-K42 PolarHBondContact O-N 3.43Å
43	S	94.5	Very high	95.1	Very high	71 Å²	71	100.9 Å²	100.9	50%	0.497	48%	0.481	S	S	.	.			trans	-68.9	131.6	171	-61.3	0	0	0	0	109.7	M41	M41-S43 VanDerWaalsContact C-N 3.26Å; M41-S43 PolarHBondContact O-N 2.87Å
44	Y	94.3	Very high	95	Very high	121 Å²	121	100.4 Å²	100.4	48%	0.475	48%	0.484	S	S	.	.			trans	-114.3	127.6	-175.4	-165.2	-92.6	0	0	0	111.6	V29 W30 Y31 N48	V29-Y44 HydrophobicContact CG1-CD2 3.72Å; V29-Y44 HydrophobicContact CG1-CE2 3.37Å; W30-Y44 VanDerWaalsContact O-CE2 3.31Å; W30-Y44 WeakPolarHBondContact O-CE2 3.32Å; Y31-Y44 HydrophobicContact CD1-CD2 4.46Å; Y31-Y44 HydrophobicContact CE1-CD2 4.41Å; Y44-N48 HydrophobicContact CD2-CB 4.07Å; Y44-N48 HydrophobicContact CE2-CB 3.57Å
45	Y	94.9	Very high	94.9	Very high	143 Å²	143	105.1 Å²	105.1	56%	0.561	50%	0.499	S	S	*	.			trans	-123.9	158	178.4	-60.1	-81.2	0	0	0	110.3	S47 N48	Y45-S47 WeakPolarHBondContact CB-OG 3.41Å; Y45-S47 PolarHBondContact O-N 3.01Å; Y45-S47 VanDerWaalsContact O-N 3.12Å; Y45-N48 PolarHBondContact N-OD1 3.35Å; Y45-N48 VanDerWaalsContact O-CB 3.32Å; Y45-N48 WeakPolarHBondContact O-CB 3.43Å; Y45-N48 PolarHBondContact O-N 3.24Å; Y45-N48 PolarHBondContact O-OD1 2.89Å; Y45-N48 VanDerWaalsContact O-OD1 3.06Å
46	I	94.6	Very high	94.8	Very high	159 Å²	159	98.7 Å²	98.7	82%	0.815	47%	0.466	S	S	*	.	G	3₁₀ helix	trans	-57.8	-30.7	179.5	-67.6	166.8	0	0	0	111.8	N48 A49	I46-N48 PolarHBondContact O-N 3.06Å; I46-A49 WeakPolarHBondContact O-CB 3.23Å; I46-A49 PolarHBondContact O-N 3.38Å
47	S	94.6	Very high	94.5	Very high	66 Å²	66	96.8 Å²	96.8	46%	0.462	45%	0.451	S	S	.	.	G	3₁₀ helix	trans	-56.4	-28.7	174.2	48.7	0	0	0	0	113.2	Y45 A49 V50	Y45-S47 WeakPolarHBondContact CB-OG 3.41Å; Y45-S47 PolarHBondContact O-N 3.01Å; Y45-S47 VanDerWaalsContact O-N 3.12Å; S47-A49 PolarHBondContact O-N 2.89Å; S47-A49 VanDerWaalsContact O-N 3.15Å; S47-V50 VanDerWaalsContact O-CB 3.25Å; S47-V50 WeakPolarHBondContact O-CB 3.35Å; S47-V50 WeakPolarHBondContact O-CG2 3.46Å; S47-V50 PolarHBondContact O-N 2.93Å
48	N	95.2	Very high	94	Very high	5 Å²	5	89.4 Å²	89.4	3%	0.027	43%	0.426	C	S	.	.	G	3₁₀ helix	trans	-67.7	-12.7	177.4	-55.9	122.8	0	0	0	113	W30 D32 Y44 Y45 I46 P51	W30-N48 VanDerWaalsContact CB-O 3.32Å; W30-N48 WeakPolarHBondContact CB-O 3.29Å; W30-N48 WeakPolarHBondContact O-CB 3.41Å; D32-N48 PolarHBondContact N-ND2 3.42Å; D32-N48 PolarHBondContact OD1-ND2 2.86Å; D32-N48 PolarHBondContact OD2-ND2 3.4Å; Y44-N48 HydrophobicContact CD2-CB 4.07Å; Y44-N48 HydrophobicContact CE2-CB 3.57Å; Y45-N48 PolarHBondContact N-OD1 3.35Å; Y45-N48 VanDerWaalsContact O-CB 3.32Å; Y45-N48 WeakPolarHBondContact O-CB 3.43Å; Y45-N48 PolarHBondContact O-N 3.24Å; Y45-N48 PolarHBondContact O-OD1 2.89Å; Y45-N48 VanDerWaalsContact O-OD1 3.06Å; I46-N48 PolarHBondContact O-N 3.06Å; N48-P51 VanDerWaalsContact O-CD 3.29Å; N48-P51 WeakPolarHBondContact O-CD 3.46Å
49	A	94.6	Very high	92.9	Very high	34 Å²	34	88.6 Å²	88.6	28%	0.281	43%	0.429	S	S	.	.	G	3₁₀ helix	trans	-85.5	-6	172.4	0	0	0	0	0	113.7	I46 S47 P51 L52 Y53	I46-A49 WeakPolarHBondContact O-CB 3.23Å; I46-A49 PolarHBondContact O-N 3.38Å; S47-A49 PolarHBondContact O-N 2.89Å; S47-A49 VanDerWaalsContact O-N 3.15Å; A49-P51 VanDerWaalsContact C-CD 3.44Å; A49-P51 VanDerWaalsContact C-N 3.32Å; A49-L52 HydrophobicContact CB-CD1 4.41Å; A49-L52 WeakPolarHBondContact O-CA 3.36Å; A49-L52 VanDerWaalsContact O-CB 3.29Å; A49-L52 WeakPolarHBondContact O-CB 3.37Å; A49-L52 PolarHBondContact O-N 2.71Å; A49-Y53 PolarHBondContact O-N 2.96Å; A49-Y53 VanDerWaalsContact O-N 3.17Å
50	V	94.1	Very high	91.4	Very high	75 Å²	75	90.8 Å²	90.8	46%	0.455	44%	0.439	S	S	.	.	H	α-helix	trans	-54.6	-39	177.4	169.9	0	0	0	0	113.2	S47 L52 Y53 N54	S47-V50 VanDerWaalsContact O-CB 3.25Å; S47-V50 WeakPolarHBondContact O-CB 3.35Å; S47-V50 WeakPolarHBondContact O-CG2 3.46Å; S47-V50 PolarHBondContact O-N 2.93Å; V50-L52 VanDerWaalsContact C-N 3.26Å; V50-L52 PolarHBondContact O-N 3.4Å; V50-Y53 PolarHBondContact O-N 3.41Å; V50-N54 WeakPolarHBondContact CG1-ND2 3.29Å; V50-N54 PolarHBondContact O-N 3.46Å; V50-N54 PolarHBondContact O-ND2 2.89Å
51	P	95.1	Very high	89.1	Confident	8 Å²	8	95.3 Å²	95.3	5%	0.052	47%	0.465	C	S	.	.	H	α-helix	trans	-61.2	-32.1	173.6	-25.6	36.7	0	0	0	113.6	W30 N48 A49 R55 C56	W30-P51 HydrophobicContact CD2-CB 3.63Å; W30-P51 HydrophobicContact CD2-CG 3.87Å; W30-P51 HydrophobicContact CE3-CB 3.51Å; W30-P51 HydrophobicContact CE3-CG 3.52Å; W30-P51 HydrophobicContact CG-CB 4.27Å; W30-P51 HydrophobicContact CG-CG 4.28Å; W30-P51 HydrophobicContact CH2-CB 3.8Å; W30-P51 HydrophobicContact CZ2-CB 3.98Å; W30-P51 HydrophobicContact CZ3-CB 3.53Å; W30-P51 HydrophobicContact CZ3-CG 3.87Å; N48-P51 VanDerWaalsContact O-CD 3.29Å; N48-P51 WeakPolarHBondContact O-CD 3.46Å; A49-P51 VanDerWaalsContact C-CD 3.44Å; A49-P51 VanDerWaalsContact C-N 3.32Å; P51-R55 PolarHBondContact O-N 3.22Å; P51-R55 VanDerWaalsContact O-N 3.16Å; P51-C56 HydrophobicContact CB-CB 3.91Å; P51-C56 WeakPolarHBondContact O-CB 3.44Å; P51-C56 PolarHBondContact O-N 3.38Å; P51-C56 PolarHBondContact O-SG 3.47Å; P51-C56 VanDerWaalsContact O-SG 3.34Å
52	L	92.9	Very high	88.8	Confident	81 Å²	81	96.3 Å²	96.3	42%	0.424	47%	0.47	S	S	.	.	H	α-helix	trans	-69.6	-48	176.3	-59.3	176	0	0	0	110.8	A49 V50 N54 R55 F57	A49-L52 HydrophobicContact CB-CD1 4.41Å; A49-L52 WeakPolarHBondContact O-CA 3.36Å; A49-L52 VanDerWaalsContact O-CB 3.29Å; A49-L52 WeakPolarHBondContact O-CB 3.37Å; A49-L52 PolarHBondContact O-N 2.71Å; V50-L52 VanDerWaalsContact C-N 3.26Å; V50-L52 PolarHBondContact O-N 3.4Å; L52-N54 PolarHBondContact O-N 2.89Å; L52-R55 PolarHBondContact O-N 3.46Å; L52-F57 HydrophobicContact CD2-CD1 4.15Å
53	Y	93.1	Very high	88.6	Confident	201 Å²	201	92 Å²	92	79%	0.788	45%	0.454	S	S	*	.	H	α-helix	trans	-55.3	-40.6	175.3	178.4	-99.1	0	0	0	111.8	A49 V50 R55	A49-Y53 PolarHBondContact O-N 2.96Å; A49-Y53 VanDerWaalsContact O-N 3.17Å; V50-Y53 PolarHBondContact O-N 3.41Å; Y53-R55 VanDerWaalsContact C-N 3.29Å; Y53-R55 PolarHBondContact O-N 3.43Å
54	N	92.7	Very high	88.2	Confident	68 Å²	68	93.2 Å²	93.2	36%	0.364	45%	0.451	S	S	.	.	T	Hydrogen-bonded Turn	trans	-83.2	2.6	178.4	-74.4	-72.3	0	0	0	114.6	K15 V50 L52 C56	K15-N54 WeakPolarHBondContact CE-O 3.46Å; K15-N54 PolarHBondContact NZ-O 3.44Å; V50-N54 WeakPolarHBondContact CG1-ND2 3.29Å; V50-N54 PolarHBondContact O-N 3.46Å; V50-N54 PolarHBondContact O-ND2 2.89Å; L52-N54 PolarHBondContact O-N 2.89Å; N54-C56 PolarHBondContact O-N 3.02Å
55	R	94	Very high	87.9	Confident	132 Å²	132	91.5 Å²	91.5	50%	0.498	45%	0.45	S	S	.	.	T	Hydrogen-bonded Turn	trans	52.6	53.1	-176.2	-58.8	174.8	56.7	153.3	-1.3	112.3	K15 P51 L52 Y53 F57 D58	K15-R55 PolarHBondContact NZ-O 2.94Å; P51-R55 PolarHBondContact O-N 3.22Å; P51-R55 VanDerWaalsContact O-N 3.16Å; L52-R55 PolarHBondContact O-N 3.46Å; Y53-R55 VanDerWaalsContact C-N 3.29Å; Y53-R55 PolarHBondContact O-N 3.43Å; R55-F57 VanDerWaalsContact C-N 3.28Å; R55-F57 HydrophobicContact CB-CE1 4.13Å; R55-F57 HydrophobicContact CB-CZ 4.24Å; R55-F57 HydrophobicContact CG-CE1 4.14Å; R55-F57 HydrophobicContact CG-CZ 4.1Å; R55-D58 IonicContact CZ-OD2 3.71Å; R55-D58 IonicContact NE-OD2 3.69Å; R55-D58 IonicContact NH2-OD2 2.88Å; R55-D58 PolarHBondContact NH2-OD2 2.89Å
56	C	94.1	Very high	87.4	Confident	4 Å²	4	88.3 Å²	88.3	3%	0.027	44%	0.443	C	S	.	.			trans	-81.3	-10.4	175.5	-55.9	0	0	0	0	112.5	K19 W30 P51 N54 D58	K19-C56 WeakPolarHBondContact CD-O 3.48Å; W30-C56 HydrophobicContact CH2-CB 3.79Å; W30-C56 HydrophobicContact CZ2-CB 4.31Å; P51-C56 HydrophobicContact CB-CB 3.91Å; P51-C56 WeakPolarHBondContact O-CB 3.44Å; P51-C56 PolarHBondContact O-N 3.38Å; P51-C56 PolarHBondContact O-SG 3.47Å; P51-C56 VanDerWaalsContact O-SG 3.34Å; N54-C56 PolarHBondContact O-N 3.02Å; C56-D58 VanDerWaalsContact C-N 3.29Å
57	F	91.1	Very high	87	Confident	105 Å²	105	83.6 Å²	83.6	46%	0.461	42%	0.418	S	S	.	.	S	Bend	trans	-72.7	-25.4	173.9	57.4	-95.1	0	0	0	112.7	K19 L52 R55 N59	K19-F57 PolarHBondContact NZ-O 3.5Å; K19-F57 VanDerWaalsContact NZ-O 3.1Å; L52-F57 HydrophobicContact CD2-CD1 4.15Å; R55-F57 VanDerWaalsContact C-N 3.28Å; R55-F57 HydrophobicContact CB-CE1 4.13Å; R55-F57 HydrophobicContact CB-CZ 4.24Å; R55-F57 HydrophobicContact CG-CE1 4.14Å; R55-F57 HydrophobicContact CG-CZ 4.1Å; F57-N59 PolarHBondContact O-N 3.5Å
58	D	86.6	Confident	86.4	Confident	44 Å²	44	84.9 Å²	84.9	24%	0.235	42%	0.415	C	S	.	.			trans	-66.6	114.6	-177.2	-148.6	-14.9	0	0	0	110.1	R55 C56 E60 N61	R55-D58 IonicContact CZ-OD2 3.71Å; R55-D58 IonicContact NE-OD2 3.69Å; R55-D58 IonicContact NH2-OD2 2.88Å; R55-D58 PolarHBondContact NH2-OD2 2.89Å; C56-D58 VanDerWaalsContact C-N 3.29Å; D58-E60 PolarHBondContact O-N 3.17Å; D58-E60 PolarHBondContact OD1-N 3.26Å; D58-N61 PolarHBondContact OD2-ND2 3.24Å
59	N	71.3	Confident	85.7	Confident	138 Å²	138	91 Å²	91	74%	0.738	45%	0.445	S	S	*	.	S	Bend	trans	-77.3	-9.4	174.8	-75.5	-31.3	0	0	0	111.9	K19 F57	K19-N59 PolarHBondContact NZ-OD1 3.1Å; F57-N59 PolarHBondContact O-N 3.5Å
60	E	64.8	Low	85	Confident	160 Å²	160	95.8 Å²	95.8	75%	0.748	46%	0.458	S	S	*	.			trans	-120.6	82.7	-172.7	-62.5	-178.8	-179.7	0	0	108.8	D58	D58-E60 PolarHBondContact O-N 3.17Å; D58-E60 PolarHBondContact OD1-N 3.26Å
61	N	50.3	Low	84.2	Confident	133 Å²	133	97.6 Å²	97.6	71%	0.711	46%	0.459	S	S	*	.			trans	-175.5	0	162	-90.1	-47.7	0	0	0	113.4	K12 D58	K12-N61 VanDerWaalsContact CE-OXT 3.23Å; K12-N61 WeakPolarHBondContact CE-OXT 3.5Å; K12-N61 PolarHBondContact NZ-OXT 3.24Å; D58-N61 PolarHBondContact OD2-ND2 3.24Å

Retrieved 61 of 61 residues in 112.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).