A0A077ZJX7_TRITR Loading...

Mitochondrial import inner membrane translocase subunit

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space.

AlphaFold DB , UniProt , Accession A0A077ZJX7, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 81 aa.

						>A0A077ZJX7_TRITR|A0A077ZJX7
MNTEIQAFRDFLTTYNALTQHCFNRCIFDFNRRALNSEEESCIYRCVQKSVHFNRRLVVAFAAMNAFVQERKNIETQSKNS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	59.6	Low	91	Very high	216 Å²	216	117.1 Å²	117.1	100%	1.064	58%	0.584	S	S	*	*				0	127.9	0	-84.1	-175.3	-94.7	0	0	107.7	T3	M1-T3 PolarHBondContact O-N 3.19Å
2	N	83.3	Confident	91.6	Very high	110 Å²	110	112.9 Å²	112.9	59%	0.588	56%	0.564	S	S	*	*			trans	-66.2	115	-178.4	-63.1	-8.9	0	0	0	109	E4 I5 Q6	N2-E4 PolarHBondContact O-N 3Å; N2-I5 HydrophobicContact CB-CB 4.31Å; N2-I5 HydrophobicContact CB-CD1 3.87Å; N2-I5 HydrophobicContact CB-CG1 3.9Å; N2-I5 PolarHBondContact O-N 3.18Å; N2-Q6 PolarHBondContact O-N 3.32Å
3	T	93.1	Very high	92	Very high	116 Å²	116	111.5 Å²	111.5	71%	0.712	57%	0.566	S	S	*	*	H	α-helix	trans	-54.5	-34.2	-178.3	45.9	0	0	0	0	112.3	M1 Q6 A7	M1-T3 PolarHBondContact O-N 3.19Å; T3-Q6 PolarHBondContact O-N 3.3Å; T3-A7 PolarHBondContact O-N 2.98Å
4	E	94.5	Very high	92.3	Very high	155 Å²	155	109 Å²	109	72%	0.724	56%	0.559	S	S	*	*	H	α-helix	trans	-65.1	-42.3	176.6	-60.1	176.3	139.9	0	0	112.7	N2 Q6 A7 F8	N2-E4 PolarHBondContact O-N 3Å; E4-Q6 VanDerWaalsContact C-N 3.27Å; E4-Q6 PolarHBondContact O-N 3.32Å; E4-A7 PolarHBondContact O-N 3.29Å; E4-F8 WeakPolarHBondContact O-CB 3.45Å; E4-F8 PolarHBondContact O-N 3.48Å
5	I	95.6	Very high	92.6	Very high	78 Å²	78	110.2 Å²	110.2	40%	0.4	56%	0.555	S	S	.	*	H	α-helix	trans	-64.3	-38.3	176.7	-62.6	179.5	0	0	0	109.8	N2 R9	N2-I5 HydrophobicContact CB-CB 4.31Å; N2-I5 HydrophobicContact CB-CD1 3.87Å; N2-I5 HydrophobicContact CB-CG1 3.9Å; N2-I5 PolarHBondContact O-N 3.18Å; I5-R9 WeakPolarHBondContact O-CG 3.38Å; I5-R9 PolarHBondContact O-N 3.3Å
6	Q	95.2	Very high	93	Very high	80 Å²	80	109.4 Å²	109.4	37%	0.374	55%	0.553	S	S	.	*	H	α-helix	trans	-65.7	-49.6	176.1	-173.3	58.1	44.3	0	0	111.2	N2 T3 E4 F8 R9 D10	N2-Q6 PolarHBondContact O-N 3.32Å; T3-Q6 PolarHBondContact O-N 3.3Å; E4-Q6 VanDerWaalsContact C-N 3.27Å; E4-Q6 PolarHBondContact O-N 3.32Å; Q6-F8 PolarHBondContact O-N 3.3Å; Q6-R9 WeakPolarHBondContact O-CB 3.39Å; Q6-R9 PolarHBondContact O-N 3.01Å; Q6-R9 VanDerWaalsContact O-N 3.09Å; Q6-D10 PolarHBondContact NE2-OD1 3.4Å; Q6-D10 PolarHBondContact NE2-OD2 3.42Å; Q6-D10 VanDerWaalsContact O-CG 3.24Å; Q6-D10 PolarHBondContact O-N 3.49Å
7	A	95.5	Very high	93.3	Very high	60 Å²	60	106.4 Å²	106.4	50%	0.496	55%	0.548	S	S	.	.	H	α-helix	trans	-57.7	-39.3	177.9	0	0	0	0	0	112.2	T3 E4 D10 F11	T3-A7 PolarHBondContact O-N 2.98Å; E4-A7 PolarHBondContact O-N 3.29Å; A7-D10 PolarHBondContact O-N 3.35Å; A7-F11 WeakPolarHBondContact O-CB 3.46Å; A7-F11 PolarHBondContact O-N 3.01Å
8	F	96.7	Very high	93.5	Very high	126 Å²	126	102.6 Å²	102.6	55%	0.553	53%	0.529	S	S	*	.	H	α-helix	trans	-67.6	-40.8	176.5	-168.6	-112.5	0	0	0	112.5	E4 Q6 D10 F11 L12	E4-F8 WeakPolarHBondContact O-CB 3.45Å; E4-F8 PolarHBondContact O-N 3.48Å; Q6-F8 PolarHBondContact O-N 3.3Å; F8-D10 VanDerWaalsContact C-N 3.35Å; F8-F11 HydrophobicContact CE2-CD1 4.42Å; F8-F11 WeakPolarHBondContact O-CB 3.4Å; F8-F11 PolarHBondContact O-N 3.08Å; F8-L12 HydrophobicContact CD1-CD1 3.91Å; F8-L12 HydrophobicContact CD1-CG 4.42Å; F8-L12 HydrophobicContact CE1-CD1 3.55Å; F8-L12 HydrophobicContact CE1-CG 4.14Å; F8-L12 HydrophobicContact CZ-CD1 4.09Å; F8-L12 HydrophobicContact CZ-CD2 4.3Å; F8-L12 HydrophobicContact CZ-CG 4.28Å; F8-L12 WeakPolarHBondContact O-CG 3.35Å; F8-L12 PolarHBondContact O-N 3.38Å
9	R	97.1	Very high	93.8	Very high	143 Å²	143	100.8 Å²	100.8	54%	0.54	52%	0.523	S	S	.	.	H	α-helix	trans	-62.6	-41	173.6	-76.1	174.9	178	154.1	-0.2	112.2	I5 Q6 F11 L12 T13	I5-R9 WeakPolarHBondContact O-CG 3.38Å; I5-R9 PolarHBondContact O-N 3.3Å; Q6-R9 WeakPolarHBondContact O-CB 3.39Å; Q6-R9 PolarHBondContact O-N 3.01Å; Q6-R9 VanDerWaalsContact O-N 3.09Å; R9-F11 VanDerWaalsContact C-N 3.34Å; R9-L12 PolarHBondContact O-N 3.3Å; R9-T13 WeakPolarHBondContact O-CB 3.36Å; R9-T13 PolarHBondContact O-N 3.18Å; R9-T13 PolarHBondContact O-OG1 3.44Å
10	D	95	Very high	94	Very high	81 Å²	81	102.3 Å²	102.3	43%	0.433	53%	0.527	S	S	.	.	H	α-helix	trans	-66.2	-39.8	178.2	-63.8	-24	0	0	0	111	Q6 A7 F8 T13 T14	Q6-D10 PolarHBondContact NE2-OD1 3.4Å; Q6-D10 PolarHBondContact NE2-OD2 3.42Å; Q6-D10 VanDerWaalsContact O-CG 3.24Å; Q6-D10 PolarHBondContact O-N 3.49Å; A7-D10 PolarHBondContact O-N 3.35Å; F8-D10 VanDerWaalsContact C-N 3.35Å; D10-T13 PolarHBondContact O-N 3.23Å; D10-T14 WeakPolarHBondContact O-CB 3.3Å; D10-T14 PolarHBondContact O-N 3.29Å; D10-T14 PolarHBondContact O-OG1 3.44Å
11	F	95.7	Very high	94.2	Very high	123 Å²	123	101.5 Å²	101.5	54%	0.539	52%	0.521	S	S	.	.	H	α-helix	trans	-59.6	-50.7	172.2	170.5	-102.4	0	0	0	111.8	A7 F8 R9 T13 T14 Y15	A7-F11 WeakPolarHBondContact O-CB 3.46Å; A7-F11 PolarHBondContact O-N 3.01Å; F8-F11 HydrophobicContact CE2-CD1 4.42Å; F8-F11 WeakPolarHBondContact O-CB 3.4Å; F8-F11 PolarHBondContact O-N 3.08Å; R9-F11 VanDerWaalsContact C-N 3.34Å; F11-T13 VanDerWaalsContact C-N 3.32Å; F11-T13 PolarHBondContact O-N 3.41Å; F11-T14 PolarHBondContact O-N 3.31Å; F11-Y15 WeakPolarHBondContact O-CB 3.42Å; F11-Y15 PolarHBondContact O-N 3.26Å
12	L	97.5	Very high	96.1	Very high	67 Å²	67	91.4 Å²	91.4	35%	0.351	47%	0.472	S	S	.	.	H	α-helix	trans	-63.1	-38.2	179.9	-70.5	177.9	0	0	0	112.4	F8 R9 T14 Y15 N16	F8-L12 HydrophobicContact CD1-CD1 3.91Å; F8-L12 HydrophobicContact CD1-CG 4.42Å; F8-L12 HydrophobicContact CE1-CD1 3.55Å; F8-L12 HydrophobicContact CE1-CG 4.14Å; F8-L12 HydrophobicContact CZ-CD1 4.09Å; F8-L12 HydrophobicContact CZ-CD2 4.3Å; F8-L12 HydrophobicContact CZ-CG 4.28Å; F8-L12 WeakPolarHBondContact O-CG 3.35Å; F8-L12 PolarHBondContact O-N 3.38Å; R9-L12 PolarHBondContact O-N 3.3Å; L12-T14 VanDerWaalsContact C-N 3.33Å; L12-T14 PolarHBondContact O-N 3.24Å; L12-Y15 PolarHBondContact O-N 3.49Å; L12-N16 WeakPolarHBondContact O-CB 3.45Å; L12-N16 VanDerWaalsContact O-CG 3.24Å; L12-N16 PolarHBondContact O-N 3.4Å; L12-N16 PolarHBondContact O-ND2 3.47Å
13	T	97.2	Very high	96.8	Very high	95 Å²	95	91.1 Å²	91.1	58%	0.583	47%	0.466	S	S	*	.	H	α-helix	trans	-60.4	-45.7	174.7	-57.9	0	0	0	0	110.9	R9 D10 F11 N16 A17	R9-T13 WeakPolarHBondContact O-CB 3.36Å; R9-T13 PolarHBondContact O-N 3.18Å; R9-T13 PolarHBondContact O-OG1 3.44Å; D10-T13 PolarHBondContact O-N 3.23Å; F11-T13 VanDerWaalsContact C-N 3.32Å; F11-T13 PolarHBondContact O-N 3.41Å; T13-N16 PolarHBondContact O-N 2.73Å; T13-A17 WeakPolarHBondContact O-CB 3.43Å; T13-A17 PolarHBondContact O-N 2.97Å; T13-A17 VanDerWaalsContact O-N 3.08Å
14	T	95.9	Very high	97	Very high	76 Å²	76	90.9 Å²	90.9	47%	0.466	46%	0.46	S	S	.	.	H	α-helix	trans	-66.1	-41.4	177.6	-56.1	0	0	0	0	111.7	D10 F11 L12 A17 L18	D10-T14 WeakPolarHBondContact O-CB 3.3Å; D10-T14 PolarHBondContact O-N 3.29Å; D10-T14 PolarHBondContact O-OG1 3.44Å; F11-T14 PolarHBondContact O-N 3.31Å; L12-T14 VanDerWaalsContact C-N 3.33Å; L12-T14 PolarHBondContact O-N 3.24Å; T14-A17 PolarHBondContact O-N 3.07Å; T14-L18 VanDerWaalsContact O-CB 3.29Å; T14-L18 WeakPolarHBondContact O-CB 3.35Å; T14-L18 PolarHBondContact O-N 2.97Å
15	Y	97.7	Very high	97.2	Very high	127 Å²	127	91 Å²	91	50%	0.498	45%	0.454	S	S	.	.	H	α-helix	trans	-60.4	-46.1	176.8	172.4	-94.7	0	0	0	111.9	F11 L12 L18 T19	F11-Y15 WeakPolarHBondContact O-CB 3.42Å; F11-Y15 PolarHBondContact O-N 3.26Å; L12-Y15 PolarHBondContact O-N 3.49Å; Y15-L18 PolarHBondContact O-N 3.37Å; Y15-T19 WeakPolarHBondContact O-CB 3.36Å; Y15-T19 PolarHBondContact O-N 3.07Å; Y15-T19 PolarHBondContact O-OG1 3.36Å
16	N	98.2	Very high	97.3	Very high	98 Å²	98	87.3 Å²	87.3	52%	0.524	44%	0.435	S	S	.	.	H	α-helix	trans	-63.8	-45.7	178.5	-71	-19.4	0	0	0	111.3	L12 T13 L18 T19 Q20	L12-N16 WeakPolarHBondContact O-CB 3.45Å; L12-N16 VanDerWaalsContact O-CG 3.24Å; L12-N16 PolarHBondContact O-N 3.4Å; L12-N16 PolarHBondContact O-ND2 3.47Å; T13-N16 PolarHBondContact O-N 2.73Å; N16-L18 PolarHBondContact O-N 3.12Å; N16-T19 PolarHBondContact O-N 3Å; N16-Q20 PolarHBondContact O-N 3.46Å
17	A	97.7	Very high	97.4	Very high	58 Å²	58	84.8 Å²	84.8	48%	0.479	42%	0.424	S	S	.	.	H	α-helix	trans	-61.8	-42.2	176.9	0	0	0	0	0	112.1	T13 T14 H21	T13-A17 WeakPolarHBondContact O-CB 3.43Å; T13-A17 PolarHBondContact O-N 2.97Å; T13-A17 VanDerWaalsContact O-N 3.08Å; T14-A17 PolarHBondContact O-N 3.07Å; A17-H21 VanDerWaalsContact O-CB 3.29Å; A17-H21 WeakPolarHBondContact O-CB 3.38Å; A17-H21 PolarHBondContact O-N 3.03Å
18	L	98.1	Very high	97.5	Very high	38 Å²	38	87.5 Å²	87.5	20%	0.199	42%	0.424	C	S	.	.	H	α-helix	trans	-64.2	-44.6	177.1	178	58.8	0	0	0	111.8	T14 Y15 N16 H21 C22 V47	T14-L18 VanDerWaalsContact O-CB 3.29Å; T14-L18 WeakPolarHBondContact O-CB 3.35Å; T14-L18 PolarHBondContact O-N 2.97Å; Y15-L18 PolarHBondContact O-N 3.37Å; N16-L18 PolarHBondContact O-N 3.12Å; L18-H21 PolarHBondContact O-N 3.47Å; L18-C22 PolarHBondContact O-N 2.86Å; L18-V47 HydrophobicContact CD2-CG1 4.3Å; L18-V47 HydrophobicContact CD2-CG2 4.5Å
19	T	98.2	Very high	97.4	Very high	68 Å²	68	83 Å²	83	42%	0.417	41%	0.406	S	S	.	.	H	α-helix	trans	-61.2	-47.9	179.3	-58.4	0	0	0	0	110.6	Y15 N16 H21 C22 F23	Y15-T19 WeakPolarHBondContact O-CB 3.36Å; Y15-T19 PolarHBondContact O-N 3.07Å; Y15-T19 PolarHBondContact O-OG1 3.36Å; N16-T19 PolarHBondContact O-N 3Å; T19-H21 PolarHBondContact O-N 3.32Å; T19-C22 PolarHBondContact O-N 2.99Å; T19-F23 VanDerWaalsContact O-CB 3.3Å; T19-F23 WeakPolarHBondContact O-CB 3.43Å; T19-F23 PolarHBondContact O-N 3.03Å
20	Q	98.4	Very high	97.4	Very high	130 Å²	130	83.1 Å²	83.1	61%	0.607	41%	0.411	S	S	*	.	H	α-helix	trans	-62.5	-42.1	175.9	-176	179.2	-11.3	0	0	111.9	N16 F23 N24	N16-Q20 PolarHBondContact O-N 3.46Å; Q20-F23 PolarHBondContact O-N 3.35Å; Q20-N24 WeakPolarHBondContact O-CB 3.27Å; Q20-N24 VanDerWaalsContact O-CG 3.28Å; Q20-N24 PolarHBondContact O-N 2.91Å; Q20-N24 PolarHBondContact O-ND2 3.39Å
21	H	98.3	Very high	97.5	Very high	86 Å²	86	86.6 Å²	86.6	40%	0.398	43%	0.43	S	S	.	.	H	α-helix	trans	-61.4	-48.3	178.2	180	69.9	0	0	0	112.2	A17 L18 T19 R25	A17-H21 VanDerWaalsContact O-CB 3.29Å; A17-H21 WeakPolarHBondContact O-CB 3.38Å; A17-H21 PolarHBondContact O-N 3.03Å; L18-H21 PolarHBondContact O-N 3.47Å; T19-H21 PolarHBondContact O-N 3.32Å; H21-R25 WeakPolarHBondContact O-CB 3.4Å; H21-R25 PolarHBondContact O-N 3.39Å
22	C	98.6	Very high	97.5	Very high	5 Å²	5	86.8 Å²	86.8	3%	0.034	43%	0.427	C	S	.	.	H	α-helix	trans	-71.1	-35.7	-179.7	-67.1	0	0	0	0	112.1	L18 T19 R25 C26 C46	L18-C22 PolarHBondContact O-N 2.86Å; T19-C22 PolarHBondContact O-N 2.99Å; C22-R25 PolarHBondContact O-N 3.2Å; C22-C26 WeakPolarHBondContact O-CB 3.42Å; C22-C26 PolarHBondContact O-N 2.93Å; C22-C46 WeakPolarHBondContact CA-SG 3.09Å; C22-C46 HydrophobicContact CB-CB 3.91Å; C22-C46 WeakPolarHBondContact CB-SG 3.19Å; C22-C46 WeakPolarHBondContact SG-CB 3.4Å; C22-C46 CovalentContact SG-SG 2.05Å; C22-C46 PolarHBondContact SG-SG 3.27Å
23	F	98.3	Very high	97.4	Very high	104 Å²	104	96.1 Å²	96.1	46%	0.456	46%	0.457	S	S	.	.	H	α-helix	trans	-58	-54.6	172.8	179.9	-91.9	0	0	0	111.3	T19 Q20 R25 C26 I27 F30	T19-F23 VanDerWaalsContact O-CB 3.3Å; T19-F23 WeakPolarHBondContact O-CB 3.43Å; T19-F23 PolarHBondContact O-N 3.03Å; Q20-F23 PolarHBondContact O-N 3.35Å; F23-R25 PolarHBondContact O-N 3.38Å; F23-R25 VanDerWaalsContact O-N 3.11Å; F23-C26 PolarHBondContact O-N 3.46Å; F23-I27 HydrophobicContact CD2-CB 4.14Å; F23-I27 HydrophobicContact CD2-CG1 3.49Å; F23-I27 VanDerWaalsContact CD2-CG1 3.49Å; F23-I27 HydrophobicContact CE2-CB 4.05Å; F23-I27 HydrophobicContact CE2-CG1 3.76Å; F23-I27 HydrophobicContact CE2-CG2 4.07Å; F23-I27 HydrophobicContact CG-CG1 4.14Å; F23-I27 HydrophobicContact CZ-CB 4.43Å; F23-I27 HydrophobicContact CZ-CG2 4.36Å; F23-I27 WeakPolarHBondContact O-CB 3.35Å; F23-I27 PolarHBondContact O-N 3.33Å; F23-F30 HydrophobicContact CZ-CE1 4.18Å; F23-F30 HydrophobicContact CZ-CZ 4.47Å
24	N	98.1	Very high	97.4	Very high	110 Å²	110	94.9 Å²	94.9	59%	0.588	46%	0.457	S	S	*	.	H	α-helix	trans	-62.5	-22	-178.5	-72.7	-16.3	0	0	0	113.9	Q20	Q20-N24 WeakPolarHBondContact O-CB 3.27Å; Q20-N24 VanDerWaalsContact O-CG 3.28Å; Q20-N24 PolarHBondContact O-N 2.91Å; Q20-N24 PolarHBondContact O-ND2 3.39Å
25	R	98	Very high	97.4	Very high	159 Å²	159	94.6 Å²	94.6	60%	0.6	45%	0.452	S	S	*	.	H	α-helix	trans	-96.6	-35.3	-177.3	-172.9	172.4	-171	157.5	10.6	113.3	H21 C22 F23	H21-R25 WeakPolarHBondContact O-CB 3.4Å; H21-R25 PolarHBondContact O-N 3.39Å; C22-R25 PolarHBondContact O-N 3.2Å; F23-R25 PolarHBondContact O-N 3.38Å; F23-R25 VanDerWaalsContact O-N 3.11Å
26	C	98.4	Very high	97.3	Very high	0 Å²	0	89.2 Å²	89.2	0%	0	43%	0.432	C	S	.	.	H	α-helix	trans	-109.8	-21.7	-167.7	-68.4	0	0	0	0	114	C22 F23 F28 E39 C42 I43	C22-C26 WeakPolarHBondContact O-CB 3.42Å; C22-C26 PolarHBondContact O-N 2.93Å; F23-C26 PolarHBondContact O-N 3.46Å; C26-F28 VanDerWaalsContact O-CD1 3.25Å; C26-F28 WeakPolarHBondContact O-CD1 3.17Å; C26-E39 WeakPolarHBondContact O-CG 3.26Å; C26-C42 WeakPolarHBondContact CA-SG 3.24Å; C26-C42 HydrophobicContact CB-CB 3.56Å; C26-C42 WeakPolarHBondContact CB-SG 3.41Å; C26-C42 WeakPolarHBondContact SG-CB 3.49Å; C26-C42 PolarHBondContact SG-O 3.18Å; C26-C42 CovalentContact SG-SG 2.05Å; C26-C42 PolarHBondContact SG-SG 3.3Å; C26-I43 HydrophobicContact CB-CG1 3.77Å; C26-I43 PolarHBondContact SG-N 3.26Å
27	I	97.8	Very high	97.3	Very high	26 Å²	26	89 Å²	89	13%	0.133	44%	0.438	C	S	.	.			trans	-90.4	117	177	-53.3	-51.6	0	0	0	108.6	F23 F30 L35 E39 I43	F23-I27 HydrophobicContact CD2-CB 4.14Å; F23-I27 HydrophobicContact CD2-CG1 3.49Å; F23-I27 VanDerWaalsContact CD2-CG1 3.49Å; F23-I27 HydrophobicContact CE2-CB 4.05Å; F23-I27 HydrophobicContact CE2-CG1 3.76Å; F23-I27 HydrophobicContact CE2-CG2 4.07Å; F23-I27 HydrophobicContact CG-CG1 4.14Å; F23-I27 HydrophobicContact CZ-CB 4.43Å; F23-I27 HydrophobicContact CZ-CG2 4.36Å; F23-I27 WeakPolarHBondContact O-CB 3.35Å; F23-I27 PolarHBondContact O-N 3.33Å; I27-F30 HydrophobicContact CG2-CD1 4.49Å; I27-F30 HydrophobicContact CG2-CE1 3.77Å; I27-F30 HydrophobicContact CG2-CE2 4.41Å; I27-F30 HydrophobicContact CG2-CZ 3.73Å; I27-L35 HydrophobicContact CD1-CD2 3.33Å; I27-E39 HydrophobicContact CD1-CB 4.36Å; I27-I43 HydrophobicContact CD1-CD1 3.84Å
28	F	96.3	Very high	97.3	Very high	117 Å²	117	92.5 Å²	92.5	51%	0.513	45%	0.445	S	S	.	.			trans	-134.6	-17.8	-176.5	59.9	-97.6	0	0	0	113	C26 E38 E39	C26-F28 VanDerWaalsContact O-CD1 3.25Å; C26-F28 WeakPolarHBondContact O-CD1 3.17Å; F28-E38 HydrophobicContact CE1-CB 4.47Å; F28-E38 HydrophobicContact CZ-CB 4.1Å; F28-E39 HydrophobicContact CD1-CG 3.9Å; F28-E39 HydrophobicContact CE1-CG 3.48Å; F28-E39 VanDerWaalsContact CE1-CG 3.48Å; F28-E39 HydrophobicContact CZ-CG 3.88Å; F28-E39 PolarHBondContact N-OE1 3.42Å
29	D	95.5	Very high	97.3	Very high	31 Å²	31	90.8 Å²	90.8	17%	0.166	44%	0.436	C	S	.	.			trans	-108.3	109.1	179	178.5	16	0	0	0	110.9	N31 R32 E39	D29-N31 WeakPolarHBondContact OD1-CB 3.41Å; D29-N31 PolarHBondContact OD1-N 3.48Å; D29-N31 PolarHBondContact OD1-ND2 3.39Å; D29-R32 IonicContact OD2-CZ 3.37Å; D29-R32 IonicContact OD2-NE 2.94Å; D29-R32 PolarHBondContact OD2-NE 3.04Å; D29-R32 IonicContact OD2-NH2 2.82Å; D29-R32 PolarHBondContact OD2-NH2 3.15Å; D29-E39 PolarHBondContact N-OE1 3.31Å
30	F	96.9	Very high	97.3	Very high	146 Å²	146	93 Å²	93	64%	0.64	44%	0.441	S	S	*	.			trans	-101.7	13.6	-179.4	-63.1	-86.8	0	0	0	113.3	F23 I27 R32	F23-F30 HydrophobicContact CZ-CE1 4.18Å; F23-F30 HydrophobicContact CZ-CZ 4.47Å; I27-F30 HydrophobicContact CG2-CD1 4.49Å; I27-F30 HydrophobicContact CG2-CE1 3.77Å; I27-F30 HydrophobicContact CG2-CE2 4.41Å; I27-F30 HydrophobicContact CG2-CZ 3.73Å; F30-R32 VanDerWaalsContact C-N 3.28Å; F30-R32 PolarHBondContact O-N 2.82Å
31	N	96.6	Very high	97.3	Very high	155 Å²	155	89 Å²	89	83%	0.829	43%	0.428	S	S	*	.	S	Bend	trans	-82	-5.6	-178.4	-60.7	-63.3	0	0	0	113.5	D29	D29-N31 WeakPolarHBondContact OD1-CB 3.41Å; D29-N31 PolarHBondContact OD1-N 3.48Å; D29-N31 PolarHBondContact OD1-ND2 3.39Å
32	R	95.1	Very high	97.3	Very high	126 Å²	126	86.8 Å²	86.8	48%	0.475	42%	0.421	S	S	.	.	S	Bend	trans	-147.6	160.6	-177.1	52.7	174.5	158.8	-177.8	-27	110.9	D29 F30 A34 N36	D29-R32 IonicContact OD2-CZ 3.37Å; D29-R32 IonicContact OD2-NE 2.94Å; D29-R32 PolarHBondContact OD2-NE 3.04Å; D29-R32 IonicContact OD2-NH2 2.82Å; D29-R32 PolarHBondContact OD2-NH2 3.15Å; F30-R32 VanDerWaalsContact C-N 3.28Å; F30-R32 PolarHBondContact O-N 2.82Å; R32-A34 WeakPolarHBondContact CD-O 3.35Å; R32-A34 VanDerWaalsContact CG-O 3.3Å; R32-A34 WeakPolarHBondContact CG-O 3.49Å; R32-N36 VanDerWaalsContact CZ-CB 3.42Å; R32-N36 VanDerWaalsContact NH1-CB 3.32Å; R32-N36 PolarHBondContact NH2-ND2 3.17Å
33	R	95.6	Very high	97.3	Very high	263 Å²	263	89 Å²	89	99%	0.992	43%	0.432	S	S	*	.	S	Bend	trans	-82	-27.6	179.3	-65.7	179.5	-179.5	-104	0.9	113.6
34	A	96.9	Very high	97.3	Very high	70 Å²	70	91.1 Å²	91.1	58%	0.579	44%	0.438	S	S	*	.	S	Bend	trans	-94.6	148.1	-180	0	0	0	0	0	110.4	R32	R32-A34 WeakPolarHBondContact CD-O 3.35Å; R32-A34 VanDerWaalsContact CG-O 3.3Å; R32-A34 WeakPolarHBondContact CG-O 3.49Å
35	L	96.6	Very high	97.3	Very high	69 Å²	69	94 Å²	94	36%	0.361	44%	0.441	S	S	.	.	P	Polyproline II helix	trans	-65.5	150.1	174.5	-59.3	178.2	0	0	0	110.9	I27 E39 E40 I43	I27-L35 HydrophobicContact CD1-CD2 3.33Å; L35-E39 WeakPolarHBondContact CA-OE2 3.47Å; L35-E39 HydrophobicContact CB-CB 4.23Å; L35-E39 HydrophobicContact CD2-CB 4.18Å; L35-E40 HydrophobicContact CB-CG 3.73Å; L35-E40 HydrophobicContact CD1-CG 4.03Å; L35-I43 HydrophobicContact CD1-CD1 3.51Å; L35-I43 HydrophobicContact CD2-CD1 4.38Å
36	N	96.2	Very high	97.4	Very high	14 Å²	14	86.9 Å²	86.9	8%	0.075	42%	0.415	C	S	.	.	P	Polyproline II helix	trans	-81.4	167.4	158.4	45.9	79	0	0	0	112.5	R32 E38 E39 E40	R32-N36 VanDerWaalsContact CZ-CB 3.42Å; R32-N36 VanDerWaalsContact NH1-CB 3.32Å; R32-N36 PolarHBondContact NH2-ND2 3.17Å; N36-E38 PolarHBondContact O-N 2.93Å; N36-E38 WeakPolarHBondContact OD1-CA 3.43Å; N36-E38 VanDerWaalsContact OD1-CB 3.23Å; N36-E38 WeakPolarHBondContact OD1-CB 3.39Å; N36-E38 PolarHBondContact OD1-N 2.92Å; N36-E39 PolarHBondContact N-OE2 3.21Å; N36-E39 VanDerWaalsContact N-OE2 3.12Å; N36-E39 PolarHBondContact ND2-OE2 3.47Å; N36-E39 PolarHBondContact O-N 2.85Å; N36-E39 WeakPolarHBondContact OD1-CG 3.48Å; N36-E39 PolarHBondContact OD1-N 3.4Å; N36-E40 WeakPolarHBondContact O-CG 3.41Å; N36-E40 PolarHBondContact O-N 3.42Å
37	S	97.4	Very high	97.4	Very high	93 Å²	93	89.7 Å²	89.7	65%	0.65	43%	0.432	S	S	*	.	H	α-helix	trans	-52	-33.9	169.5	51.6	0	0	0	0	114.3	S41	S37-S41 VanDerWaalsContact O-CB 3.27Å; S37-S41 WeakPolarHBondContact O-CB 3.28Å; S37-S41 PolarHBondContact O-N 3.01Å
38	E	97.8	Very high	97.4	Very high	133 Å²	133	92.2 Å²	92.2	62%	0.621	44%	0.444	S	S	*	.	H	α-helix	trans	-73.1	-44.4	178.3	-55	-177.1	173.2	0	0	111.5	F28 N36 S41 C42	F28-E38 HydrophobicContact CE1-CB 4.47Å; F28-E38 HydrophobicContact CZ-CB 4.1Å; N36-E38 PolarHBondContact O-N 2.93Å; N36-E38 WeakPolarHBondContact OD1-CA 3.43Å; N36-E38 VanDerWaalsContact OD1-CB 3.23Å; N36-E38 WeakPolarHBondContact OD1-CB 3.39Å; N36-E38 PolarHBondContact OD1-N 2.92Å; E38-S41 PolarHBondContact O-N 3.35Å; E38-C42 VanDerWaalsContact O-CB 3.26Å; E38-C42 WeakPolarHBondContact O-CB 3.14Å; E38-C42 PolarHBondContact O-N 3.24Å
39	E	98.4	Very high	97.5	Very high	2 Å²	2	93.1 Å²	93.1	1%	0.009	45%	0.447	C	S	.	.	H	α-helix	trans	-62.3	-45.5	174.4	-66.6	179.1	138.5	0	0	110.9	C26 I27 F28 D29 L35 N36 C42 I43	C26-E39 WeakPolarHBondContact O-CG 3.26Å; I27-E39 HydrophobicContact CD1-CB 4.36Å; F28-E39 HydrophobicContact CD1-CG 3.9Å; F28-E39 HydrophobicContact CE1-CG 3.48Å; F28-E39 VanDerWaalsContact CE1-CG 3.48Å; F28-E39 HydrophobicContact CZ-CG 3.88Å; F28-E39 PolarHBondContact N-OE1 3.42Å; D29-E39 PolarHBondContact N-OE1 3.31Å; L35-E39 WeakPolarHBondContact CA-OE2 3.47Å; L35-E39 HydrophobicContact CB-CB 4.23Å; L35-E39 HydrophobicContact CD2-CB 4.18Å; N36-E39 PolarHBondContact N-OE2 3.21Å; N36-E39 VanDerWaalsContact N-OE2 3.12Å; N36-E39 PolarHBondContact ND2-OE2 3.47Å; N36-E39 PolarHBondContact O-N 2.85Å; N36-E39 WeakPolarHBondContact OD1-CG 3.48Å; N36-E39 PolarHBondContact OD1-N 3.4Å; E39-C42 PolarHBondContact O-N 3.05Å; E39-I43 VanDerWaalsContact O-CG1 3.24Å; E39-I43 WeakPolarHBondContact O-CG1 3.32Å; E39-I43 PolarHBondContact O-N 2.95Å
40	E	98.1	Very high	97.6	Very high	114 Å²	114	93 Å²	93	53%	0.533	45%	0.448	S	S	.	.	H	α-helix	trans	-58.8	-48.6	175.1	-73.8	179.9	-176	0	0	111.7	L35 N36 C42 I43 Y44	L35-E40 HydrophobicContact CB-CG 3.73Å; L35-E40 HydrophobicContact CD1-CG 4.03Å; N36-E40 WeakPolarHBondContact O-CG 3.41Å; N36-E40 PolarHBondContact O-N 3.42Å; E40-C42 VanDerWaalsContact C-N 3.32Å; E40-C42 PolarHBondContact O-N 3.19Å; E40-I43 PolarHBondContact O-N 3.37Å; E40-Y44 PolarHBondContact O-N 3.45Å
41	S	98.4	Very high	97.6	Very high	47 Å²	47	88.7 Å²	88.7	33%	0.329	43%	0.434	S	S	.	.	H	α-helix	trans	-63.1	-40	177.2	-163.6	0	0	0	0	111.7	S37 E38 R45	S37-S41 VanDerWaalsContact O-CB 3.27Å; S37-S41 WeakPolarHBondContact O-CB 3.28Å; S37-S41 PolarHBondContact O-N 3.01Å; E38-S41 PolarHBondContact O-N 3.35Å; S41-R45 WeakPolarHBondContact O-CB 3.29Å; S41-R45 VanDerWaalsContact O-CG 3.28Å; S41-R45 WeakPolarHBondContact O-CG 3.48Å; S41-R45 PolarHBondContact O-N 3.42Å; S41-R45 VanDerWaalsContact O-N 3.08Å
42	C	98.6	Very high	97.6	Very high	39 Å²	39	86.5 Å²	86.5	26%	0.264	42%	0.419	S	S	.	.	H	α-helix	trans	-62.5	-48.2	176.5	-176.3	0	0	0	0	111.2	C26 E38 E39 E40 Y44 R45 C46	C26-C42 WeakPolarHBondContact CA-SG 3.24Å; C26-C42 HydrophobicContact CB-CB 3.56Å; C26-C42 WeakPolarHBondContact CB-SG 3.41Å; C26-C42 WeakPolarHBondContact SG-CB 3.49Å; C26-C42 PolarHBondContact SG-O 3.18Å; C26-C42 CovalentContact SG-SG 2.05Å; C26-C42 PolarHBondContact SG-SG 3.3Å; E38-C42 VanDerWaalsContact O-CB 3.26Å; E38-C42 WeakPolarHBondContact O-CB 3.14Å; E38-C42 PolarHBondContact O-N 3.24Å; E39-C42 PolarHBondContact O-N 3.05Å; E40-C42 VanDerWaalsContact C-N 3.32Å; E40-C42 PolarHBondContact O-N 3.19Å; C42-Y44 PolarHBondContact O-N 2.87Å; C42-R45 PolarHBondContact O-N 3.44Å; C42-C46 WeakPolarHBondContact O-CB 3.46Å; C42-C46 PolarHBondContact O-N 3.48Å
43	I	98.4	Very high	97.7	Very high	51 Å²	51	86.7 Å²	86.7	26%	0.262	42%	0.423	S	S	.	.	H	α-helix	trans	-60	-47	180	-69.3	165	0	0	0	110.4	C26 I27 L35 E39 E40 R45 C46 V47	C26-I43 HydrophobicContact CB-CG1 3.77Å; C26-I43 PolarHBondContact SG-N 3.26Å; I27-I43 HydrophobicContact CD1-CD1 3.84Å; L35-I43 HydrophobicContact CD1-CD1 3.51Å; L35-I43 HydrophobicContact CD2-CD1 4.38Å; E39-I43 VanDerWaalsContact O-CG1 3.24Å; E39-I43 WeakPolarHBondContact O-CG1 3.32Å; E39-I43 PolarHBondContact O-N 2.95Å; E40-I43 PolarHBondContact O-N 3.37Å; I43-R45 PolarHBondContact O-N 2.84Å; I43-C46 WeakPolarHBondContact O-CB 3.27Å; I43-C46 PolarHBondContact O-N 3.48Å; I43-V47 HydrophobicContact CG2-CG2 4.46Å; I43-V47 WeakPolarHBondContact O-CG2 3.08Å; I43-V47 PolarHBondContact O-N 3.36Å
44	Y	98.3	Very high	97.7	Very high	149 Å²	149	77.8 Å²	77.8	58%	0.584	40%	0.395	S	S	*	.	H	α-helix	trans	-57	-49.9	178.1	-178.8	-100.1	0	0	0	111.7	E40 C42 C46 V47 Q48	E40-Y44 PolarHBondContact O-N 3.45Å; C42-Y44 PolarHBondContact O-N 2.87Å; Y44-C46 PolarHBondContact O-N 2.84Å; Y44-V47 PolarHBondContact O-N 3.02Å; Y44-Q48 HydrophobicContact CE1-CG 4.35Å; Y44-Q48 VanDerWaalsContact CZ-NE2 3.32Å; Y44-Q48 WeakPolarHBondContact O-CG 3.41Å; Y44-Q48 PolarHBondContact O-N 2.96Å; Y44-Q48 VanDerWaalsContact O-N 3.08Å; Y44-Q48 PolarHBondContact OH-NE2 2.89Å
45	R	98.5	Very high	97.7	Very high	170 Å²	170	82.1 Å²	82.1	64%	0.642	40%	0.397	S	S	*	.	H	α-helix	trans	-64.8	-38.3	177.2	-69	173.6	-175.5	-171.5	2.4	112.2	S41 C42 I43 K49	S41-R45 WeakPolarHBondContact O-CB 3.29Å; S41-R45 VanDerWaalsContact O-CG 3.28Å; S41-R45 WeakPolarHBondContact O-CG 3.48Å; S41-R45 PolarHBondContact O-N 3.42Å; S41-R45 VanDerWaalsContact O-N 3.08Å; C42-R45 PolarHBondContact O-N 3.44Å; I43-R45 PolarHBondContact O-N 2.84Å; R45-K49 WeakPolarHBondContact O-CB 3Å; R45-K49 PolarHBondContact O-N 3.03Å
46	C	98.7	Very high	97.8	Very high	10 Å²	10	88.5 Å²	88.5	7%	0.068	42%	0.416	C	S	.	.	H	α-helix	trans	-61.9	-49	179.3	177.5	0	0	0	0	111	C22 C42 I43 Y44 S50	C22-C46 WeakPolarHBondContact CA-SG 3.09Å; C22-C46 HydrophobicContact CB-CB 3.91Å; C22-C46 WeakPolarHBondContact CB-SG 3.19Å; C22-C46 WeakPolarHBondContact SG-CB 3.4Å; C22-C46 CovalentContact SG-SG 2.05Å; C22-C46 PolarHBondContact SG-SG 3.27Å; C42-C46 WeakPolarHBondContact O-CB 3.46Å; C42-C46 PolarHBondContact O-N 3.48Å; I43-C46 WeakPolarHBondContact O-CB 3.27Å; I43-C46 PolarHBondContact O-N 3.48Å; Y44-C46 PolarHBondContact O-N 2.84Å; C46-S50 VanDerWaalsContact O-CB 3.24Å; C46-S50 WeakPolarHBondContact O-CB 3.26Å; C46-S50 PolarHBondContact O-N 3.42Å; C46-S50 PolarHBondContact O-OG 2.92Å
47	V	98.4	Very high	97.8	Very high	58 Å²	58	91.9 Å²	91.9	35%	0.352	43%	0.434	S	S	.	.	H	α-helix	trans	-62.3	-51.2	178.2	170.9	0	0	0	0	110.5	L18 I43 Y44 K49 S50 V51	L18-V47 HydrophobicContact CD2-CG1 4.3Å; L18-V47 HydrophobicContact CD2-CG2 4.5Å; I43-V47 HydrophobicContact CG2-CG2 4.46Å; I43-V47 WeakPolarHBondContact O-CG2 3.08Å; I43-V47 PolarHBondContact O-N 3.36Å; Y44-V47 PolarHBondContact O-N 3.02Å; V47-K49 PolarHBondContact O-N 3.46Å; V47-S50 PolarHBondContact O-N 2.81Å; V47-V51 WeakPolarHBondContact O-CG2 3.47Å; V47-V51 PolarHBondContact O-N 3.08Å
48	Q	98.3	Very high	97.7	Very high	80 Å²	80	91.5 Å²	91.5	37%	0.374	43%	0.427	S	S	.	.	H	α-helix	trans	-57.3	-50.9	178.4	-73.7	-174.3	-47.2	0	0	112	Y44 S50 V51 H52	Y44-Q48 HydrophobicContact CE1-CG 4.35Å; Y44-Q48 VanDerWaalsContact CZ-NE2 3.32Å; Y44-Q48 WeakPolarHBondContact O-CG 3.41Å; Y44-Q48 PolarHBondContact O-N 2.96Å; Y44-Q48 VanDerWaalsContact O-N 3.08Å; Y44-Q48 PolarHBondContact OH-NE2 2.89Å; Q48-S50 VanDerWaalsContact C-N 3.3Å; Q48-S50 PolarHBondContact O-N 2.82Å; Q48-V51 PolarHBondContact O-N 3.18Å; Q48-H52 PolarHBondContact O-CD2 2.9Å; Q48-H52 PolarHBondContact O-N 3.41Å
49	K	98.4	Very high	97.7	Very high	136 Å²	136	90.1 Å²	90.1	59%	0.591	43%	0.428	S	S	*	.	H	α-helix	trans	-59.3	-43	179.9	-176.9	173.9	-179.4	173.9	0	111.4	R45 V47 H52 F53	R45-K49 WeakPolarHBondContact O-CB 3Å; R45-K49 PolarHBondContact O-N 3.03Å; V47-K49 PolarHBondContact O-N 3.46Å; K49-H52 PolarHBondContact O-N 2.95Å; K49-F53 WeakPolarHBondContact O-CB 3.34Å; K49-F53 PolarHBondContact O-N 3.03Å
50	S	97.7	Very high	97.7	Very high	27 Å²	27	92.3 Å²	92.3	19%	0.189	45%	0.446	C	S	.	.	H	α-helix	trans	-66.6	-41.4	-179.4	-59	0	0	0	0	112	C46 V47 Q48 F53 N54	C46-S50 VanDerWaalsContact O-CB 3.24Å; C46-S50 WeakPolarHBondContact O-CB 3.26Å; C46-S50 PolarHBondContact O-N 3.42Å; C46-S50 PolarHBondContact O-OG 2.92Å; V47-S50 PolarHBondContact O-N 2.81Å; Q48-S50 VanDerWaalsContact C-N 3.3Å; Q48-S50 PolarHBondContact O-N 2.82Å; S50-F53 PolarHBondContact O-N 3.09Å; S50-N54 VanDerWaalsContact O-CB 3.26Å; S50-N54 WeakPolarHBondContact O-CB 3.07Å; S50-N54 PolarHBondContact O-N 3.36Å
51	V	96.7	Very high	97.6	Very high	56 Å²	56	93.2 Å²	93.2	34%	0.339	45%	0.448	S	S	.	.	H	α-helix	trans	-65.3	-46.1	175.7	171.8	0	0	0	0	111.3	V47 Q48 F53 N54 R55	V47-V51 WeakPolarHBondContact O-CG2 3.47Å; V47-V51 PolarHBondContact O-N 3.08Å; Q48-V51 PolarHBondContact O-N 3.18Å; V51-F53 VanDerWaalsContact C-N 3.35Å; V51-F53 PolarHBondContact O-N 2.96Å; V51-N54 PolarHBondContact O-N 2.93Å; V51-R55 WeakPolarHBondContact O-CG 3.24Å; V51-R55 PolarHBondContact O-N 2.7Å
52	H	97.6	Very high	97.6	Very high	109 Å²	109	93.6 Å²	93.6	51%	0.505	46%	0.455	S	S	.	.	H	α-helix	trans	-62.9	-41.6	176.4	-75.5	-64.6	0	0	0	112.3	Q48 K49 R56	Q48-H52 PolarHBondContact O-CD2 2.9Å; Q48-H52 PolarHBondContact O-N 3.41Å; K49-H52 PolarHBondContact O-N 2.95Å; H52-R56 WeakPolarHBondContact O-CG 3.3Å; H52-R56 PolarHBondContact O-N 3.43Å; H52-R56 VanDerWaalsContact O-N 3.15Å
53	F	96.9	Very high	97.5	Very high	131 Å²	131	94.9 Å²	94.9	58%	0.575	47%	0.468	S	S	*	.	H	α-helix	trans	-61.7	-48.5	175	173.2	-101.8	0	0	0	111.3	K49 S50 V51 R55 R56 L57	K49-F53 WeakPolarHBondContact O-CB 3.34Å; K49-F53 PolarHBondContact O-N 3.03Å; S50-F53 PolarHBondContact O-N 3.09Å; V51-F53 VanDerWaalsContact C-N 3.35Å; V51-F53 PolarHBondContact O-N 2.96Å; F53-R55 VanDerWaalsContact C-N 3.34Å; F53-R55 PolarHBondContact O-N 2.76Å; F53-R56 PolarHBondContact O-N 3.19Å; F53-L57 HydrophobicContact CE1-CD2 3.97Å; F53-L57 HydrophobicContact CZ-CD2 4.24Å; F53-L57 WeakPolarHBondContact O-CB 3.29Å; F53-L57 PolarHBondContact O-N 3.48Å
54	N	95.6	Very high	97.4	Very high	75 Å²	75	97.8 Å²	97.8	40%	0.401	48%	0.482	S	S	.	.	H	α-helix	trans	-58.9	-44.3	179.3	-179.4	-92.2	0	0	0	111.7	S50 V51 R56 L57 V58	S50-N54 VanDerWaalsContact O-CB 3.26Å; S50-N54 WeakPolarHBondContact O-CB 3.07Å; S50-N54 PolarHBondContact O-N 3.36Å; V51-N54 PolarHBondContact O-N 2.93Å; N54-R56 PolarHBondContact O-N 3.43Å; N54-L57 PolarHBondContact O-N 2.93Å; N54-V58 WeakPolarHBondContact O-CG2 3.33Å; N54-V58 PolarHBondContact O-N 3.27Å
55	R	96.7	Very high	97.3	Very high	161 Å²	161	94.1 Å²	94.1	61%	0.608	47%	0.472	S	S	*	.	H	α-helix	trans	-57.1	-47.6	174.6	-72.8	177	-177.3	176.7	2	112.3	V51 F53 L57 V58 V59	V51-R55 WeakPolarHBondContact O-CG 3.24Å; V51-R55 PolarHBondContact O-N 2.7Å; F53-R55 VanDerWaalsContact C-N 3.34Å; F53-R55 PolarHBondContact O-N 2.76Å; R55-L57 VanDerWaalsContact C-N 3.34Å; R55-V58 PolarHBondContact O-N 3.47Å; R55-V59 WeakPolarHBondContact O-CG2 3.46Å; R55-V59 PolarHBondContact O-N 3.46Å
56	R	98	Very high	97.2	Very high	203 Å²	203	89 Å²	89	77%	0.766	47%	0.466	S	S	*	.	H	α-helix	trans	-64	-40.3	177.9	-70.8	177.7	65.8	-175.5	0.3	112	H52 F53 N54 V59 A60	H52-R56 WeakPolarHBondContact O-CG 3.3Å; H52-R56 PolarHBondContact O-N 3.43Å; H52-R56 VanDerWaalsContact O-N 3.15Å; F53-R56 PolarHBondContact O-N 3.19Å; N54-R56 PolarHBondContact O-N 3.43Å; R56-V59 PolarHBondContact O-N 3.06Å; R56-A60 PolarHBondContact O-N 2.89Å
57	L	96.9	Very high	97	Very high	85 Å²	85	94.1 Å²	94.1	45%	0.445	49%	0.487	S	S	.	.	H	α-helix	trans	-63.8	-44.2	179.3	-177.7	63.6	0	0	0	111.5	F53 N54 R55 V59 A60 F61	F53-L57 HydrophobicContact CE1-CD2 3.97Å; F53-L57 HydrophobicContact CZ-CD2 4.24Å; F53-L57 WeakPolarHBondContact O-CB 3.29Å; F53-L57 PolarHBondContact O-N 3.48Å; N54-L57 PolarHBondContact O-N 2.93Å; R55-L57 VanDerWaalsContact C-N 3.34Å; L57-V59 PolarHBondContact O-N 3.37Å; L57-A60 PolarHBondContact O-N 2.93Å; L57-F61 VanDerWaalsContact O-CB 3.27Å; L57-F61 WeakPolarHBondContact O-CB 3.35Å; L57-F61 PolarHBondContact O-N 2.81Å
58	V	96	Very high	96.9	Very high	85 Å²	85	94.4 Å²	94.4	52%	0.515	49%	0.489	S	S	.	.	H	α-helix	trans	-60.4	-44.1	177.4	170.1	0	0	0	0	111.3	N54 R55 F61 A62	N54-V58 WeakPolarHBondContact O-CG2 3.33Å; N54-V58 PolarHBondContact O-N 3.27Å; R55-V58 PolarHBondContact O-N 3.47Å; V58-F61 PolarHBondContact O-N 2.9Å; V58-A62 WeakPolarHBondContact O-CB 3.25Å; V58-A62 PolarHBondContact O-N 3.43Å
59	V	97.5	Very high	96.7	Very high	105 Å²	105	94.3 Å²	94.3	64%	0.636	49%	0.488	S	S	*	.	H	α-helix	trans	-62	-47.4	176.6	173.2	0	0	0	0	111.4	R55 R56 L57 F61 A62 A63	R55-V59 WeakPolarHBondContact O-CG2 3.46Å; R55-V59 PolarHBondContact O-N 3.46Å; R56-V59 PolarHBondContact O-N 3.06Å; L57-V59 PolarHBondContact O-N 3.37Å; V59-F61 VanDerWaalsContact C-N 3.35Å; V59-F61 PolarHBondContact O-N 3.33Å; V59-A62 PolarHBondContact O-N 3.48Å; V59-A63 PolarHBondContact O-N 2.81Å; V59-A63 VanDerWaalsContact O-N 3.12Å
60	A	97.5	Very high	96.5	Very high	47 Å²	47	93.6 Å²	93.6	39%	0.388	49%	0.487	S	S	.	.	H	α-helix	trans	-63	-41.7	178.3	0	0	0	0	0	112	R56 L57 A63 M64	R56-A60 PolarHBondContact O-N 2.89Å; L57-A60 PolarHBondContact O-N 2.93Å; A60-A63 PolarHBondContact O-N 3.08Å; A60-M64 WeakPolarHBondContact O-CG 3.23Å; A60-M64 PolarHBondContact O-N 3.47Å
61	F	97.3	Very high	96.3	Very high	133 Å²	133	98.4 Å²	98.4	58%	0.583	50%	0.501	S	S	*	.	H	α-helix	trans	-63.8	-43	177.7	-177.4	-98.9	0	0	0	112	L57 V58 V59 A63 M64 N65	L57-F61 VanDerWaalsContact O-CB 3.27Å; L57-F61 WeakPolarHBondContact O-CB 3.35Å; L57-F61 PolarHBondContact O-N 2.81Å; V58-F61 PolarHBondContact O-N 2.9Å; V59-F61 VanDerWaalsContact C-N 3.35Å; V59-F61 PolarHBondContact O-N 3.33Å; F61-A63 VanDerWaalsContact C-N 3.35Å; F61-A63 PolarHBondContact O-N 2.94Å; F61-M64 PolarHBondContact O-N 3.37Å; F61-N65 WeakPolarHBondContact O-CB 3.41Å; F61-N65 PolarHBondContact O-N 2.82Å
62	A	97.1	Very high	96.2	Very high	56 Å²	56	100.8 Å²	100.8	46%	0.463	51%	0.507	S	S	.	.	H	α-helix	trans	-60.7	-43.5	176.2	0	0	0	0	0	112	V58 V59 N65 A66	V58-A62 WeakPolarHBondContact O-CB 3.25Å; V58-A62 PolarHBondContact O-N 3.43Å; V59-A62 PolarHBondContact O-N 3.48Å; A62-N65 PolarHBondContact O-N 3.45Å; A62-A66 PolarHBondContact O-N 3.25Å
63	A	96.6	Very high	96	Very high	65 Å²	65	100 Å²	100	54%	0.537	51%	0.507	S	S	.	.	H	α-helix	trans	-62.8	-45.2	176.4	0	0	0	0	0	112.3	V59 A60 F61 A66 F67	V59-A63 PolarHBondContact O-N 2.81Å; V59-A63 VanDerWaalsContact O-N 3.12Å; A60-A63 PolarHBondContact O-N 3.08Å; F61-A63 VanDerWaalsContact C-N 3.35Å; F61-A63 PolarHBondContact O-N 2.94Å; A63-A66 PolarHBondContact O-N 3.08Å; A63-F67 PolarHBondContact O-N 3.31Å
64	M	96.9	Very high	95.8	Very high	113 Å²	113	98.2 Å²	98.2	56%	0.557	50%	0.502	S	S	*	.	H	α-helix	trans	-63.8	-42	176.1	-72.4	-173.5	-65.5	0	0	112.2	A60 F61 A66 F67 V68	A60-M64 WeakPolarHBondContact O-CG 3.23Å; A60-M64 PolarHBondContact O-N 3.47Å; F61-M64 PolarHBondContact O-N 3.37Å; M64-A66 VanDerWaalsContact C-N 3.33Å; M64-A66 PolarHBondContact O-N 3.41Å; M64-F67 PolarHBondContact O-N 3.45Å; M64-V68 WeakPolarHBondContact O-CG2 3.33Å; M64-V68 PolarHBondContact O-N 3.36Å
65	N	96.4	Very high	95.6	Very high	72 Å²	72	99.3 Å²	99.3	39%	0.385	51%	0.505	S	S	.	.	H	α-helix	trans	-62	-42.5	178.3	-174.7	49.1	0	0	0	110.9	F61 A62 F67 V68 Q69	F61-N65 WeakPolarHBondContact O-CB 3.41Å; F61-N65 PolarHBondContact O-N 2.82Å; A62-N65 PolarHBondContact O-N 3.45Å; N65-F67 PolarHBondContact O-N 3.49Å; N65-V68 PolarHBondContact O-N 3.19Å; N65-Q69 VanDerWaalsContact O-CG 3.3Å; N65-Q69 WeakPolarHBondContact O-CG 3.33Å; N65-Q69 PolarHBondContact O-N 3.01Å; N65-Q69 PolarHBondContact OD1-NE2 3.45Å
66	A	95.9	Very high	95.3	Very high	61 Å²	61	95.3 Å²	95.3	50%	0.504	50%	0.498	S	S	.	.	H	α-helix	trans	-56.7	-46.8	175.8	0	0	0	0	0	112.3	A62 A63 M64 V68 Q69 E70	A62-A66 PolarHBondContact O-N 3.25Å; A63-A66 PolarHBondContact O-N 3.08Å; M64-A66 VanDerWaalsContact C-N 3.33Å; M64-A66 PolarHBondContact O-N 3.41Å; A66-V68 PolarHBondContact O-N 2.05Å; A66-Q69 PolarHBondContact O-N 3.31Å; A66-E70 PolarHBondContact O-N 2.9Å
67	F	95.2	Very high	94.7	Very high	118 Å²	118	91.9 Å²	91.9	52%	0.518	49%	0.491	S	S	.	.	H	α-helix	trans	-62.1	-41.6	176.1	177.2	-100.6	0	0	0	112.9	A63 M64 N65 E70 R71	A63-F67 PolarHBondContact O-N 3.31Å; M64-F67 PolarHBondContact O-N 3.45Å; N65-F67 PolarHBondContact O-N 3.49Å; F67-E70 PolarHBondContact O-N 2.91Å; F67-R71 VanDerWaalsContact CE1-CD 3.4Å; F67-R71 HydrophobicContact CE1-CG 4.22Å; F67-R71 HydrophobicContact CZ-CG 4.19Å; F67-R71 PolarHBondContact O-N 2.05Å; F67-R71 VanDerWaalsContact O-N 3.08Å
68	V	95.7	Very high	94.2	Very high	64 Å²	64	91.9 Å²	91.9	39%	0.388	50%	0.498	S	S	.	.	H	α-helix	trans	-65.4	-39.6	177.4	170.7	0	0	0	0	111.4	M64 N65 A66 R71 K72	M64-V68 WeakPolarHBondContact O-CG2 3.33Å; M64-V68 PolarHBondContact O-N 3.36Å; N65-V68 PolarHBondContact O-N 3.19Å; A66-V68 PolarHBondContact O-N 2.05Å; V68-R71 PolarHBondContact O-N 3.28Å; V68-K72 HydrophobicContact CG1-CD 4.34Å; V68-K72 WeakPolarHBondContact O-CG 3.21Å; V68-K72 PolarHBondContact O-N 3.39Å
69	Q	94.9	Very high	93.6	Very high	78 Å²	78	95.9 Å²	95.9	36%	0.364	51%	0.508	S	S	.	.	H	α-helix	trans	-66.3	-42	176.4	-64.3	-55.7	-23.7	0	0	111.6	N65 A66 R71 K72 N73	N65-Q69 VanDerWaalsContact O-CG 3.3Å; N65-Q69 WeakPolarHBondContact O-CG 3.33Å; N65-Q69 PolarHBondContact O-N 3.01Å; N65-Q69 PolarHBondContact OD1-NE2 3.45Å; A66-Q69 PolarHBondContact O-N 3.31Å; Q69-R71 VanDerWaalsContact C-N 3.35Å; Q69-R71 PolarHBondContact O-N 2.92Å; Q69-K72 PolarHBondContact O-N 3.11Å; Q69-N73 PolarHBondContact O-N 3.01Å; Q69-N73 PolarHBondContact O-ND2 3.36Å; Q69-N73 PolarHBondContact O-OD1 2.85Å
70	E	93.9	Very high	92.4	Very high	121 Å²	121	97.2 Å²	97.2	57%	0.565	51%	0.512	S	S	*	.	H	α-helix	trans	-58.2	-46.6	175.6	-176.4	172.9	-168.6	0	0	111.6	A66 F67 K72 N73 I74	A66-E70 PolarHBondContact O-N 2.9Å; F67-E70 PolarHBondContact O-N 2.91Å; E70-K72 PolarHBondContact O-N 3.33Å; E70-N73 WeakPolarHBondContact O-CB 3.43Å; E70-N73 PolarHBondContact O-N 3.23Å; E70-I74 HydrophobicContact CG-CD1 4.34Å; E70-I74 WeakPolarHBondContact O-CG1 3.41Å; E70-I74 PolarHBondContact O-N 3.48Å; E70-I74 VanDerWaalsContact O-N 3.07Å
71	R	94.1	Very high	90.7	Very high	129 Å²	129	102.5 Å²	102.5	49%	0.487	55%	0.546	S	S	.	.	H	α-helix	trans	-59.6	-44.6	175.2	-75.4	-173.1	58.1	177.5	-2.9	113.1	F67 V68 Q69 N73 I74 E75	F67-R71 VanDerWaalsContact CE1-CD 3.4Å; F67-R71 HydrophobicContact CE1-CG 4.22Å; F67-R71 HydrophobicContact CZ-CG 4.19Å; F67-R71 PolarHBondContact O-N 2.05Å; F67-R71 VanDerWaalsContact O-N 3.08Å; V68-R71 PolarHBondContact O-N 3.28Å; Q69-R71 VanDerWaalsContact C-N 3.35Å; Q69-R71 PolarHBondContact O-N 2.92Å; R71-N73 VanDerWaalsContact C-N 3.26Å; R71-N73 PolarHBondContact O-N 3Å; R71-I74 PolarHBondContact O-N 3.34Å; R71-E75 IonicContact NH2-OE1 3.89Å; R71-E75 WeakPolarHBondContact O-CG 3.38Å; R71-E75 PolarHBondContact O-N 2.86Å
72	K	93.7	Very high	90.4	Very high	106 Å²	106	101 Å²	101	46%	0.461	54%	0.544	S	S	.	.	H	α-helix	trans	-60.6	-37.7	176.6	-75.2	177	177.7	-176.8	0	112	V68 Q69 E70 E75 T76	V68-K72 HydrophobicContact CG1-CD 4.34Å; V68-K72 WeakPolarHBondContact O-CG 3.21Å; V68-K72 PolarHBondContact O-N 3.39Å; Q69-K72 PolarHBondContact O-N 3.11Å; E70-K72 PolarHBondContact O-N 3.33Å; K72-E75 PolarHBondContact O-N 3.12Å; K72-T76 WeakPolarHBondContact O-CB 3.18Å; K72-T76 PolarHBondContact O-N 3Å; K72-T76 PolarHBondContact O-OG1 3.01Å
73	N	92.8	Very high	90	Very high	92 Å²	92	103.3 Å²	103.3	49%	0.492	55%	0.548	S	S	.	.	H	α-helix	trans	-66.4	-44.3	178.3	-66.1	-15.7	0	0	0	111.3	Q69 E70 R71 T76 Q77	Q69-N73 PolarHBondContact O-N 3.01Å; Q69-N73 PolarHBondContact O-ND2 3.36Å; Q69-N73 PolarHBondContact O-OD1 2.85Å; E70-N73 WeakPolarHBondContact O-CB 3.43Å; E70-N73 PolarHBondContact O-N 3.23Å; R71-N73 VanDerWaalsContact C-N 3.26Å; R71-N73 PolarHBondContact O-N 3Å; N73-T76 PolarHBondContact O-N 2.79Å; N73-Q77 WeakPolarHBondContact O-CG 3.3Å; N73-Q77 PolarHBondContact O-N 3.48Å
74	I	93.1	Very high	89.7	Confident	94 Å²	94	105.4 Å²	105.4	48%	0.482	55%	0.549	S	S	.	.	H	α-helix	trans	-60.4	-47.6	175.5	-64.6	166.2	0	0	0	110.6	E70 R71 T76 Q77 S78	E70-I74 HydrophobicContact CG-CD1 4.34Å; E70-I74 WeakPolarHBondContact O-CG1 3.41Å; E70-I74 PolarHBondContact O-N 3.48Å; E70-I74 VanDerWaalsContact O-N 3.07Å; R71-I74 PolarHBondContact O-N 3.34Å; I74-T76 VanDerWaalsContact C-N 3.29Å; I74-T76 PolarHBondContact O-N 2.88Å; I74-Q77 PolarHBondContact O-N 3.22Å; I74-S78 PolarHBondContact O-N 3.24Å; I74-S78 PolarHBondContact O-OG 2.82Å
75	E	91.8	Very high	89.2	Confident	97 Å²	97	105 Å²	105	45%	0.453	55%	0.549	S	S	.	.	H	α-helix	trans	-62.5	-34.8	178.6	-71.1	172	-170.7	0	0	112.7	R71 K72 K79	R71-E75 IonicContact NH2-OE1 3.89Å; R71-E75 WeakPolarHBondContact O-CG 3.38Å; R71-E75 PolarHBondContact O-N 2.86Å; K72-E75 PolarHBondContact O-N 3.12Å; E75-K79 WeakPolarHBondContact O-CG 3.34Å; E75-K79 PolarHBondContact O-N 2.94Å
76	T	90.7	Very high	88.8	Confident	77 Å²	77	107.1 Å²	107.1	47%	0.472	56%	0.559	S	S	.	*	H	α-helix	trans	-72.2	-37.3	177	-55	0	0	0	0	111.5	K72 N73 I74 K79 N80	K72-T76 WeakPolarHBondContact O-CB 3.18Å; K72-T76 PolarHBondContact O-N 3Å; K72-T76 PolarHBondContact O-OG1 3.01Å; N73-T76 PolarHBondContact O-N 2.79Å; I74-T76 VanDerWaalsContact C-N 3.29Å; I74-T76 PolarHBondContact O-N 2.88Å; T76-K79 PolarHBondContact O-N 2.99Å; T76-N80 PolarHBondContact O-N 2.82Å; T76-N80 PolarHBondContact O-ND2 3.06Å
77	Q	85.6	Confident	88.3	Confident	132 Å²	132	110.1 Å²	110.1	62%	0.617	56%	0.562	S	S	*	*	H	α-helix	trans	-66.7	-42.2	175.4	-72	176.9	13	0	0	111.9	N73 I74 K79 N80 S81	N73-Q77 WeakPolarHBondContact O-CG 3.3Å; N73-Q77 PolarHBondContact O-N 3.48Å; I74-Q77 PolarHBondContact O-N 3.22Å; Q77-K79 PolarHBondContact O-N 3.41Å; Q77-N80 PolarHBondContact O-N 2.99Å; Q77-S81 PolarHBondContact O-N 3.09Å; Q77-S81 PolarHBondContact O-OG 3.45Å
78	S	85	Confident	87.8	Confident	84 Å²	84	109.6 Å²	109.6	59%	0.587	57%	0.566	S	S	*	*	H	α-helix	trans	-67.2	-21.7	177.1	-59	0	0	0	0	114.1	I74	I74-S78 PolarHBondContact O-N 3.24Å; I74-S78 PolarHBondContact O-OG 2.82Å
79	K	83.4	Confident	87.2	Confident	169 Å²	169	113.1 Å²	113.1	74%	0.735	58%	0.579	S	S	*	*	H	α-helix	trans	-86	-18.9	174.8	-75.4	178	-179.6	178.3	0	113.5	E75 T76 Q77	E75-K79 WeakPolarHBondContact O-CG 3.34Å; E75-K79 PolarHBondContact O-N 2.94Å; T76-K79 PolarHBondContact O-N 2.99Å; Q77-K79 PolarHBondContact O-N 3.41Å
80	N	73.5	Confident	86.6	Confident	134 Å²	134	116 Å²	116	72%	0.717	60%	0.597	S	S	*	*			trans	-101.6	4.1	-178.1	-69	-10.7	0	0	0	112.9	T76 Q77	T76-N80 PolarHBondContact O-N 2.82Å; T76-N80 PolarHBondContact O-ND2 3.06Å; Q77-N80 PolarHBondContact O-N 2.99Å
81	S	61.2	Low	85.9	Confident	157 Å²	157	115.5 Å²	115.5	100%	1.098	60%	0.6	S	S	*	*			trans	-111.7	0	170	-55.4	0	0	0	0	109.6	Q77	Q77-S81 PolarHBondContact O-N 3.09Å; Q77-S81 PolarHBondContact O-OG 3.45Å

Retrieved 81 of 81 residues in 52.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).