A0A077ZKC5_TRITR Loading...

Retrovirus-related Pol polyprotein from transposon TNT 1-94-like beta-barrel domain-containing protein

AlphaFold DB , UniProt , Accession A0A077ZKC5, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 106 aa.

						>A0A077ZKC5_TRITR|A0A077ZKC5
MTSDKDFFTSLHVDSGATSHMTSDKDFFTSLRPMKATVYLADSNPAQSEGIGERWLFCLTPTGTIKMIHLEEVPYVPSLEGGFLSVQRLMCGGCTVTFKRTTCLIS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	35.3	Very low	51.3	Low	243 Å²	243	126.9 Å²	126.9	100%	1.197	66%	0.661	S	S	*	*				0	102.8	0	-65.1	171.2	-158.5	0	0	105.5	S3	M1-S3 PolarHBondContact O-N 2.94Å; M1-S3 VanDerWaalsContact O-N 3.17Å
2	T	33.8	Very low	54.8	Low	129 Å²	129	124.4 Å²	124.4	79%	0.791	64%	0.643	S	S	*	*			trans	-61.7	117.9	174.1	41.2	0	0	0	0	106	D4	T2-D4 VanDerWaalsContact C-N 3.31Å; T2-D4 PolarHBondContact O-N 3.07Å
3	S	34.2	Very low	57.9	Low	106 Å²	106	118.2 Å²	118.2	74%	0.741	61%	0.614	S	S	*	*			trans	-50.3	103.2	170.8	175.7	0	0	0	0	106.3	M1 K5	M1-S3 PolarHBondContact O-N 2.94Å; M1-S3 VanDerWaalsContact O-N 3.17Å; S3-K5 VanDerWaalsContact C-N 3.3Å; S3-K5 PolarHBondContact O-N 2.82Å
4	D	41.4	Very low	60.6	Low	111 Å²	111	113.5 Å²	113.5	59%	0.594	59%	0.59	S	S	*	*			trans	-50.6	109.1	163.7	-72.2	-43.4	0	0	0	103.7	T2 D6	T2-D4 VanDerWaalsContact C-N 3.31Å; T2-D4 PolarHBondContact O-N 3.07Å; D4-D6 PolarHBondContact O-N 3.44Å
5	K	40.9	Very low	62.9	Low	188 Å²	188	112.3 Å²	112.3	82%	0.817	60%	0.595	S	S	*	*			trans	-60.1	106.7	168.3	-75.1	179.8	178	170.9	0	102.4	S3 F7	S3-K5 VanDerWaalsContact C-N 3.3Å; S3-K5 PolarHBondContact O-N 2.82Å; K5-F7 PolarHBondContact O-N 3.04Å
6	D	43.9	Very low	64.9	Low	123 Å²	123	108.9 Å²	108.9	66%	0.658	60%	0.596	S	S	*	*			trans	-31.5	122.7	-179.8	-58.8	-54.7	0	0	0	108.3	D4 F8	D4-D6 PolarHBondContact O-N 3.44Å; D6-F8 HydrophobicContact CB-CD2 3.81Å; D6-F8 HydrophobicContact CB-CE2 3.63Å; D6-F8 WeakPolarHBondContact O-CD2 3.5Å; D6-F8 PolarHBondContact O-N 2.72Å
7	F	41.8	Very low	66.6	Low	189 Å²	189	103.2 Å²	103.2	83%	0.829	57%	0.567	S	S	*	*			trans	-62.1	52.1	-172.1	-85.4	-98.5	0	0	0	112.6	K5 T9	K5-F7 PolarHBondContact O-N 3.04Å; F7-T9 PolarHBondContact O-N 3.31Å
8	F	52.6	Low	68.2	Low	143 Å²	143	102.9 Å²	102.9	63%	0.627	57%	0.569	S	S	*	*	P	Polyproline II helix	trans	-68.3	126.8	166.7	-70.8	-70.9	0	0	0	107.2	D6 S10	D6-F8 HydrophobicContact CB-CD2 3.81Å; D6-F8 HydrophobicContact CB-CE2 3.63Å; D6-F8 WeakPolarHBondContact O-CD2 3.5Å; D6-F8 PolarHBondContact O-N 2.72Å; F8-S10 PolarHBondContact O-N 3.17Å
9	T	63.2	Low	69.7	Low	40 Å²	40	98.8 Å²	98.8	25%	0.245	55%	0.548	C	S	.	.	P	Polyproline II helix	trans	-51.2	132.8	161.5	52	0	0	0	0	109.4	F7 L11 T22 D24	F7-T9 PolarHBondContact O-N 3.31Å; T9-L11 PolarHBondContact O-N 3.14Å; T9-T22 PolarHBondContact OG1-OG1 2.95Å; T9-D24 HydrophobicContact CG2-CB 3.68Å; T9-D24 WeakPolarHBondContact OG1-CB 3.39Å; T9-D24 PolarHBondContact OG1-OD2 2.86Å
10	S	86.1	Confident	71.1	Confident	68 Å²	68	94.3 Å²	94.3	48%	0.476	52%	0.522	S	S	.	.	P	Polyproline II helix	trans	-67	120	177.1	54.2	0	0	0	0	109.6	F8 H12 G82	F8-S10 PolarHBondContact O-N 3.17Å; S10-H12 PolarHBondContact O-ND1 2.85Å; S10-H12 PolarHBondContact OG-CE1 2.8Å; S10-G82 PolarHBondContact O-N 2.8Å; S10-G82 VanDerWaalsContact O-N 3.08Å
11	L	91.5	Very high	72.3	Confident	56 Å²	56	90.5 Å²	90.5	29%	0.293	50%	0.501	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.8	126.6	169.3	-67.4	177.8	0	0	0	110.3	T9 F27 G82 L84	T9-L11 PolarHBondContact O-N 3.14Å; L11-F27 HydrophobicContact CD1-CD2 4.25Å; L11-F27 HydrophobicContact CD1-CE2 3.49Å; L11-F27 VanDerWaalsContact CD1-CE2 3.49Å; L11-F27 HydrophobicContact CD1-CZ 3.98Å; L11-G82 WeakPolarHBondContact CA-O 3.42Å; L11-L84 HydrophobicContact CB-CD1 4.49Å; L11-L84 HydrophobicContact CB-CG 4.34Å; L11-L84 HydrophobicContact CD1-CD2 4.35Å; L11-L84 HydrophobicContact CD1-CG 4.41Å
12	H	93.3	Very high	75.2	Confident	97 Å²	97	79 Å²	79	45%	0.449	44%	0.444	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.6	130.3	177.6	-60.3	89	0	0	0	110.3	S10 D14 G82 F83 L84	S10-H12 PolarHBondContact O-ND1 2.85Å; S10-H12 PolarHBondContact OG-CE1 2.8Å; H12-D14 PolarHBondContact O-N 2.82Å; H12-G82 PolarHBondContact N-O 3.39Å; H12-F83 HydrophobicContact CB-CD1 4.06Å; H12-F83 HydrophobicContact CB-CE1 4.4Å; H12-F83 CarbonylContact O-C 3.59Å; H12-F83 VanDerWaalsContact O-CA 3.29Å; H12-F83 WeakPolarHBondContact O-CA 3.37Å; H12-L84 PolarHBondContact O-N 2.87Å
13	V	94.7	Very high	78.2	Confident	44 Å²	44	74 Å²	74	27%	0.267	41%	0.414	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.5	118.6	170	-179	0	0	0	0	108	L84 V86 L89 V96 F98 I105	V13-L84 WeakPolarHBondContact CA-O 3.44Å; V13-L84 HydrophobicContact CG2-CB 4.39Å; V13-L84 HydrophobicContact CG2-CD1 4.46Å; V13-V86 HydrophobicContact CG1-CG2 3.49Å; V13-V86 VanDerWaalsContact CG1-CG2 3.49Å; V13-L89 HydrophobicContact CG1-CD1 4.35Å; V13-V96 HydrophobicContact CG1-CG1 4.35Å; V13-F98 HydrophobicContact CG1-CE1 4.5Å; V13-F98 HydrophobicContact CG1-CZ 3.99Å; V13-I105 HydrophobicContact CG2-CD1 4.06Å
14	D	95.1	Very high	81.1	Confident	52 Å²	52	69.8 Å²	69.8	28%	0.278	38%	0.384	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.9	120.5	-173	-177.7	15.3	0	0	0	110.6	H12 G16 A17 F83 L84 S85 V86	H12-D14 PolarHBondContact O-N 2.82Å; D14-G16 VanDerWaalsContact C-N 3.32Å; D14-G16 WeakPolarHBondContact OD1-CA 3.42Å; D14-G16 PolarHBondContact OD1-N 3.34Å; D14-A17 HydrophobicContact CB-CB 3.99Å; D14-A17 WeakPolarHBondContact OD2-CB 3.47Å; D14-A17 PolarHBondContact OD2-N 2.88Å; D14-F83 HydrophobicContact CB-CB 4.38Å; D14-F83 HydrophobicContact CB-CD1 4.08Å; D14-L84 PolarHBondContact N-O 2.86Å; D14-S85 WeakPolarHBondContact O-CA 3.48Å; D14-V86 PolarHBondContact O-N 2.91Å
15	S	95.7	Very high	83.7	Confident	95 Å²	95	70.5 Å²	70.5	66%	0.664	38%	0.382	S	S	*	.	S	Bend	trans	-77.7	-18.5	174.2	56.5	0	0	0	0	113.1
16	G	94.5	Very high	86.2	Confident	59 Å²	59	68.3 Å²	68.3	61%	0.608	38%	0.379	S	S	*	.	S	Bend	trans	-79.9	-22.3	175	0	0	0	0	0	113.6	D14	D14-G16 VanDerWaalsContact C-N 3.32Å; D14-G16 WeakPolarHBondContact OD1-CA 3.42Å; D14-G16 PolarHBondContact OD1-N 3.34Å
17	A	94.8	Very high	88.6	Confident	12 Å²	12	63.2 Å²	63.2	10%	0.099	35%	0.351	C	S	.	.			trans	-74.4	131.1	177	0	0	0	0	0	111.9	D14 F83 S85	D14-A17 HydrophobicContact CB-CB 3.99Å; D14-A17 WeakPolarHBondContact OD2-CB 3.47Å; D14-A17 PolarHBondContact OD2-N 2.88Å; A17-F83 HydrophobicContact CB-CB 4.16Å; A17-S85 WeakPolarHBondContact O-CB 3.14Å; A17-S85 PolarHBondContact O-OG 2.85Å
18	T	95.5	Very high	91.2	Very high	98 Å²	98	55.1 Å²	55.1	60%	0.601	32%	0.315	S	S	*	.	S	Bend	trans	-86.3	-15.2	176.9	55.3	0	0	0	0	113.6	R88	T18-R88 PolarHBondContact O-NE 2.81Å
19	S	96.4	Very high	93.3	Very high	24 Å²	24	52.5 Å²	52.5	17%	0.168	31%	0.311	C	S	.	.	S	Bend	trans	-141.2	153.3	178.2	-171.7	0	0	0	0	110.1	S85	S19-S85 VanDerWaalsContact C-CB 3.42Å; S19-S85 WeakPolarHBondContact O-CB 3.31Å
20	H	97.1	Very high	94.9	Very high	9 Å²	9	53.1 Å²	53.1	4%	0.042	32%	0.317	C	S	.	.			trans	-60.9	150.5	157	-55.6	-50	0	0	0	108.8	V73 P74 F83 L84 S85 R88	H20-V73 HydrophobicContact CB-CB 4.29Å; H20-V73 HydrophobicContact CB-CG1 3.9Å; H20-V73 HydrophobicContact CB-CG2 3.8Å; H20-P74 WeakPolarHBondContact O-CD 3.25Å; H20-F83 CarbonylContact C-O 3.53Å; H20-F83 VanDerWaalsContact CA-O 3.25Å; H20-F83 WeakPolarHBondContact CA-O 3.19Å; H20-L84 WeakPolarHBondContact ND1-CA 3.19Å; H20-S85 PolarHBondContact CE1-O 2.88Å; H20-S85 PolarHBondContact ND1-N 3.13Å; H20-S85 VanDerWaalsContact ND1-N 3.17Å; H20-R88 VanDerWaalsContact CE1-CB 3.45Å; H20-R88 WeakPolarHBondContact CE1-CB 3.34Å; H20-R88 WeakPolarHBondContact NE2-CB 3.47Å
21	M	96.7	Very high	95.5	Very high	14 Å²	14	52.6 Å²	52.6	7%	0.069	31%	0.308	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-163.6	156.7	170.1	60.9	-172.4	76.8	0	0	110.4	V38 P74 V76 L79 G82 F83	M21-V38 HydrophobicContact CE-CG1 3.7Å; M21-V38 HydrophobicContact SD-CG1 3.79Å; M21-P74 WeakPolarHBondContact CA-O 3.41Å; M21-V76 HydrophobicContact CB-CG2 4.27Å; M21-L79 HydrophobicContact CG-CD2 3.78Å; M21-L79 HydrophobicContact SD-CD2 4.06Å; M21-G82 CarbonylContact O-C 3.58Å; M21-G82 WeakPolarHBondContact O-CA 3.48Å; M21-F83 HydrophobicContact CG-CB 4.33Å; M21-F83 HydrophobicContact CG-CD2 3.83Å; M21-F83 PolarHBondContact N-O 3.17Å; M21-F83 PolarHBondContact O-N 2.82Å; M21-F83 HydrophobicContact SD-CD2 3.97Å
22	T	96.7	Very high	95.9	Very high	1 Å²	1	55.5 Å²	55.5	1%	0.006	32%	0.316	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-155.7	153.8	175.8	-175	0	0	0	0	111.5	T9 D24 F27 F28 P74 Y75 V76	T9-T22 PolarHBondContact OG1-OG1 2.95Å; T22-D24 PolarHBondContact OG1-N 2.93Å; T22-D24 VanDerWaalsContact OG1-N 3.13Å; T22-F27 HydrophobicContact CG2-CB 4.03Å; T22-F27 HydrophobicContact CG2-CD1 3.69Å; T22-F27 HydrophobicContact CG2-CE1 4.35Å; T22-F27 HydrophobicContact CG2-CG 3.94Å; T22-F28 HydrophobicContact CG2-CE2 3.66Å; T22-F28 HydrophobicContact CG2-CZ 3.73Å; T22-P74 PolarHBondContact N-O 2.61Å; T22-Y75 CarbonylContact O-C 3.58Å; T22-Y75 WeakPolarHBondContact O-CA 3.5Å; T22-V76 PolarHBondContact O-N 3Å
23	S	95.6	Very high	96.1	Very high	24 Å²	24	56.8 Å²	56.8	17%	0.168	33%	0.333	C	S	.	.	S	Bend	trans	-89.6	0.1	168.1	57	0	0	0	0	114.2	Y75 V76 L79 G81	S23-Y75 VanDerWaalsContact O-CE2 3.28Å; S23-Y75 WeakPolarHBondContact O-CE2 3.12Å; S23-V76 VanDerWaalsContact CA-O 3.27Å; S23-V76 WeakPolarHBondContact CA-O 3.03Å; S23-V76 WeakPolarHBondContact CB-O 3.4Å; S23-L79 WeakPolarHBondContact CB-O 2.91Å; S23-L79 PolarHBondContact OG-O 2.8Å; S23-G81 PolarHBondContact N-O 3.23Å; S23-G81 PolarHBondContact OG-N 2.93Å; S23-G81 PolarHBondContact OG-O 3.04Å; S23-G81 VanDerWaalsContact OG-O 3.13Å
24	D	95.9	Very high	96.3	Very high	19 Å²	19	58.8 Å²	58.8	10%	0.102	34%	0.34	C	S	.	.			trans	-91	115.1	178.5	-177.2	-6.9	0	0	0	111.2	T9 T22 D26 F27 F28	T9-D24 HydrophobicContact CG2-CB 3.68Å; T9-D24 WeakPolarHBondContact OG1-CB 3.39Å; T9-D24 PolarHBondContact OG1-OD2 2.86Å; T22-D24 PolarHBondContact OG1-N 2.93Å; T22-D24 VanDerWaalsContact OG1-N 3.13Å; D24-D26 WeakPolarHBondContact OD1-CA 3.36Å; D24-D26 PolarHBondContact OD1-N 3.18Å; D24-F27 HydrophobicContact CB-CB 4.07Å; D24-F27 WeakPolarHBondContact O-CB 3.49Å; D24-F27 PolarHBondContact OD1-N 3.34Å; D24-F28 WeakPolarHBondContact O-CD2 3.28Å; D24-F28 VanDerWaalsContact O-CE2 3.25Å; D24-F28 WeakPolarHBondContact O-CE2 3.41Å
25	K	95.1	Very high	96.4	Very high	126 Å²	126	64.9 Å²	64.9	55%	0.548	36%	0.364	S	S	.	.	S	Bend	trans	-75.9	-29.4	179.9	-162.8	176.1	-177.5	177.2	0	112.5	F27 L31 Y75	K25-F27 PolarHBondContact O-N 2.64Å; K25-L31 HydrophobicContact CG-CD2 3.83Å; K25-Y75 HydrophobicContact CB-CD2 4.36Å; K25-Y75 HydrophobicContact CB-CE2 3.72Å; K25-Y75 HydrophobicContact CD-CE1 4.41Å; K25-Y75 HydrophobicContact CG-CE1 4.49Å; K25-Y75 HydrophobicContact CG-CE2 4.26Å
26	D	94.1	Very high	96.4	Very high	142 Å²	142	62.3 Å²	62.3	76%	0.759	35%	0.348	S	S	*	.	T	Hydrogen-bonded Turn	trans	-79.4	-9.5	-180	-63.7	-28.7	0	0	0	111.7	D24 F28	D24-D26 WeakPolarHBondContact OD1-CA 3.36Å; D24-D26 PolarHBondContact OD1-N 3.18Å; D26-F28 VanDerWaalsContact C-N 3.26Å; D26-F28 PolarHBondContact O-N 2.89Å
27	F	94.2	Very high	96.5	Very high	15 Å²	15	62.6 Å²	62.6	7%	0.066	34%	0.339	C	S	.	.	T	Hydrogen-bonded Turn	trans	-57	-37.4	170.2	179.6	-104.8	0	0	0	112.9	L11 T22 D24 K25 R54 L56 L70 V73	L11-F27 HydrophobicContact CD1-CD2 4.25Å; L11-F27 HydrophobicContact CD1-CE2 3.49Å; L11-F27 VanDerWaalsContact CD1-CE2 3.49Å; L11-F27 HydrophobicContact CD1-CZ 3.98Å; T22-F27 HydrophobicContact CG2-CB 4.03Å; T22-F27 HydrophobicContact CG2-CD1 3.69Å; T22-F27 HydrophobicContact CG2-CE1 4.35Å; T22-F27 HydrophobicContact CG2-CG 3.94Å; D24-F27 HydrophobicContact CB-CB 4.07Å; D24-F27 WeakPolarHBondContact O-CB 3.49Å; D24-F27 PolarHBondContact OD1-N 3.34Å; K25-F27 PolarHBondContact O-N 2.64Å; F27-R54 HydrophobicContact CD1-CB 3.96Å; F27-R54 HydrophobicContact CD1-CG 4.24Å; F27-R54 HydrophobicContact CD2-CG 4.28Å; F27-R54 HydrophobicContact CE1-CB 3.39Å; F27-R54 HydrophobicContact CE1-CG 3.79Å; F27-R54 HydrophobicContact CE2-CB 4.33Å; F27-R54 HydrophobicContact CE2-CG 3.78Å; F27-R54 HydrophobicContact CG-CG 4.49Å; F27-R54 HydrophobicContact CZ-CB 3.63Å; F27-R54 HydrophobicContact CZ-CG 3.56Å; F27-R54 WeakPolarHBondContact O-CD 3.14Å; F27-R54 WeakPolarHBondContact O-CG 3.37Å; F27-R54 VanDerWaalsContact O-CZ 3.32Å; F27-R54 PolarHBondContact O-NE 2.88Å; F27-R54 PolarHBondContact O-NH1 3.13Å; F27-L56 HydrophobicContact CE2-CD2 4.1Å; F27-L56 HydrophobicContact CZ-CD2 4.28Å; F27-L70 HydrophobicContact CE1-CD1 4.46Å; F27-L70 HydrophobicContact CZ-CD1 3.85Å; F27-V73 HydrophobicContact CE1-CG1 4.37Å
28	F	96.7	Very high	96.5	Very high	20 Å²	20	62.9 Å²	62.9	9%	0.088	34%	0.339	C	S	.	.			trans	-81.1	138.7	-166.1	-65.6	-88.1	0	0	0	113	T22 D24 D26 L31 V73 Y75	T22-F28 HydrophobicContact CG2-CE2 3.66Å; T22-F28 HydrophobicContact CG2-CZ 3.73Å; D24-F28 WeakPolarHBondContact O-CD2 3.28Å; D24-F28 VanDerWaalsContact O-CE2 3.25Å; D24-F28 WeakPolarHBondContact O-CE2 3.41Å; D26-F28 VanDerWaalsContact C-N 3.26Å; D26-F28 PolarHBondContact O-N 2.89Å; F28-L31 HydrophobicContact CB-CB 4.03Å; F28-L31 HydrophobicContact CD1-CD1 4.06Å; F28-L31 HydrophobicContact CD2-CD1 4.19Å; F28-L31 HydrophobicContact CD2-CD2 4.3Å; F28-L31 HydrophobicContact CE1-CD1 4.09Å; F28-L31 HydrophobicContact CE2-CD1 4.27Å; F28-L31 HydrophobicContact CG-CB 4.23Å; F28-L31 HydrophobicContact CG-CD1 4.09Å; F28-L31 HydrophobicContact CZ-CD1 4.21Å; F28-V73 HydrophobicContact CE1-CB 3.78Å; F28-V73 HydrophobicContact CE1-CG1 3.87Å; F28-V73 VanDerWaalsContact CE1-O 3.23Å; F28-V73 WeakPolarHBondContact CE1-O 3.29Å; F28-V73 HydrophobicContact CZ-CB 4.43Å; F28-V73 HydrophobicContact CZ-CG1 4.05Å; F28-Y75 AromaticContact CE2-CD2 4Å; F28-Y75 HydrophobicContact CE2-CD2 4Å; F28-Y75 HydrophobicContact CE2-CG 4.24Å
29	T	96.3	Very high	96.4	Very high	88 Å²	88	66.6 Å²	66.6	54%	0.54	34%	0.343	S	S	.	.	S	Bend	trans	-78.3	-36.3	166.7	-56.6	0	0	0	0	110.8	E53	T29-E53 PolarHBondContact N-O 3.23Å
30	S	97.7	Very high	96	Very high	53 Å²	53	67.8 Å²	67.8	37%	0.371	35%	0.347	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.5	142.7	170.7	75.2	0	0	0	0	109.1	G52 E53	S30-G52 CarbonylContact O-C 3.47Å; S30-G52 WeakPolarHBondContact O-CA 3.34Å; S30-E53 PolarHBondContact O-N 3.44Å; S30-E53 WeakPolarHBondContact OG-CG 3.37Å; S30-E53 PolarHBondContact OG-OE1 3.08Å
31	L	98.5	Very high	95.5	Very high	56 Å²	56	72.7 Å²	72.7	29%	0.293	39%	0.39	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-143.3	119	-179.1	-179.1	67.1	0	0	0	108.8	K25 F28 Y75	K25-L31 HydrophobicContact CG-CD2 3.83Å; F28-L31 HydrophobicContact CB-CB 4.03Å; F28-L31 HydrophobicContact CD1-CD1 4.06Å; F28-L31 HydrophobicContact CD2-CD1 4.19Å; F28-L31 HydrophobicContact CD2-CD2 4.3Å; F28-L31 HydrophobicContact CE1-CD1 4.09Å; F28-L31 HydrophobicContact CE2-CD1 4.27Å; F28-L31 HydrophobicContact CG-CB 4.23Å; F28-L31 HydrophobicContact CG-CD1 4.09Å; F28-L31 HydrophobicContact CZ-CD1 4.21Å; L31-Y75 HydrophobicContact CD2-CD1 4.35Å; L31-Y75 HydrophobicContact CD2-CG 4.36Å
32	R	98.5	Very high	94.9	Very high	117 Å²	117	76.7 Å²	76.7	44%	0.442	41%	0.411	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.3	140.2	173.5	67.9	-175.8	-174.3	-89	0.6	110.3	M34 G50 I51 E72	R32-M34 PolarHBondContact O-N 3.42Å; R32-G50 CarbonylContact O-C 3.51Å; R32-G50 WeakPolarHBondContact O-CA 3.48Å; R32-I51 HydrophobicContact CG-CG2 3.59Å; R32-I51 WeakPolarHBondContact CG-O 3.16Å; R32-I51 PolarHBondContact N-O 2.83Å; R32-I51 PolarHBondContact O-N 3.12Å; R32-E72 IonicContact CZ-OE1 3.96Å; R32-E72 VanDerWaalsContact CZ-OE1 3.31Å; R32-E72 IonicContact CZ-OE2 3.42Å; R32-E72 IonicContact NH1-OE1 3.12Å; R32-E72 PolarHBondContact NH1-OE1 2.83Å; R32-E72 VanDerWaalsContact NH2-CD 3.28Å; R32-E72 IonicContact NH2-OE1 2.88Å; R32-E72 PolarHBondContact NH2-OE1 3.16Å; R32-E72 IonicContact NH2-OE2 2.82Å; R32-E72 PolarHBondContact NH2-OE2 2.86Å
33	P	98.5	Very high	94	Very high	125 Å²	125	81.4 Å²	81.4	81%	0.812	44%	0.444	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-60.6	127.3	175.2	-22.3	33.2	0	0	0	111.2
34	M	98.1	Very high	93.5	Very high	86 Å²	86	84.8 Å²	84.8	42%	0.424	46%	0.46	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-162.7	123.1	178.4	-176.9	168.7	171.3	0	0	109.7	R32 S48 E49 G50 I51	R32-M34 PolarHBondContact O-N 3.42Å; M34-S48 PolarHBondContact O-OG 3.42Å; M34-E49 PolarHBondContact N-O 3.35Å; M34-E49 VanDerWaalsContact N-O 3.1Å; M34-E49 CarbonylContact O-C 3.11Å; M34-G50 WeakPolarHBondContact O-CA 3.23Å; M34-G50 PolarHBondContact O-N 3.32Å; M34-G50 VanDerWaalsContact O-N 3.13Å; M34-I51 HydrophobicContact CB-CB 4.36Å; M34-I51 HydrophobicContact CB-CG2 3.74Å; M34-I51 HydrophobicContact CG-CG2 4.26Å; M34-I51 HydrophobicContact SD-CB 4.36Å; M34-I51 HydrophobicContact SD-CD1 4.47Å; M34-I51 HydrophobicContact SD-CG2 3.62Å
35	K	97.9	Very high	93.3	Very high	180 Å²	180	87.9 Å²	87.9	78%	0.783	48%	0.482	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-92.6	130.4	175.8	-65.5	-171.8	177.6	-173.3	0	110.8	S48	K35-S48 WeakPolarHBondContact CA-O 3.44Å
36	A	96.4	Very high	93.2	Very high	40 Å²	40	82.1 Å²	82.1	33%	0.331	46%	0.458	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-148	149	170.9	0	0	0	0	0	109.7	S48	A36-S48 WeakPolarHBondContact CB-OG 3.19Å; A36-S48 PolarHBondContact N-OG 3.25Å; A36-S48 PolarHBondContact O-N 3.12Å; A36-S48 PolarHBondContact O-OG 3Å
37	T	96.1	Very high	93.4	Very high	66 Å²	66	79.8 Å²	79.8	41%	0.405	44%	0.442	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-80	128.6	171.6	-57.4	0	0	0	0	109.3	Y39 P45 A46 Q47	T37-Y39 HydrophobicContact CG2-CD2 4.39Å; T37-Y39 HydrophobicContact CG2-CE1 4.25Å; T37-Y39 HydrophobicContact CG2-CE2 3.88Å; T37-P45 HydrophobicContact CG2-CB 3.71Å; T37-A46 WeakPolarHBondContact CA-O 3.25Å; T37-Q47 PolarHBondContact OG1-NE2 2.74Å
38	V	94.8	Very high	93.5	Very high	17 Å²	17	79.2 Å²	79.2	10%	0.103	44%	0.44	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.2	133.3	171.4	-180	0	0	0	0	108	M21 L40 P45 A46 V76	M21-V38 HydrophobicContact CE-CG1 3.7Å; M21-V38 HydrophobicContact SD-CG1 3.79Å; V38-L40 HydrophobicContact CG1-CD2 4.42Å; V38-P45 WeakPolarHBondContact O-CA 3Å; V38-A46 PolarHBondContact N-O 3.5Å; V38-A46 PolarHBondContact O-N 3.22Å; V38-V76 HydrophobicContact CB-CG2 4.49Å; V38-V76 HydrophobicContact CG2-CG2 3.9Å
39	Y	93	Very high	93.6	Very high	177 Å²	177	83.6 Å²	83.6	69%	0.694	46%	0.461	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-99.7	120.9	178	-66.6	-86.6	0	0	0	109.6	T37 P45	T37-Y39 HydrophobicContact CG2-CD2 4.39Å; T37-Y39 HydrophobicContact CG2-CE1 4.25Å; T37-Y39 HydrophobicContact CG2-CE2 3.88Å; Y39-P45 HydrophobicContact CE1-CB 4.41Å
40	L	88.4	Confident	93.7	Very high	48 Å²	48	79.4 Å²	79.4	25%	0.251	44%	0.436	S	S	.	.			trans	-87.3	165.3	174.3	-57.3	-178.3	0	0	0	110.5	V38 D42 S43 N44 A46 L79	V38-L40 HydrophobicContact CG1-CD2 4.42Å; L40-D42 WeakPolarHBondContact CB-OD1 3.42Å; L40-D42 PolarHBondContact O-N 3.22Å; L40-D42 VanDerWaalsContact O-N 3.17Å; L40-S43 PolarHBondContact O-N 2.95Å; L40-N44 PolarHBondContact N-O 3.49Å; L40-A46 HydrophobicContact CD1-CB 4.27Å; L40-A46 HydrophobicContact CG-CB 4.36Å; L40-L79 HydrophobicContact CD1-CD1 4.42Å; L40-L79 HydrophobicContact CD2-CD1 4.12Å
41	A	86.3	Confident	93.8	Very high	113 Å²	113	77.7 Å²	77.7	93%	0.934	42%	0.422	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.4	-25.2	-174.3	0	0	0	0	0	113.8	S43	A41-S43 PolarHBondContact O-N 3.06Å
42	D	83.5	Confident	93.8	Very high	98 Å²	98	75.2 Å²	75.2	52%	0.524	41%	0.41	S	S	.	.	T	Hydrogen-bonded Turn	trans	-82.5	10.9	177.1	66.2	-8.1	0	0	0	113.5	L40 N44	L40-D42 WeakPolarHBondContact CB-OD1 3.42Å; L40-D42 PolarHBondContact O-N 3.22Å; L40-D42 VanDerWaalsContact O-N 3.17Å; D42-N44 PolarHBondContact O-N 3.37Å; D42-N44 WeakPolarHBondContact OD1-CB 3.45Å; D42-N44 PolarHBondContact OD1-N 2.87Å; D42-N44 PolarHBondContact OD2-ND2 2.81Å
43	S	78.8	Confident	93.8	Very high	100 Å²	100	72.4 Å²	72.4	70%	0.699	40%	0.402	S	S	*	.	S	Bend	trans	63.9	7	-174.6	-52.8	0	0	0	0	115	L40 A41 P45	L40-S43 PolarHBondContact O-N 2.95Å; A41-S43 PolarHBondContact O-N 3.06Å; S43-P45 WeakPolarHBondContact O-CD 3.29Å
44	N	84.2	Confident	93.6	Very high	94 Å²	94	69.9 Å²	69.9	50%	0.503	38%	0.376	S	S	.	.	P	Polyproline II helix	trans	-79.6	125.2	174.4	-70	-43.8	0	0	0	109.9	L40 D42 A46	L40-N44 PolarHBondContact N-O 3.49Å; D42-N44 PolarHBondContact O-N 3.37Å; D42-N44 WeakPolarHBondContact OD1-CB 3.45Å; D42-N44 PolarHBondContact OD1-N 2.87Å; D42-N44 PolarHBondContact OD2-ND2 2.81Å; N44-A46 PolarHBondContact O-N 2.86Å
45	P	91.9	Very high	93.4	Very high	84 Å²	84	70.3 Å²	70.3	55%	0.545	37%	0.373	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.2	128.1	174.2	29.7	-32.3	0	0	0	110	T37 V38 Y39 S43	T37-P45 HydrophobicContact CG2-CB 3.71Å; V38-P45 WeakPolarHBondContact O-CA 3Å; Y39-P45 HydrophobicContact CE1-CB 4.41Å; S43-P45 WeakPolarHBondContact O-CD 3.29Å
46	A	94	Very high	93.1	Very high	6 Å²	6	63.4 Å²	63.4	5%	0.05	35%	0.345	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.2	161.6	164.8	0	0	0	0	0	110	T37 V38 L40 N44 V76	T37-A46 WeakPolarHBondContact CA-O 3.25Å; V38-A46 PolarHBondContact N-O 3.5Å; V38-A46 PolarHBondContact O-N 3.22Å; L40-A46 HydrophobicContact CD1-CB 4.27Å; L40-A46 HydrophobicContact CG-CB 4.36Å; N44-A46 PolarHBondContact O-N 2.86Å; A46-V76 HydrophobicContact CB-CG1 3.72Å
47	Q	97.3	Very high	92.8	Very high	92 Å²	92	67.9 Å²	67.9	43%	0.43	36%	0.357	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.8	127.5	176.1	-67.6	-63.2	-54.4	0	0	109.6	T37	T37-Q47 PolarHBondContact OG1-NE2 2.74Å
48	S	97.6	Very high	92.4	Very high	4 Å²	4	67 Å²	67	3%	0.028	35%	0.353	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-76.9	146.1	162.5	77.8	0	0	0	0	109.7	M34 K35 A36 Y75	M34-S48 PolarHBondContact O-OG 3.42Å; K35-S48 WeakPolarHBondContact CA-O 3.44Å; A36-S48 WeakPolarHBondContact CB-OG 3.19Å; A36-S48 PolarHBondContact N-OG 3.25Å; A36-S48 PolarHBondContact O-N 3.12Å; A36-S48 PolarHBondContact O-OG 3Å; S48-Y75 CarbonylContact C-O 3.55Å; S48-Y75 WeakPolarHBondContact CA-O 3.41Å; S48-Y75 WeakPolarHBondContact CB-O 3.39Å
49	E	98.5	Very high	92	Very high	111 Å²	111	72.6 Å²	72.6	52%	0.519	38%	0.381	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.2	-13.8	175.1	-66.1	-173	-178.1	0	0	112.8	M34 Y75 P77	M34-E49 PolarHBondContact N-O 3.35Å; M34-E49 VanDerWaalsContact N-O 3.1Å; M34-E49 CarbonylContact O-C 3.11Å; E49-Y75 HydrophobicContact CB-CD1 3.92Å; E49-Y75 HydrophobicContact CB-CE1 4.13Å; E49-Y75 PolarHBondContact N-O 3.13Å; E49-P77 HydrophobicContact CB-CG 4.33Å; E49-P77 VanDerWaalsContact CD-CG 3.41Å; E49-P77 HydrophobicContact CG-CG 3.77Å
50	G	98.6	Very high	91.6	Very high	1 Å²	1	65.8 Å²	65.8	1%	0.01	36%	0.358	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-155.3	170.2	176.7	0	0	0	0	0	111.9	R32 M34 P74 Y75	R32-G50 CarbonylContact O-C 3.51Å; R32-G50 WeakPolarHBondContact O-CA 3.48Å; M34-G50 WeakPolarHBondContact O-CA 3.23Å; M34-G50 PolarHBondContact O-N 3.32Å; M34-G50 VanDerWaalsContact O-N 3.13Å; G50-P74 WeakPolarHBondContact O-CA 3.41Å; G50-Y75 PolarHBondContact O-N 3.45Å
51	I	98.6	Very high	91.3	Very high	17 Å²	17	69.9 Å²	69.9	9%	0.087	39%	0.388	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.7	137.7	170.6	-170.3	159.3	0	0	0	108.3	R32 M34 E72 V73	R32-I51 HydrophobicContact CG-CG2 3.59Å; R32-I51 WeakPolarHBondContact CG-O 3.16Å; R32-I51 PolarHBondContact N-O 2.83Å; R32-I51 PolarHBondContact O-N 3.12Å; M34-I51 HydrophobicContact CB-CB 4.36Å; M34-I51 HydrophobicContact CB-CG2 3.74Å; M34-I51 HydrophobicContact CG-CG2 4.26Å; M34-I51 HydrophobicContact SD-CB 4.36Å; M34-I51 HydrophobicContact SD-CD1 4.47Å; M34-I51 HydrophobicContact SD-CG2 3.62Å; I51-E72 HydrophobicContact CD1-CB 3.94Å; I51-E72 HydrophobicContact CD1-CG 4.47Å; I51-E72 WeakPolarHBondContact CD1-OE2 3.45Å; I51-E72 HydrophobicContact CG1-CB 4.31Å; I51-V73 WeakPolarHBondContact CA-O 3.27Å
52	G	98.3	Very high	91.4	Very high	3 Å²	3	70 Å²	70	3%	0.031	38%	0.377	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-154.9	-169.2	-170.6	0	0	0	0	0	112.5	S30 E72 V73	S30-G52 CarbonylContact O-C 3.47Å; S30-G52 WeakPolarHBondContact O-CA 3.34Å; G52-E72 PolarHBondContact O-N 3.2Å; G52-V73 PolarHBondContact N-O 2.84Å; G52-V73 PolarHBondContact O-N 3.33Å
53	E	97.9	Very high	91.7	Very high	59 Å²	59	67.9 Å²	67.9	28%	0.276	38%	0.378	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-135.1	160.6	179.8	78.3	-165	150.3	0	0	112	T29 S30 H69 L70	T29-E53 PolarHBondContact N-O 3.23Å; S30-E53 PolarHBondContact O-N 3.44Å; S30-E53 WeakPolarHBondContact OG-CG 3.37Å; S30-E53 PolarHBondContact OG-OE1 3.08Å; E53-H69 IonicContact OE2-CE1 2.84Å; E53-H69 PolarHBondContact OE2-CE1 2.78Å; E53-H69 IonicContact OE2-NE2 3.31Å; E53-H69 PolarHBondContact OE2-NE2 3.3Å; E53-L70 CarbonylContact C-O 3.59Å; E53-L70 WeakPolarHBondContact CA-O 3.47Å; E53-L70 WeakPolarHBondContact CB-O 3.03Å
54	R	95.5	Very high	92.3	Very high	72 Å²	72	67 Å²	67	27%	0.272	37%	0.369	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-149	138.4	172.2	179.3	51.9	168.6	-140.7	4.4	111.4	F27 L56 L70	F27-R54 HydrophobicContact CD1-CB 3.96Å; F27-R54 HydrophobicContact CD1-CG 4.24Å; F27-R54 HydrophobicContact CD2-CG 4.28Å; F27-R54 HydrophobicContact CE1-CB 3.39Å; F27-R54 HydrophobicContact CE1-CG 3.79Å; F27-R54 HydrophobicContact CE2-CB 4.33Å; F27-R54 HydrophobicContact CE2-CG 3.78Å; F27-R54 HydrophobicContact CG-CG 4.49Å; F27-R54 HydrophobicContact CZ-CB 3.63Å; F27-R54 HydrophobicContact CZ-CG 3.56Å; F27-R54 WeakPolarHBondContact O-CD 3.14Å; F27-R54 WeakPolarHBondContact O-CG 3.37Å; F27-R54 VanDerWaalsContact O-CZ 3.32Å; F27-R54 PolarHBondContact O-NE 2.88Å; F27-R54 PolarHBondContact O-NH1 3.13Å; R54-L56 HydrophobicContact CG-CD2 4.07Å; R54-L70 PolarHBondContact N-O 2.9Å; R54-L70 WeakPolarHBondContact O-CB 3.49Å; R54-L70 PolarHBondContact O-N 3.23Å
55	W	94.2	Very high	92.6	Very high	94 Å²	94	68 Å²	68	36%	0.356	37%	0.373	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.6	123.6	161.8	-69.1	90.1	0	0	0	110.7	F57 M67 I68 H69	W55-F57 HydrophobicContact CB-CE2 3.82Å; W55-F57 HydrophobicContact CB-CZ 3.91Å; W55-M67 HydrophobicContact CE3-CB 3.94Å; W55-M67 HydrophobicContact CZ3-CB 4.03Å; W55-I68 CarbonylContact C-O 3.47Å; W55-I68 WeakPolarHBondContact CA-O 3.48Å; W55-H69 HydrophobicContact CD2-CB 4.1Å; W55-H69 AromaticContact CE2-CD2 3.68Å; W55-H69 AromaticContact CE2-CG 3.7Å; W55-H69 HydrophobicContact CE3-CB 3.82Å; W55-H69 HydrophobicContact CH2-CB 3.59Å; W55-H69 AromaticContact CH2-CG 3.83Å; W55-H69 HydrophobicContact CZ2-CB 3.84Å; W55-H69 AromaticContact CZ2-CD2 3.95Å; W55-H69 AromaticContact CZ2-CG 3.54Å; W55-H69 AromaticContact CZ2-ND1 3.62Å; W55-H69 HydrophobicContact CZ3-CB 3.58Å; W55-H69 AromaticContact NE1-CD2 3.74Å; W55-H69 AromaticContact NE1-NE2 3.94Å
56	L	91.6	Very high	92.5	Very high	36 Å²	36	66.9 Å²	66.9	19%	0.188	36%	0.359	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.8	133.8	165.5	-56.8	-175.5	0	0	0	109.3	F27 R54 M67 I68 L70 L84	F27-L56 HydrophobicContact CE2-CD2 4.1Å; F27-L56 HydrophobicContact CZ-CD2 4.28Å; R54-L56 HydrophobicContact CG-CD2 4.07Å; L56-M67 CarbonylContact O-C 3.59Å; L56-M67 WeakPolarHBondContact O-CA 3.16Å; L56-I68 HydrophobicContact CB-CB 4.29Å; L56-I68 PolarHBondContact N-O 3.24Å; L56-I68 PolarHBondContact O-N 2.89Å; L56-L70 HydrophobicContact CD1-CD1 3.71Å; L56-L70 HydrophobicContact CD1-CG 4.31Å; L56-L70 HydrophobicContact CD2-CD1 4.24Å; L56-L70 HydrophobicContact CG-CD1 3.78Å; L56-L70 HydrophobicContact CG-CG 4.22Å; L56-L84 HydrophobicContact CD1-CD1 4.2Å
57	F	90.6	Very high	92.4	Very high	133 Å²	133	72 Å²	72	58%	0.583	38%	0.384	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-109.2	99.7	176.4	-60.1	-90.7	0	0	0	108.2	W55 I65 M67	W55-F57 HydrophobicContact CB-CE2 3.82Å; W55-F57 HydrophobicContact CB-CZ 3.91Å; F57-I65 HydrophobicContact CB-CG2 3.9Å; F57-I65 HydrophobicContact CD1-CG2 4.07Å; F57-M67 HydrophobicContact CD1-CG 3.77Å; F57-M67 HydrophobicContact CD1-SD 4.09Å; F57-M67 HydrophobicContact CE1-CG 3.88Å; F57-M67 HydrophobicContact CE1-SD 3.6Å
58	C	87.6	Confident	92.3	Very high	49 Å²	49	68.2 Å²	68.2	33%	0.331	37%	0.366	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.6	120.6	-174.6	-59.8	0	0	0	0	110.2	T60 I65 K66	C58-T60 PolarHBondContact O-N 3.38Å; C58-I65 WeakPolarHBondContact O-CA 3.17Å; C58-K66 PolarHBondContact N-O 3.26Å; C58-K66 PolarHBondContact O-N 3.25Å
59	L	86.1	Confident	92.1	Very high	133 Å²	133	70.6 Å²	70.6	70%	0.696	38%	0.377	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-73.3	120.4	171.5	-173.7	65.2	0	0	0	109.7
60	T	83.8	Confident	92	Very high	34 Å²	34	65.4 Å²	65.4	21%	0.209	35%	0.353	C	S	.	.	P	Polyproline II helix	trans	-80.1	161.4	176.7	70.6	0	0	0	0	110.8	C58 T62 G63 T64 K66	C58-T60 PolarHBondContact O-N 3.38Å; T60-T62 PolarHBondContact O-N 3.39Å; T60-T62 VanDerWaalsContact O-N 3.07Å; T60-T62 PolarHBondContact OG1-N 3.32Å; T60-T62 PolarHBondContact OG1-OG1 2.91Å; T60-G63 PolarHBondContact O-N 3.31Å; T60-T64 WeakPolarHBondContact CG2-O 2.98Å; T60-T64 PolarHBondContact N-O 3.29Å; T60-T64 PolarHBondContact OG1-N 2.94Å; T60-T64 VanDerWaalsContact OG1-N 3.14Å; T60-T64 PolarHBondContact OG1-O 2.96Å; T60-T64 PolarHBondContact OG1-OG1 3.37Å; T60-K66 HydrophobicContact CG2-CB 3.92Å
61	P	82.6	Confident	91.9	Very high	135 Å²	135	71.2 Å²	71.2	88%	0.877	38%	0.38	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58	-21.8	174.4	-26.5	36	0	0	0	114.5	G63	P61-G63 VanDerWaalsContact C-N 3.28Å
62	T	88.4	Confident	91.8	Very high	116 Å²	116	75 Å²	75	71%	0.712	40%	0.397	S	S	*	.	T	Hydrogen-bonded Turn	trans	-85.6	1.3	177.3	58.7	0	0	0	0	113.1	T60 T64	T60-T62 PolarHBondContact O-N 3.39Å; T60-T62 VanDerWaalsContact O-N 3.07Å; T60-T62 PolarHBondContact OG1-N 3.32Å; T60-T62 PolarHBondContact OG1-OG1 2.91Å; T62-T64 VanDerWaalsContact C-N 3.34Å; T62-T64 PolarHBondContact OG1-OG1 3.19Å
63	G	89.9	Confident	91.8	Very high	53 Å²	53	75 Å²	75	55%	0.546	40%	0.396	S	S	.	.	S	Bend	trans	80.9	9.2	-178.4	0	0	0	0	0	114.6	T60 P61	T60-G63 PolarHBondContact O-N 3.31Å; P61-G63 VanDerWaalsContact C-N 3.28Å
64	T	91.7	Very high	91.8	Very high	81 Å²	81	73 Å²	73	50%	0.497	39%	0.389	S	S	.	.	P	Polyproline II helix	trans	-90	153.3	174.6	58.7	0	0	0	0	110.4	T60 T62	T60-T64 WeakPolarHBondContact CG2-O 2.98Å; T60-T64 PolarHBondContact N-O 3.29Å; T60-T64 PolarHBondContact OG1-N 2.94Å; T60-T64 VanDerWaalsContact OG1-N 3.14Å; T60-T64 PolarHBondContact OG1-O 2.96Å; T60-T64 PolarHBondContact OG1-OG1 3.37Å; T62-T64 VanDerWaalsContact C-N 3.34Å; T62-T64 PolarHBondContact OG1-OG1 3.19Å
65	I	90.8	Very high	91.9	Very high	116 Å²	116	71 Å²	71	60%	0.595	38%	0.381	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-93.7	118.1	174	-61.6	174.5	0	0	0	108.3	F57 C58	F57-I65 HydrophobicContact CB-CG2 3.9Å; F57-I65 HydrophobicContact CD1-CG2 4.07Å; C58-I65 WeakPolarHBondContact O-CA 3.17Å
66	K	89	Confident	92	Very high	59 Å²	59	66.6 Å²	66.6	26%	0.257	36%	0.364	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.2	128	166.3	-174.4	177.1	-177.6	-176.6	0	108.8	C58 T60 S106	C58-K66 PolarHBondContact N-O 3.26Å; C58-K66 PolarHBondContact O-N 3.25Å; T60-K66 HydrophobicContact CG2-CB 3.92Å; K66-S106 PolarHBondContact NZ-O 2.89Å; K66-S106 PolarHBondContact NZ-OXT 3.4Å
67	M	92.5	Very high	92.2	Very high	115 Å²	115	67.1 Å²	67.1	57%	0.567	37%	0.37	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-93.9	133.2	174.1	-60.9	-171.6	-64.5	0	0	109.8	W55 L56 F57	W55-M67 HydrophobicContact CE3-CB 3.94Å; W55-M67 HydrophobicContact CZ3-CB 4.03Å; L56-M67 CarbonylContact O-C 3.59Å; L56-M67 WeakPolarHBondContact O-CA 3.16Å; F57-M67 HydrophobicContact CD1-CG 3.77Å; F57-M67 HydrophobicContact CD1-SD 4.09Å; F57-M67 HydrophobicContact CE1-CG 3.88Å; F57-M67 HydrophobicContact CE1-SD 3.6Å
68	I	93.6	Very high	92.3	Very high	11 Å²	11	64.7 Å²	64.7	6%	0.056	37%	0.37	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.5	122.6	173.8	-56.1	175.1	0	0	0	107.5	W55 L56 L70 L89 I105	W55-I68 CarbonylContact C-O 3.47Å; W55-I68 WeakPolarHBondContact CA-O 3.48Å; L56-I68 HydrophobicContact CB-CB 4.29Å; L56-I68 PolarHBondContact N-O 3.24Å; L56-I68 PolarHBondContact O-N 2.89Å; I68-L70 HydrophobicContact CG2-CD2 3.88Å; I68-L89 HydrophobicContact CG2-CD2 4.25Å; I68-I105 HydrophobicContact CD1-CG2 3.9Å
69	H	95.2	Very high	92.5	Very high	54 Å²	54	63.1 Å²	63.1	25%	0.25	36%	0.358	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.8	123.1	174.9	-167.1	-165.5	0	0	0	109.4	E53 W55 E71	E53-H69 IonicContact OE2-CE1 2.84Å; E53-H69 PolarHBondContact OE2-CE1 2.78Å; E53-H69 IonicContact OE2-NE2 3.31Å; E53-H69 PolarHBondContact OE2-NE2 3.3Å; W55-H69 HydrophobicContact CD2-CB 4.1Å; W55-H69 AromaticContact CE2-CD2 3.68Å; W55-H69 AromaticContact CE2-CG 3.7Å; W55-H69 HydrophobicContact CE3-CB 3.82Å; W55-H69 HydrophobicContact CH2-CB 3.59Å; W55-H69 AromaticContact CH2-CG 3.83Å; W55-H69 HydrophobicContact CZ2-CB 3.84Å; W55-H69 AromaticContact CZ2-CD2 3.95Å; W55-H69 AromaticContact CZ2-CG 3.54Å; W55-H69 AromaticContact CZ2-ND1 3.62Å; W55-H69 HydrophobicContact CZ3-CB 3.58Å; W55-H69 AromaticContact NE1-CD2 3.74Å; W55-H69 AromaticContact NE1-NE2 3.94Å; H69-E71 WeakPolarHBondContact CE1-CG 3.28Å; H69-E71 IonicContact CE1-OE1 2.86Å; H69-E71 PolarHBondContact CE1-OE1 2.82Å; H69-E71 IonicContact ND1-OE1 3.5Å; H69-E71 PolarHBondContact ND1-OE1 3.01Å
70	L	96.3	Very high	92.6	Very high	2 Å²	2	65.5 Å²	65.5	1%	0.01	37%	0.366	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.9	106.8	172.6	-51.7	179.3	0	0	0	107.5	F27 E53 R54 L56 I68 V73 L84 L89	F27-L70 HydrophobicContact CE1-CD1 4.46Å; F27-L70 HydrophobicContact CZ-CD1 3.85Å; E53-L70 CarbonylContact C-O 3.59Å; E53-L70 WeakPolarHBondContact CA-O 3.47Å; E53-L70 WeakPolarHBondContact CB-O 3.03Å; R54-L70 PolarHBondContact N-O 2.9Å; R54-L70 WeakPolarHBondContact O-CB 3.49Å; R54-L70 PolarHBondContact O-N 3.23Å; L56-L70 HydrophobicContact CD1-CD1 3.71Å; L56-L70 HydrophobicContact CD1-CG 4.31Å; L56-L70 HydrophobicContact CD2-CD1 4.24Å; L56-L70 HydrophobicContact CG-CD1 3.78Å; L56-L70 HydrophobicContact CG-CG 4.22Å; I68-L70 HydrophobicContact CG2-CD2 3.88Å; L70-V73 HydrophobicContact CB-CG2 3.72Å; L70-L84 HydrophobicContact CD1-CD2 3.51Å; L70-L84 HydrophobicContact CD2-CD2 4.38Å; L70-L89 HydrophobicContact CD2-CD2 4.08Å
71	E	95.5	Very high	93	Very high	124 Å²	124	64.3 Å²	64.3	58%	0.579	36%	0.36	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-96.2	156.6	178.2	-65.4	-177.8	145.7	0	0	111.2	H69 V73	H69-E71 WeakPolarHBondContact CE1-CG 3.28Å; H69-E71 IonicContact CE1-OE1 2.86Å; H69-E71 PolarHBondContact CE1-OE1 2.82Å; H69-E71 IonicContact ND1-OE1 3.5Å; H69-E71 PolarHBondContact ND1-OE1 3.01Å; E71-V73 PolarHBondContact O-N 2.82Å; E71-V73 VanDerWaalsContact O-N 3.16Å
72	E	96.6	Very high	93.6	Very high	97 Å²	97	57.9 Å²	57.9	45%	0.453	32%	0.318	S	S	.	.	E	Extended strand (participates in β ladder)	trans	52.7	39.6	171.3	-64.2	-66.8	113.1	0	0	113.6	R32 I51 G52 P74	R32-E72 IonicContact CZ-OE1 3.96Å; R32-E72 VanDerWaalsContact CZ-OE1 3.31Å; R32-E72 IonicContact CZ-OE2 3.42Å; R32-E72 IonicContact NH1-OE1 3.12Å; R32-E72 PolarHBondContact NH1-OE1 2.83Å; R32-E72 VanDerWaalsContact NH2-CD 3.28Å; R32-E72 IonicContact NH2-OE1 2.88Å; R32-E72 PolarHBondContact NH2-OE1 3.16Å; R32-E72 IonicContact NH2-OE2 2.82Å; R32-E72 PolarHBondContact NH2-OE2 2.86Å; I51-E72 HydrophobicContact CD1-CB 3.94Å; I51-E72 HydrophobicContact CD1-CG 4.47Å; I51-E72 WeakPolarHBondContact CD1-OE2 3.45Å; I51-E72 HydrophobicContact CG1-CB 4.31Å; G52-E72 PolarHBondContact O-N 3.2Å; E72-P74 WeakPolarHBondContact O-CD 3.4Å
73	V	97.7	Very high	93.9	Very high	2 Å²	2	54.9 Å²	54.9	1%	0.012	30%	0.295	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.3	117.5	179.7	-176.6	0	0	0	0	109.1	H20 F27 F28 I51 G52 L70 E71	H20-V73 HydrophobicContact CB-CB 4.29Å; H20-V73 HydrophobicContact CB-CG1 3.9Å; H20-V73 HydrophobicContact CB-CG2 3.8Å; F27-V73 HydrophobicContact CE1-CG1 4.37Å; F28-V73 HydrophobicContact CE1-CB 3.78Å; F28-V73 HydrophobicContact CE1-CG1 3.87Å; F28-V73 VanDerWaalsContact CE1-O 3.23Å; F28-V73 WeakPolarHBondContact CE1-O 3.29Å; F28-V73 HydrophobicContact CZ-CB 4.43Å; F28-V73 HydrophobicContact CZ-CG1 4.05Å; I51-V73 WeakPolarHBondContact CA-O 3.27Å; G52-V73 PolarHBondContact N-O 2.84Å; G52-V73 PolarHBondContact O-N 3.33Å; L70-V73 HydrophobicContact CB-CG2 3.72Å; E71-V73 PolarHBondContact O-N 2.82Å; E71-V73 VanDerWaalsContact O-N 3.16Å
74	P	98.3	Very high	94.2	Very high	18 Å²	18	53 Å²	53	12%	0.117	27%	0.273	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.7	136	175.3	-19	36	0	0	0	111.5	H20 M21 T22 G50 E72 V76	H20-P74 WeakPolarHBondContact O-CD 3.25Å; M21-P74 WeakPolarHBondContact CA-O 3.41Å; T22-P74 PolarHBondContact N-O 2.61Å; G50-P74 WeakPolarHBondContact O-CA 3.41Å; E72-P74 WeakPolarHBondContact O-CD 3.4Å; P74-V76 HydrophobicContact CB-CG2 4.19Å
75	Y	98.1	Very high	94.4	Very high	30 Å²	30	49.1 Å²	49.1	12%	0.118	25%	0.249	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-87.2	113.5	168	169.8	-119.3	0	0	0	109.1	T22 S23 K25 F28 L31 S48 E49 G50 P77	T22-Y75 CarbonylContact O-C 3.58Å; T22-Y75 WeakPolarHBondContact O-CA 3.5Å; S23-Y75 VanDerWaalsContact O-CE2 3.28Å; S23-Y75 WeakPolarHBondContact O-CE2 3.12Å; K25-Y75 HydrophobicContact CB-CD2 4.36Å; K25-Y75 HydrophobicContact CB-CE2 3.72Å; K25-Y75 HydrophobicContact CD-CE1 4.41Å; K25-Y75 HydrophobicContact CG-CE1 4.49Å; K25-Y75 HydrophobicContact CG-CE2 4.26Å; F28-Y75 AromaticContact CE2-CD2 4Å; F28-Y75 HydrophobicContact CE2-CD2 4Å; F28-Y75 HydrophobicContact CE2-CG 4.24Å; L31-Y75 HydrophobicContact CD2-CD1 4.35Å; L31-Y75 HydrophobicContact CD2-CG 4.36Å; S48-Y75 CarbonylContact C-O 3.55Å; S48-Y75 WeakPolarHBondContact CA-O 3.41Å; S48-Y75 WeakPolarHBondContact CB-O 3.39Å; E49-Y75 HydrophobicContact CB-CD1 3.92Å; E49-Y75 HydrophobicContact CB-CE1 4.13Å; E49-Y75 PolarHBondContact N-O 3.13Å; G50-Y75 PolarHBondContact O-N 3.45Å; Y75-P77 HydrophobicContact CD1-CG 4.26Å; Y75-P77 HydrophobicContact CE1-CB 4.33Å; Y75-P77 HydrophobicContact CE1-CG 3.59Å; Y75-P77 HydrophobicContact CE2-CG 4.46Å; Y75-P77 WeakPolarHBondContact O-CD 3.39Å
76	V	96.6	Very high	94.7	Very high	0 Å²	0	44.2 Å²	44.2	0%	0	23%	0.225	C	C	.	.			trans	-120.8	87.6	-175	-173.6	0	0	0	0	108.8	M21 T22 S23 V38 A46 P74 S78 L79	M21-V76 HydrophobicContact CB-CG2 4.27Å; T22-V76 PolarHBondContact O-N 3Å; S23-V76 VanDerWaalsContact CA-O 3.27Å; S23-V76 WeakPolarHBondContact CA-O 3.03Å; S23-V76 WeakPolarHBondContact CB-O 3.4Å; V38-V76 HydrophobicContact CB-CG2 4.49Å; V38-V76 HydrophobicContact CG2-CG2 3.9Å; A46-V76 HydrophobicContact CB-CG1 3.72Å; P74-V76 HydrophobicContact CB-CG2 4.19Å; V76-S78 PolarHBondContact O-N 3.46Å; V76-S78 VanDerWaalsContact O-N 3.12Å; V76-L79 HydrophobicContact CB-CB 4.17Å; V76-L79 HydrophobicContact CG1-CB 4.05Å; V76-L79 VanDerWaalsContact O-CB 3.31Å; V76-L79 WeakPolarHBondContact O-CB 3.39Å; V76-L79 PolarHBondContact O-N 2.71Å
77	P	95.8	Very high	95.1	Very high	47 Å²	47	46.6 Å²	46.6	31%	0.305	24%	0.237	S	C	.	.	T	Hydrogen-bonded Turn	trans	-59.6	-28.3	-171.9	-6.9	6.2	0	0	0	114.6	E49 Y75 L79	E49-P77 HydrophobicContact CB-CG 4.33Å; E49-P77 VanDerWaalsContact CD-CG 3.41Å; E49-P77 HydrophobicContact CG-CG 3.77Å; Y75-P77 HydrophobicContact CD1-CG 4.26Å; Y75-P77 HydrophobicContact CE1-CB 4.33Å; Y75-P77 HydrophobicContact CE1-CG 3.59Å; Y75-P77 HydrophobicContact CE2-CG 4.46Å; Y75-P77 WeakPolarHBondContact O-CD 3.39Å; P77-L79 PolarHBondContact O-N 3.29Å
78	S	93.1	Very high	95.4	Very high	83 Å²	83	47 Å²	47	58%	0.58	23%	0.232	S	C	*	.	T	Hydrogen-bonded Turn	trans	-78.5	-3.8	-179.9	64.6	0	0	0	0	113.9	V76	V76-S78 PolarHBondContact O-N 3.46Å; V76-S78 VanDerWaalsContact O-N 3.12Å
79	L	91.3	Very high	95.5	Very high	16 Å²	16	46.6 Å²	46.6	8%	0.084	23%	0.23	C	C	.	.	S	Bend	trans	-80.9	140.9	179.9	-177.3	64.8	0	0	0	110.9	M21 S23 L40 V76 P77 G81 F83	M21-L79 HydrophobicContact CG-CD2 3.78Å; M21-L79 HydrophobicContact SD-CD2 4.06Å; S23-L79 WeakPolarHBondContact CB-O 2.91Å; S23-L79 PolarHBondContact OG-O 2.8Å; L40-L79 HydrophobicContact CD1-CD1 4.42Å; L40-L79 HydrophobicContact CD2-CD1 4.12Å; V76-L79 HydrophobicContact CB-CB 4.17Å; V76-L79 HydrophobicContact CG1-CB 4.05Å; V76-L79 VanDerWaalsContact O-CB 3.31Å; V76-L79 WeakPolarHBondContact O-CB 3.39Å; V76-L79 PolarHBondContact O-N 2.71Å; P77-L79 PolarHBondContact O-N 3.29Å; L79-G81 WeakPolarHBondContact CD2-O 3.32Å; L79-G81 PolarHBondContact O-N 2.85Å; L79-F83 HydrophobicContact CD1-CD2 4.49Å; L79-F83 HydrophobicContact CD1-CE2 3.62Å; L79-F83 HydrophobicContact CD1-CZ 4.28Å; L79-F83 HydrophobicContact CD2-CD2 3.9Å; L79-F83 HydrophobicContact CD2-CE2 3.82Å; L79-F83 HydrophobicContact CG-CE2 4.25Å
80	E	88.7	Confident	95.6	Very high	183 Å²	183	49.3 Å²	49.3	86%	0.855	24%	0.244	S	C	*	.	S	Bend	trans	-82.8	100.8	166.9	-67.8	-174.4	-177.5	0	0	109.5
81	G	91.8	Very high	95.5	Very high	9 Å²	9	53.7 Å²	53.7	9%	0.093	27%	0.274	C	S	.	.	S	Bend	trans	83.2	-140.9	-179.5	0	0	0	0	0	113.8	S23 L79	S23-G81 PolarHBondContact N-O 3.23Å; S23-G81 PolarHBondContact OG-N 2.93Å; S23-G81 PolarHBondContact OG-O 3.04Å; S23-G81 VanDerWaalsContact OG-O 3.13Å; L79-G81 WeakPolarHBondContact CD2-O 3.32Å; L79-G81 PolarHBondContact O-N 2.85Å
82	G	93.6	Very high	95.3	Very high	0 Å²	0	50.6 Å²	50.6	0%	0	28%	0.275	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-159.3	172.9	175.4	0	0	0	0	0	114.1	S10 L11 H12 M21	S10-G82 PolarHBondContact O-N 2.8Å; S10-G82 VanDerWaalsContact O-N 3.08Å; L11-G82 WeakPolarHBondContact CA-O 3.42Å; H12-G82 PolarHBondContact N-O 3.39Å; M21-G82 CarbonylContact O-C 3.58Å; M21-G82 WeakPolarHBondContact O-CA 3.48Å
83	F	95.3	Very high	95.1	Very high	52 Å²	52	49 Å²	49	23%	0.228	28%	0.284	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.5	136.4	-176.5	-55.7	-69.1	0	0	0	111.4	H12 D14 A17 H20 M21 L79	H12-F83 HydrophobicContact CB-CD1 4.06Å; H12-F83 HydrophobicContact CB-CE1 4.4Å; H12-F83 CarbonylContact O-C 3.59Å; H12-F83 VanDerWaalsContact O-CA 3.29Å; H12-F83 WeakPolarHBondContact O-CA 3.37Å; D14-F83 HydrophobicContact CB-CB 4.38Å; D14-F83 HydrophobicContact CB-CD1 4.08Å; A17-F83 HydrophobicContact CB-CB 4.16Å; H20-F83 CarbonylContact C-O 3.53Å; H20-F83 VanDerWaalsContact CA-O 3.25Å; H20-F83 WeakPolarHBondContact CA-O 3.19Å; M21-F83 HydrophobicContact CG-CB 4.33Å; M21-F83 HydrophobicContact CG-CD2 3.83Å; M21-F83 PolarHBondContact N-O 3.17Å; M21-F83 PolarHBondContact O-N 2.82Å; M21-F83 HydrophobicContact SD-CD2 3.97Å; L79-F83 HydrophobicContact CD1-CD2 4.49Å; L79-F83 HydrophobicContact CD1-CE2 3.62Å; L79-F83 HydrophobicContact CD1-CZ 4.28Å; L79-F83 HydrophobicContact CD2-CD2 3.9Å; L79-F83 HydrophobicContact CD2-CE2 3.82Å; L79-F83 HydrophobicContact CG-CE2 4.25Å
84	L	95.8	Very high	94.8	Very high	13 Å²	13	49.2 Å²	49.2	7%	0.068	29%	0.286	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.8	102.9	163.9	-65.1	177.4	0	0	0	108.5	L11 H12 V13 D14 H20 L56 L70 V86 L89	L11-L84 HydrophobicContact CB-CD1 4.49Å; L11-L84 HydrophobicContact CB-CG 4.34Å; L11-L84 HydrophobicContact CD1-CD2 4.35Å; L11-L84 HydrophobicContact CD1-CG 4.41Å; H12-L84 PolarHBondContact O-N 2.87Å; V13-L84 WeakPolarHBondContact CA-O 3.44Å; V13-L84 HydrophobicContact CG2-CB 4.39Å; V13-L84 HydrophobicContact CG2-CD1 4.46Å; D14-L84 PolarHBondContact N-O 2.86Å; H20-L84 WeakPolarHBondContact ND1-CA 3.19Å; L56-L84 HydrophobicContact CD1-CD1 4.2Å; L70-L84 HydrophobicContact CD1-CD2 3.51Å; L70-L84 HydrophobicContact CD2-CD2 4.38Å; L84-V86 PolarHBondContact O-N 3.04Å; L84-L89 HydrophobicContact CB-CD1 4.29Å
85	S	97.2	Very high	94.7	Very high	0 Å²	0	52 Å²	52	0%	0	30%	0.303	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-57.8	121.5	172.4	170.6	0	0	0	0	111.6	D14 A17 S19 H20 Q87 R88 L89	D14-S85 WeakPolarHBondContact O-CA 3.48Å; A17-S85 WeakPolarHBondContact O-CB 3.14Å; A17-S85 PolarHBondContact O-OG 2.85Å; S19-S85 VanDerWaalsContact C-CB 3.42Å; S19-S85 WeakPolarHBondContact O-CB 3.31Å; H20-S85 PolarHBondContact CE1-O 2.88Å; H20-S85 PolarHBondContact ND1-N 3.13Å; H20-S85 VanDerWaalsContact ND1-N 3.17Å; S85-Q87 VanDerWaalsContact C-N 3.26Å; S85-Q87 PolarHBondContact O-N 2.86Å; S85-Q87 PolarHBondContact OG-N 3.01Å; S85-R88 PolarHBondContact O-N 3.1Å; S85-R88 PolarHBondContact OG-N 3.32Å; S85-L89 PolarHBondContact O-N 3.04Å
86	V	97.6	Very high	94.5	Very high	14 Å²	14	51.6 Å²	51.6	9%	0.085	30%	0.303	C	S	.	.	H	α-helix	trans	-58.2	-42.6	173.7	173.1	0	0	0	0	110.7	V13 D14 L84 R88 L89 M90 V96 F98	V13-V86 HydrophobicContact CG1-CG2 3.49Å; V13-V86 VanDerWaalsContact CG1-CG2 3.49Å; D14-V86 PolarHBondContact O-N 2.91Å; L84-V86 PolarHBondContact O-N 3.04Å; V86-R88 VanDerWaalsContact C-N 3.3Å; V86-R88 PolarHBondContact O-N 2.95Å; V86-L89 PolarHBondContact O-N 3.18Å; V86-M90 HydrophobicContact CG1-CG 4.32Å; V86-M90 HydrophobicContact CG1-SD 3.96Å; V86-M90 WeakPolarHBondContact O-CB 3.46Å; V86-M90 WeakPolarHBondContact O-CG 3.47Å; V86-M90 PolarHBondContact O-N 3.04Å; V86-V96 HydrophobicContact CG1-CB 4.04Å; V86-V96 HydrophobicContact CG1-CG1 4.33Å; V86-V96 HydrophobicContact CG1-CG2 4.12Å; V86-V96 HydrophobicContact CG2-CG1 4.31Å; V86-F98 HydrophobicContact CG2-CE2 4.14Å; V86-F98 HydrophobicContact CG2-CZ 3.94Å
87	Q	97.4	Very high	94.4	Very high	109 Å²	109	54.2 Å²	54.2	51%	0.509	32%	0.32	S	S	.	.	H	α-helix	trans	-56.4	-46.7	177.6	-179.3	-177.2	-7.5	0	0	110.8	S85 M90 C91	S85-Q87 VanDerWaalsContact C-N 3.26Å; S85-Q87 PolarHBondContact O-N 2.86Å; S85-Q87 PolarHBondContact OG-N 3.01Å; Q87-M90 PolarHBondContact O-N 3.36Å; Q87-C91 PolarHBondContact O-N 3.39Å; Q87-C91 PolarHBondContact O-SG 2.64Å
88	R	97.5	Very high	94.4	Very high	123 Å²	123	57.7 Å²	57.7	46%	0.464	33%	0.33	S	S	.	.	H	α-helix	trans	-71.2	-37.7	-179.5	-62.7	-59.2	-177.3	161.6	3.7	113.1	T18 H20 S85 V86 M90 C91 G92	T18-R88 PolarHBondContact O-NE 2.81Å; H20-R88 VanDerWaalsContact CE1-CB 3.45Å; H20-R88 WeakPolarHBondContact CE1-CB 3.34Å; H20-R88 WeakPolarHBondContact NE2-CB 3.47Å; S85-R88 PolarHBondContact O-N 3.1Å; S85-R88 PolarHBondContact OG-N 3.32Å; V86-R88 VanDerWaalsContact C-N 3.3Å; V86-R88 PolarHBondContact O-N 2.95Å; R88-M90 VanDerWaalsContact C-N 3.28Å; R88-M90 PolarHBondContact O-N 2.83Å; R88-C91 PolarHBondContact O-N 2.88Å; R88-G92 PolarHBondContact O-N 3.39Å
89	L	96.1	Very high	94.4	Very high	2 Å²	2	60.2 Å²	60.2	1%	0.01	33%	0.33	C	S	.	.	H	α-helix	trans	-56.2	-45.4	169.9	-73.4	174.1	0	0	0	111.1	V13 I68 L70 L84 S85 V86 G92 G93 C94 V96 I105	V13-L89 HydrophobicContact CG1-CD1 4.35Å; I68-L89 HydrophobicContact CG2-CD2 4.25Å; L70-L89 HydrophobicContact CD2-CD2 4.08Å; L84-L89 HydrophobicContact CB-CD1 4.29Å; S85-L89 PolarHBondContact O-N 3.04Å; V86-L89 PolarHBondContact O-N 3.18Å; L89-G92 CarbonylContact O-C 3.6Å; L89-G92 PolarHBondContact O-N 3.12Å; L89-G93 PolarHBondContact O-N 3.32Å; L89-C94 HydrophobicContact CB-CB 4.34Å; L89-C94 VanDerWaalsContact O-CB 3.28Å; L89-C94 WeakPolarHBondContact O-CB 3.32Å; L89-C94 PolarHBondContact O-N 3.48Å; L89-V96 HydrophobicContact CB-CG2 4.02Å; L89-V96 HydrophobicContact CD1-CG2 3.93Å; L89-I105 HydrophobicContact CD1-CD1 3.85Å; L89-I105 HydrophobicContact CD1-CG1 4.37Å
90	M	96.4	Very high	94.4	Very high	111 Å²	111	71.6 Å²	71.6	55%	0.547	37%	0.372	S	S	.	.	H	α-helix	trans	-68.4	-39.3	179.3	-71.1	-176.6	64.3	0	0	112.7	V86 Q87 R88 G92 G93 C94 V96	V86-M90 HydrophobicContact CG1-CG 4.32Å; V86-M90 HydrophobicContact CG1-SD 3.96Å; V86-M90 WeakPolarHBondContact O-CB 3.46Å; V86-M90 WeakPolarHBondContact O-CG 3.47Å; V86-M90 PolarHBondContact O-N 3.04Å; Q87-M90 PolarHBondContact O-N 3.36Å; R88-M90 VanDerWaalsContact C-N 3.28Å; R88-M90 PolarHBondContact O-N 2.83Å; M90-G92 PolarHBondContact O-N 2.75Å; M90-G93 PolarHBondContact O-N 2.99Å; M90-C94 WeakPolarHBondContact CA-O 3.44Å; M90-V96 HydrophobicContact CG-CG2 4.38Å
91	C	95.2	Very high	94.4	Very high	95 Å²	95	69.3 Å²	69.3	64%	0.642	37%	0.371	S	S	*	.	H	α-helix	trans	-60.5	-33.5	171.5	-70.2	0	0	0	0	112.1	Q87 R88 G93	Q87-C91 PolarHBondContact O-N 3.39Å; Q87-C91 PolarHBondContact O-SG 2.64Å; R88-C91 PolarHBondContact O-N 2.88Å; C91-G93 PolarHBondContact O-N 3.17Å
92	G	91.1	Very high	94.2	Very high	59 Å²	59	72.5 Å²	72.5	61%	0.608	39%	0.389	S	S	*	.	T	Hydrogen-bonded Turn	trans	-75.9	9.7	172.6	0	0	0	0	0	114.8	R88 L89 M90	R88-G92 PolarHBondContact O-N 3.39Å; L89-G92 CarbonylContact O-C 3.6Å; L89-G92 PolarHBondContact O-N 3.12Å; M90-G92 PolarHBondContact O-N 2.75Å
93	G	92.1	Very high	94.1	Very high	62 Å²	62	75 Å²	75	64%	0.639	41%	0.405	S	S	*	.	T	Hydrogen-bonded Turn	trans	81.2	10.8	176.9	0	0	0	0	0	115	L89 M90 C91	L89-G93 PolarHBondContact O-N 3.32Å; M90-G93 PolarHBondContact O-N 2.99Å; C91-G93 PolarHBondContact O-N 3.17Å
94	C	92.8	Very high	93.8	Very high	8 Å²	8	76 Å²	76	5%	0.054	41%	0.413	C	S	.	.			trans	-81.5	153	171.4	-60.3	0	0	0	0	111.3	L89 M90 I105 S106	L89-C94 HydrophobicContact CB-CB 4.34Å; L89-C94 VanDerWaalsContact O-CB 3.28Å; L89-C94 WeakPolarHBondContact O-CB 3.32Å; L89-C94 PolarHBondContact O-N 3.48Å; M90-C94 WeakPolarHBondContact CA-O 3.44Å; C94-I105 HydrophobicContact CB-CG2 3.88Å; C94-S106 WeakPolarHBondContact CA-O 3.48Å
95	T	94.3	Very high	93.6	Very high	77 Å²	77	77.8 Å²	77.8	47%	0.472	42%	0.422	S	S	.	.			trans	-103.6	129.7	163.8	-62.8	0	0	0	0	109	I105 S106	T95-I105 CarbonylContact O-C 3.53Å; T95-I105 WeakPolarHBondContact O-CA 3.48Å; T95-S106 PolarHBondContact N-O 3.03Å; T95-S106 PolarHBondContact O-N 3.33Å
96	V	95.1	Very high	93.2	Very high	20 Å²	20	81.4 Å²	81.4	12%	0.121	45%	0.448	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.3	118.3	175.8	-174	0	0	0	0	109	V13 V86 L89 M90 F98 C103 L104 I105	V13-V96 HydrophobicContact CG1-CG1 4.35Å; V86-V96 HydrophobicContact CG1-CB 4.04Å; V86-V96 HydrophobicContact CG1-CG1 4.33Å; V86-V96 HydrophobicContact CG1-CG2 4.12Å; V86-V96 HydrophobicContact CG2-CG1 4.31Å; L89-V96 HydrophobicContact CB-CG2 4.02Å; L89-V96 HydrophobicContact CD1-CG2 3.93Å; M90-V96 HydrophobicContact CG-CG2 4.38Å; V96-F98 HydrophobicContact CG1-CD2 4.24Å; V96-F98 HydrophobicContact CG1-CE2 3.6Å; V96-F98 HydrophobicContact CG1-CZ 3.9Å; V96-C103 VanDerWaalsContact CG1-SG 3.57Å; V96-L104 CarbonylContact C-O 3.6Å; V96-L104 WeakPolarHBondContact CA-O 3.5Å; V96-I105 HydrophobicContact CG2-CG1 4.47Å
97	T	95.1	Very high	92.9	Very high	56 Å²	56	84.8 Å²	84.8	34%	0.344	47%	0.466	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.2	116.7	179	-59.5	0	0	0	0	110.2	K99 L104	T97-K99 HydrophobicContact CG2-CG 4.46Å; T97-L104 PolarHBondContact N-O 3.18Å; T97-L104 PolarHBondContact O-N 2.86Å
98	F	94.4	Very high	92.7	Very high	119 Å²	119	83.5 Å²	83.5	52%	0.522	46%	0.463	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.5	127.5	171.8	-64.5	-88.5	0	0	0	110.3	V13 V86 V96 C103	V13-F98 HydrophobicContact CG1-CE1 4.5Å; V13-F98 HydrophobicContact CG1-CZ 3.99Å; V86-F98 HydrophobicContact CG2-CE2 4.14Å; V86-F98 HydrophobicContact CG2-CZ 3.94Å; V96-F98 HydrophobicContact CG1-CD2 4.24Å; V96-F98 HydrophobicContact CG1-CE2 3.6Å; V96-F98 HydrophobicContact CG1-CZ 3.9Å; F98-C103 HydrophobicContact CD1-CB 3.96Å; F98-C103 HydrophobicContact CE1-CB 3.84Å
99	K	92.9	Very high	92.4	Very high	136 Å²	136	81.3 Å²	81.3	59%	0.591	46%	0.463	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-115.4	169.3	165.8	-59.9	-179	178.7	177.2	0	108.1	T97 T101 T102	T97-K99 HydrophobicContact CG2-CG 4.46Å; K99-T101 PolarHBondContact O-N 2.8Å; K99-T102 PolarHBondContact N-O 2.98Å; K99-T102 PolarHBondContact O-N 3.3Å; K99-T102 VanDerWaalsContact O-N 3.12Å
100	R	91.2	Very high	92.2	Very high	255 Å²	255	86 Å²	86	96%	0.962	49%	0.49	S	S	*	.	T	Hydrogen-bonded Turn	trans	-37.8	-47.5	-171.7	-60.3	-168.1	-150	105.6	1.1	114.7
101	T	88.9	Confident	92	Very high	135 Å²	135	84.4 Å²	84.4	83%	0.828	49%	0.486	S	S	*	.	T	Hydrogen-bonded Turn	trans	-125.8	8.9	-175.2	58	0	0	0	0	113.7	K99	K99-T101 PolarHBondContact O-N 2.8Å
102	T	88.5	Confident	91.7	Very high	76 Å²	76	83.7 Å²	83.7	47%	0.466	48%	0.476	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-143.3	140.3	-172.5	62.8	0	0	0	0	111.9	K99	K99-T102 PolarHBondContact N-O 2.98Å; K99-T102 PolarHBondContact O-N 3.3Å; K99-T102 VanDerWaalsContact O-N 3.12Å
103	C	90.5	Very high	91.8	Very high	52 Å²	52	85.5 Å²	85.5	35%	0.351	47%	0.467	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.4	117.6	164.5	175.8	0	0	0	0	108.8	V96 F98	V96-C103 VanDerWaalsContact CG1-SG 3.57Å; F98-C103 HydrophobicContact CD1-CB 3.96Å; F98-C103 HydrophobicContact CE1-CB 3.84Å
104	L	90.3	Very high	91.8	Very high	73 Å²	73	87.3 Å²	87.3	38%	0.382	45%	0.453	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.5	127.2	173.3	179	66.9	0	0	0	109.2	V96 T97	V96-L104 CarbonylContact C-O 3.6Å; V96-L104 WeakPolarHBondContact CA-O 3.5Å; T97-L104 PolarHBondContact N-O 3.18Å; T97-L104 PolarHBondContact O-N 2.86Å
105	I	90.7	Very high	91.7	Very high	52 Å²	52	93.9 Å²	93.9	27%	0.267	49%	0.487	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.6	121.6	169.9	-54	169.7	0	0	0	106.5	V13 I68 L89 C94 T95 V96	V13-I105 HydrophobicContact CG2-CD1 4.06Å; I68-I105 HydrophobicContact CD1-CG2 3.9Å; L89-I105 HydrophobicContact CD1-CD1 3.85Å; L89-I105 HydrophobicContact CD1-CG1 4.37Å; C94-I105 HydrophobicContact CB-CG2 3.88Å; T95-I105 CarbonylContact O-C 3.53Å; T95-I105 WeakPolarHBondContact O-CA 3.48Å; V96-I105 HydrophobicContact CG2-CG1 4.47Å
106	S	88.1	Confident	91.4	Very high	76 Å²	76	95.5 Å²	95.5	53%	0.531	49%	0.488	S	S	.	.			trans	-128.3	0	-177.2	62.9	0	0	0	0	113.7	K66 C94 T95	K66-S106 PolarHBondContact NZ-O 2.89Å; K66-S106 PolarHBondContact NZ-OXT 3.4Å; C94-S106 WeakPolarHBondContact CA-O 3.48Å; T95-S106 PolarHBondContact N-O 3.03Å; T95-S106 PolarHBondContact O-N 3.33Å

Retrieved 106 of 106 residues in 110.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).