A0A077ZKH6_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZKH6, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 100 aa.

						>A0A077ZKH6_TRITR|A0A077ZKH6
MNHPCIYRLDVITKIRQPMKEEEAASARLFKDPWLPAYEASIEAFNPGLLSGEDQGLGVSPWKYANPRGRTVAAAVQLRARLHGHGVHAGLQSELEEEAE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	39.6	Very low	44.3	Very low	236 Å²	236	137.7 Å²	137.7	100%	1.163	69%	0.693	S	S	*	*				0	110.9	0	-75.2	173.6	172	0	0	106.8
2	N	44.3	Very low	44.9	Very low	168 Å²	168	133 Å²	133	90%	0.898	67%	0.669	S	S	*	*			trans	-80.2	134.4	-165.8	-75.6	-23.2	0	0	0	111.7
3	H	40.4	Very low	45.5	Very low	150 Å²	150	129.1 Å²	129.1	69%	0.694	66%	0.657	S	S	*	*			trans	-65.1	128.4	-169.2	-68.7	-60.6	0	0	0	114.1	C5	H3-C5 PolarHBondContact O-N 3.11Å; H3-C5 VanDerWaalsContact O-N 3.1Å
4	P	49.1	Very low	46	Very low	108 Å²	108	130.9 Å²	130.9	70%	0.701	66%	0.658	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72.6	5.3	174.3	28.7	-33.2	0	0	0	114.3
5	C	41.8	Very low	46.8	Very low	83 Å²	83	129.4 Å²	129.4	56%	0.561	65%	0.651	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84	-14.5	-170.6	-56.3	0	0	0	0	114.6	H3	H3-C5 PolarHBondContact O-N 3.11Å; H3-C5 VanDerWaalsContact O-N 3.1Å
6	I	43.5	Very low	47.3	Very low	118 Å²	118	133.4 Å²	133.4	61%	0.605	66%	0.656	S	S	*	*	H	α-helix	trans	-71.8	-36.8	-175.5	-57.9	178.1	0	0	0	111.2	R8	I6-R8 PolarHBondContact O-N 3.4Å
7	Y	43.5	Very low	47.7	Very low	187 Å²	187	133.4 Å²	133.4	73%	0.733	65%	0.654	S	S	*	*	H	α-helix	trans	-68.9	-30.5	-178.1	-68.1	-80.1	0	0	0	113.9	V11	Y7-V11 WeakPolarHBondContact O-CG2 3.22Å; Y7-V11 PolarHBondContact O-N 3.45Å
8	R	42.8	Very low	48.2	Very low	171 Å²	171	132.3 Å²	132.3	65%	0.645	66%	0.659	S	S	*	*	H	α-helix	trans	-71.4	-36.1	-178.1	-120.5	-179.1	179.8	-172.6	-1.4	112.2	I6 I12	I6-R8 PolarHBondContact O-N 3.4Å; R8-I12 VanDerWaalsContact O-CG1 3.31Å; R8-I12 WeakPolarHBondContact O-CG1 3.39Å; R8-I12 PolarHBondContact O-N 3.29Å
9	L	39.6	Very low	48.9	Very low	121 Å²	121	129.2 Å²	129.2	63%	0.634	64%	0.643	S	S	*	*	H	α-helix	trans	-64.4	-48.5	177	-102.5	147.6	0	0	0	110.8	V11 I12 T13	L9-V11 VanDerWaalsContact C-N 3.32Å; L9-V11 PolarHBondContact O-N 3.3Å; L9-I12 PolarHBondContact O-N 2.85Å; L9-T13 PolarHBondContact O-N 3.17Å; L9-T13 PolarHBondContact O-OG1 3.41Å
10	D	53.7	Low	49.8	Very low	91 Å²	91	129.7 Å²	129.7	49%	0.487	64%	0.641	S	S	.	*	H	α-helix	trans	-61.1	-37.9	-179.3	-77.7	-15.8	0	0	0	113.6	T13 K14	D10-T13 PolarHBondContact O-N 2.88Å; D10-K14 WeakPolarHBondContact O-CB 3.38Å; D10-K14 WeakPolarHBondContact O-CG 3.38Å; D10-K14 PolarHBondContact O-N 3.03Å
11	V	48.5	Very low	50.4	Low	82 Å²	82	132.1 Å²	132.1	50%	0.497	65%	0.651	S	S	.	*	H	α-helix	trans	-66.5	-43.3	177.3	173.4	0	0	0	0	110.8	Y7 L9 T13 K14 I15	Y7-V11 WeakPolarHBondContact O-CG2 3.22Å; Y7-V11 PolarHBondContact O-N 3.45Å; L9-V11 VanDerWaalsContact C-N 3.32Å; L9-V11 PolarHBondContact O-N 3.3Å; V11-T13 VanDerWaalsContact C-N 3.34Å; V11-T13 PolarHBondContact O-N 3.39Å; V11-K14 PolarHBondContact O-N 2.87Å; V11-I15 HydrophobicContact CG1-CD1 3.83Å; V11-I15 VanDerWaalsContact O-CG1 3.28Å; V11-I15 WeakPolarHBondContact O-CG1 3.48Å; V11-I15 PolarHBondContact O-N 3.41Å
12	I	51.8	Low	51.6	Low	81 Å²	81	128.8 Å²	128.8	42%	0.415	63%	0.632	S	S	.	*	H	α-helix	trans	-64.4	-40.6	177.1	-66.9	168.6	0	0	0	110.5	R8 L9 K14 I15 R16	R8-I12 VanDerWaalsContact O-CG1 3.31Å; R8-I12 WeakPolarHBondContact O-CG1 3.39Å; R8-I12 PolarHBondContact O-N 3.29Å; L9-I12 PolarHBondContact O-N 2.85Å; I12-K14 VanDerWaalsContact C-N 3.33Å; I12-K14 PolarHBondContact O-N 3.32Å; I12-I15 PolarHBondContact O-N 3.18Å; I12-R16 HydrophobicContact CG2-CG 4.4Å; I12-R16 WeakPolarHBondContact O-CB 3.49Å; I12-R16 WeakPolarHBondContact O-CG 3.44Å; I12-R16 PolarHBondContact O-N 3.29Å
13	T	53.2	Low	52.3	Low	82 Å²	82	124.4 Å²	124.4	50%	0.503	61%	0.606	S	S	.	*	H	α-helix	trans	-64.7	-36.8	177.4	-36.4	0	0	0	0	112	L9 D10 V11	L9-T13 PolarHBondContact O-N 3.17Å; L9-T13 PolarHBondContact O-OG1 3.41Å; D10-T13 PolarHBondContact O-N 2.88Å; V11-T13 VanDerWaalsContact C-N 3.34Å; V11-T13 PolarHBondContact O-N 3.39Å
14	K	52.4	Low	53.3	Low	155 Å²	155	118.6 Å²	118.6	67%	0.674	58%	0.584	S	S	*	*	H	α-helix	trans	-70.1	-34.9	174.8	-75	177.4	-178	179.1	0	112.9	D10 V11 I12	D10-K14 WeakPolarHBondContact O-CB 3.38Å; D10-K14 WeakPolarHBondContact O-CG 3.38Å; D10-K14 PolarHBondContact O-N 3.03Å; V11-K14 PolarHBondContact O-N 2.87Å; I12-K14 VanDerWaalsContact C-N 3.33Å; I12-K14 PolarHBondContact O-N 3.32Å
15	I	57.4	Low	53.7	Low	108 Å²	108	115.9 Å²	115.9	55%	0.554	57%	0.571	S	S	*	*	H	α-helix	trans	-71.4	-33.4	176.6	-68.1	165.7	0	0	0	111.4	V11 I12 Q17	V11-I15 HydrophobicContact CG1-CD1 3.83Å; V11-I15 VanDerWaalsContact O-CG1 3.28Å; V11-I15 WeakPolarHBondContact O-CG1 3.48Å; V11-I15 PolarHBondContact O-N 3.41Å; I12-I15 PolarHBondContact O-N 3.18Å; I15-Q17 VanDerWaalsContact C-N 3.3Å; I15-Q17 PolarHBondContact O-N 3.26Å
16	R	54.7	Low	54.5	Low	193 Å²	193	114.5 Å²	114.5	73%	0.728	56%	0.563	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84.5	7	-178.5	-71	-175.9	177.8	-171.8	0.4	114.5	I12	I12-R16 HydrophobicContact CG2-CG 4.4Å; I12-R16 WeakPolarHBondContact O-CB 3.49Å; I12-R16 WeakPolarHBondContact O-CG 3.44Å; I12-R16 PolarHBondContact O-N 3.29Å
17	Q	54	Low	55	Low	134 Å²	134	111 Å²	111	63%	0.626	55%	0.551	S	S	*	*	S	Bend	trans	-63.8	134.4	176	-69	-163.7	-11	0	0	110.1	I15 M19	I15-Q17 VanDerWaalsContact C-N 3.3Å; I15-Q17 PolarHBondContact O-N 3.26Å; Q17-M19 PolarHBondContact O-N 3.47Å
18	P	56.6	Low	55.3	Low	114 Å²	114	110.6 Å²	110.6	74%	0.74	55%	0.548	S	S	*	.	P	Polyproline II helix	trans	-59.4	134.7	174.1	25.2	-32.2	0	0	0	108.8	K20	P18-K20 PolarHBondContact O-N 3.38Å
19	M	61.4	Low	55.7	Low	73 Å²	73	109.7 Å²	109.7	36%	0.36	56%	0.555	S	S	.	*	P	Polyproline II helix	trans	-57.9	130.3	176.4	-172.5	173.4	-72.3	0	0	109.2	Q17 E23 A24 A27 Y38	Q17-M19 PolarHBondContact O-N 3.47Å; M19-E23 HydrophobicContact CG-CB 3.42Å; M19-E23 VanDerWaalsContact CG-CB 3.42Å; M19-E23 HydrophobicContact SD-CB 4.26Å; M19-A24 HydrophobicContact CG-CB 4.27Å; M19-A24 HydrophobicContact SD-CB 4.09Å; M19-A27 HydrophobicContact SD-CB 4.12Å; M19-Y38 HydrophobicContact CE-CE2 3.97Å
20	K	67.9	Low	56.2	Low	139 Å²	139	108.6 Å²	108.6	60%	0.604	55%	0.546	S	S	*	.	P	Polyproline II helix	trans	-65.3	153.6	175.6	-66.6	177.1	-179.4	177	0	109.8	P18 E22 E23 A24	P18-K20 PolarHBondContact O-N 3.38Å; K20-E22 PolarHBondContact O-N 3.48Å; K20-E22 VanDerWaalsContact O-N 3.17Å; K20-E23 HydrophobicContact CB-CB 4.45Å; K20-E23 HydrophobicContact CB-CG 4.13Å; K20-E23 PolarHBondContact N-OE2 3.44Å; K20-E23 WeakPolarHBondContact O-CA 3.38Å; K20-E23 WeakPolarHBondContact O-CB 3.43Å; K20-E23 PolarHBondContact O-N 2.93Å; K20-A24 PolarHBondContact O-N 3.28Å
21	E	61.8	Low	56	Low	180 Å²	180	112.7 Å²	112.7	84%	0.841	56%	0.559	S	S	*	*	H	α-helix	trans	-56.2	-35.7	-179.9	-71	-171.5	158.3	0	0	113.1	A24 A25	E21-A24 PolarHBondContact O-N 3.13Å; E21-A25 WeakPolarHBondContact O-CB 3.39Å; E21-A25 PolarHBondContact O-N 3.14Å
22	E	64.6	Low	56.2	Low	166 Å²	166	112.5 Å²	112.5	78%	0.776	56%	0.555	S	S	*	*	H	α-helix	trans	-66.4	-39	175.5	-62.2	176.6	175.5	0	0	112.5	K20 A25 S26	K20-E22 PolarHBondContact O-N 3.48Å; K20-E22 VanDerWaalsContact O-N 3.17Å; E22-A25 PolarHBondContact O-N 3.27Å; E22-S26 PolarHBondContact O-N 2.69Å; E22-S26 PolarHBondContact O-OG 3.32Å; E22-S26 VanDerWaalsContact O-OG 3.11Å
23	E	60.1	Low	56.3	Low	76 Å²	76	114.4 Å²	114.4	36%	0.355	57%	0.573	S	S	.	*	H	α-helix	trans	-69.9	-38.9	175.9	-64.5	172.4	154.3	0	0	110.2	M19 K20 S26 A27	M19-E23 HydrophobicContact CG-CB 3.42Å; M19-E23 VanDerWaalsContact CG-CB 3.42Å; M19-E23 HydrophobicContact SD-CB 4.26Å; K20-E23 HydrophobicContact CB-CB 4.45Å; K20-E23 HydrophobicContact CB-CG 4.13Å; K20-E23 PolarHBondContact N-OE2 3.44Å; K20-E23 WeakPolarHBondContact O-CA 3.38Å; K20-E23 WeakPolarHBondContact O-CB 3.43Å; K20-E23 PolarHBondContact O-N 2.93Å; E23-S26 WeakPolarHBondContact CA-OG 3.49Å; E23-S26 PolarHBondContact O-N 2.97Å; E23-S26 PolarHBondContact O-OG 2.9Å; E23-A27 VanDerWaalsContact O-CB 3.26Å; E23-A27 WeakPolarHBondContact O-CB 3.13Å; E23-A27 PolarHBondContact O-N 2.95Å
24	A	61.2	Low	56.1	Low	28 Å²	28	119.6 Å²	119.6	23%	0.231	58%	0.583	C	S	.	*	H	α-helix	trans	-65.8	-38.6	174	0	0	0	0	0	111.7	M19 K20 E21 A27 R28	M19-A24 HydrophobicContact CG-CB 4.27Å; M19-A24 HydrophobicContact SD-CB 4.09Å; K20-A24 PolarHBondContact O-N 3.28Å; E21-A24 PolarHBondContact O-N 3.13Å; A24-A27 PolarHBondContact O-N 3.31Å; A24-R28 WeakPolarHBondContact O-CB 3.37Å; A24-R28 VanDerWaalsContact O-CG 3.22Å; A24-R28 WeakPolarHBondContact O-CG 3.36Å; A24-R28 PolarHBondContact O-N 3.37Å
25	A	58	Low	55.9	Low	51 Å²	51	116.3 Å²	116.3	42%	0.421	57%	0.573	S	S	.	*	H	α-helix	trans	-65.3	-41	176.3	0	0	0	0	0	112.2	E21 E22 R28	E21-A25 WeakPolarHBondContact O-CB 3.39Å; E21-A25 PolarHBondContact O-N 3.14Å; E22-A25 PolarHBondContact O-N 3.27Å; A25-R28 PolarHBondContact O-N 2.88Å
26	S	56.9	Low	55.7	Low	55 Å²	55	114.4 Å²	114.4	39%	0.385	57%	0.567	S	S	.	*	H	α-helix	trans	-73	-34.9	175.4	57	0	0	0	0	112.6	E22 E23 R28 L29 F30	E22-S26 PolarHBondContact O-N 2.69Å; E22-S26 PolarHBondContact O-OG 3.32Å; E22-S26 VanDerWaalsContact O-OG 3.11Å; E23-S26 WeakPolarHBondContact CA-OG 3.49Å; E23-S26 PolarHBondContact O-N 2.97Å; E23-S26 PolarHBondContact O-OG 2.9Å; S26-R28 VanDerWaalsContact C-N 3.33Å; S26-R28 PolarHBondContact O-N 2.98Å; S26-L29 WeakPolarHBondContact O-CB 3.34Å; S26-L29 PolarHBondContact O-N 3.11Å; S26-F30 WeakPolarHBondContact O-CD2 3.42Å
27	A	54.1	Low	55.5	Low	43 Å²	43	108 Å²	108	36%	0.355	56%	0.556	S	S	.	*	H	α-helix	trans	-66.3	-32.7	172.6	0	0	0	0	0	112.6	M19 E23 A24 L29 F30	M19-A27 HydrophobicContact SD-CB 4.12Å; E23-A27 VanDerWaalsContact O-CB 3.26Å; E23-A27 WeakPolarHBondContact O-CB 3.13Å; E23-A27 PolarHBondContact O-N 2.95Å; A24-A27 PolarHBondContact O-N 3.31Å; A27-L29 PolarHBondContact O-N 2.85Å; A27-F30 CarbonylContact O-C 3.38Å; A27-F30 WeakPolarHBondContact O-CA 3.44Å; A27-F30 WeakPolarHBondContact O-CB 3.26Å; A27-F30 PolarHBondContact O-N 3.37Å
28	R	50.6	Low	55.2	Low	180 Å²	180	107.1 Å²	107.1	68%	0.679	55%	0.547	S	S	*	.	H	α-helix	trans	-62.2	-25.8	174	-79.5	169.1	-179.5	176.6	2.4	113.5	A24 A25 S26 F30 K31	A24-R28 WeakPolarHBondContact O-CB 3.37Å; A24-R28 VanDerWaalsContact O-CG 3.22Å; A24-R28 WeakPolarHBondContact O-CG 3.36Å; A24-R28 PolarHBondContact O-N 3.37Å; A25-R28 PolarHBondContact O-N 2.88Å; S26-R28 VanDerWaalsContact C-N 3.33Å; S26-R28 PolarHBondContact O-N 2.98Å; R28-F30 VanDerWaalsContact C-N 3.26Å; R28-K31 WeakPolarHBondContact O-CG 3.49Å; R28-K31 PolarHBondContact O-N 2.94Å
29	L	50.6	Low	54.6	Low	152 Å²	152	108 Å²	108	80%	0.796	54%	0.542	S	S	*	.	H	α-helix	trans	-69.9	-26.9	171.9	-84.2	144	0	0	0	111.8	S26 A27 K31	S26-L29 WeakPolarHBondContact O-CB 3.34Å; S26-L29 PolarHBondContact O-N 3.11Å; A27-L29 PolarHBondContact O-N 2.85Å; L29-K31 PolarHBondContact O-N 3.12Å
30	F	50	Low	53.8	Low	98 Å²	98	107.2 Å²	107.2	43%	0.43	55%	0.547	S	S	.	.	T	Hydrogen-bonded Turn	trans	-90.1	45.1	170.3	-61.6	-81.7	0	0	0	111.4	S26 A27 R28 D32 L78 L82	S26-F30 WeakPolarHBondContact O-CD2 3.42Å; A27-F30 CarbonylContact O-C 3.38Å; A27-F30 WeakPolarHBondContact O-CA 3.44Å; A27-F30 WeakPolarHBondContact O-CB 3.26Å; A27-F30 PolarHBondContact O-N 3.37Å; R28-F30 VanDerWaalsContact C-N 3.26Å; F30-D32 PolarHBondContact O-N 3.38Å; F30-L78 HydrophobicContact CE1-CD1 4.28Å; F30-L82 HydrophobicContact CE2-CD1 4.23Å; F30-L82 HydrophobicContact CE2-CD2 3.75Å; F30-L82 HydrophobicContact CZ-CD2 3.99Å
31	K	51.1	Low	52.8	Low	177 Å²	177	102.9 Å²	102.9	77%	0.77	53%	0.534	S	S	*	.			trans	-64	72	162.8	-94	-177.6	177.7	-174.3	0	109	R28 L29 P33	R28-K31 WeakPolarHBondContact O-CG 3.49Å; R28-K31 PolarHBondContact O-N 2.94Å; L29-K31 PolarHBondContact O-N 3.12Å; K31-P33 WeakPolarHBondContact O-CD 3.43Å
32	D	51.2	Low	52	Low	77 Å²	77	99.7 Å²	99.7	41%	0.412	52%	0.521	S	S	.	.			trans	-65.3	120.9	165.4	-163.6	-27.2	0	0	0	106.1	F30 W34 L35	F30-D32 PolarHBondContact O-N 3.38Å; D32-W34 PolarHBondContact O-N 3.19Å; D32-W34 PolarHBondContact OD1-N 3.08Å; D32-L35 HydrophobicContact CB-CB 4.24Å; D32-L35 HydrophobicContact CB-CD1 3.41Å; D32-L35 VanDerWaalsContact CB-CD1 3.41Å; D32-L35 HydrophobicContact CB-CG 4.39Å; D32-L35 PolarHBondContact O-N 3.09Å
33	P	53.5	Low	50.8	Low	121 Å²	121	100 Å²	100	79%	0.786	52%	0.523	S	S	*	.	T	Hydrogen-bonded Turn	trans	-54.5	-16.9	178.6	-25.1	33.9	0	0	0	113.8	K31	K31-P33 WeakPolarHBondContact O-CD 3.43Å
34	W	49.6	Very low	50	Low	192 Å²	192	99.3 Å²	99.3	73%	0.727	53%	0.53	S	S	*	.	T	Hydrogen-bonded Turn	trans	-96.3	-8.5	-178.3	-54.6	103.9	0	0	0	114.1	D32	D32-W34 PolarHBondContact O-N 3.19Å; D32-W34 PolarHBondContact OD1-N 3.08Å
35	L	49	Very low	49.1	Very low	86 Å²	86	104.6 Å²	104.6	45%	0.45	55%	0.548	S	S	.	.	S	Bend	trans	-83.6	125.5	175.3	-100.7	114.5	0	0	0	109.8	D32 W62	D32-L35 HydrophobicContact CB-CB 4.24Å; D32-L35 HydrophobicContact CB-CD1 3.41Å; D32-L35 VanDerWaalsContact CB-CD1 3.41Å; D32-L35 HydrophobicContact CB-CG 4.39Å; D32-L35 PolarHBondContact O-N 3.09Å; L35-W62 HydrophobicContact CD2-CH2 3.43Å; L35-W62 VanDerWaalsContact CD2-CH2 3.43Å; L35-W62 HydrophobicContact CD2-CZ2 4.31Å; L35-W62 HydrophobicContact CD2-CZ3 4.16Å; L35-W62 HydrophobicContact CG-CH2 3.63Å; L35-W62 HydrophobicContact CG-CZ3 3.9Å
36	P	52.4	Low	48.6	Very low	67 Å²	67	104.6 Å²	104.6	44%	0.435	54%	0.541	S	S	.	.	P	Polyproline II helix	trans	-57.3	148.9	169.5	1.9	3.5	0	0	0	109.4	Y38 A40	P36-Y38 PolarHBondContact O-N 3.26Å; P36-A40 HydrophobicContact CB-CB 4.48Å
37	A	51.4	Low	47.9	Very low	59 Å²	59	106.2 Å²	106.2	49%	0.488	55%	0.55	S	S	.	*	P	Polyproline II helix	trans	-47.6	135.4	171.7	0	0	0	0	0	109	E39 A40 S41	A37-E39 PolarHBondContact O-N 2.78Å; A37-E39 VanDerWaalsContact O-N 3.11Å; A37-A40 HydrophobicContact CB-CB 4.43Å; A37-A40 WeakPolarHBondContact O-CA 3.45Å; A37-A40 WeakPolarHBondContact O-CB 3.36Å; A37-A40 PolarHBondContact O-N 3.19Å; A37-S41 PolarHBondContact O-N 3.03Å; A37-S41 PolarHBondContact O-OG 3.25Å
38	Y	46.1	Very low	47.4	Very low	116 Å²	116	105.7 Å²	105.7	46%	0.455	55%	0.549	S	S	.	.	H	α-helix	trans	-52.5	-37.7	-176.1	175.3	-106.2	0	0	0	111.2	M19 P36 A40 S41 I42	M19-Y38 HydrophobicContact CE-CE2 3.97Å; P36-Y38 PolarHBondContact O-N 3.26Å; Y38-A40 PolarHBondContact O-N 2.88Å; Y38-S41 PolarHBondContact O-N 3.06Å; Y38-S41 VanDerWaalsContact O-N 3.14Å; Y38-I42 HydrophobicContact CD1-CD1 3.8Å; Y38-I42 HydrophobicContact CE1-CD1 3.3Å; Y38-I42 HydrophobicContact CE1-CG1 4.41Å; Y38-I42 HydrophobicContact CE2-CD1 4.14Å; Y38-I42 HydrophobicContact CE2-CG1 4.48Å; Y38-I42 HydrophobicContact CG-CD1 4.41Å; Y38-I42 VanDerWaalsContact CZ-CD1 3.5Å; Y38-I42 PolarHBondContact O-N 3.44Å
39	E	44.2	Very low	46.9	Very low	133 Å²	133	102.5 Å²	102.5	62%	0.621	55%	0.545	S	S	*	.	H	α-helix	trans	-60.3	-42.2	174.9	-59.5	95.7	-176.3	0	0	112.6	A37 S41 I42	A37-E39 PolarHBondContact O-N 2.78Å; A37-E39 VanDerWaalsContact O-N 3.11Å; E39-S41 PolarHBondContact O-N 3.32Å; E39-I42 PolarHBondContact O-N 3.29Å
40	A	45.2	Very low	46.3	Very low	56 Å²	56	101.5 Å²	101.5	46%	0.463	54%	0.539	S	S	.	.	H	α-helix	trans	-69.4	-20.5	177.9	0	0	0	0	0	113.3	P36 A37 Y38	P36-A40 HydrophobicContact CB-CB 4.48Å; A37-A40 HydrophobicContact CB-CB 4.43Å; A37-A40 WeakPolarHBondContact O-CA 3.45Å; A37-A40 WeakPolarHBondContact O-CB 3.36Å; A37-A40 PolarHBondContact O-N 3.19Å; Y38-A40 PolarHBondContact O-N 2.88Å
41	S	46.7	Very low	45.7	Very low	48 Å²	48	99.6 Å²	99.6	34%	0.336	54%	0.538	S	S	.	.	H	α-helix	trans	-85.9	-24.2	-179.5	-54.2	0	0	0	0	113	A37 Y38 E39	A37-S41 PolarHBondContact O-N 3.03Å; A37-S41 PolarHBondContact O-OG 3.25Å; Y38-S41 PolarHBondContact O-N 3.06Å; Y38-S41 VanDerWaalsContact O-N 3.14Å; E39-S41 PolarHBondContact O-N 3.32Å
42	I	45.3	Very low	45.1	Very low	112 Å²	112	95.3 Å²	95.3	57%	0.574	54%	0.544	S	S	*	.	H	α-helix	trans	-80.1	-35.7	177.3	-64.5	164.4	0	0	0	110.9	Y38 E39	Y38-I42 HydrophobicContact CD1-CD1 3.8Å; Y38-I42 HydrophobicContact CE1-CD1 3.3Å; Y38-I42 HydrophobicContact CE1-CG1 4.41Å; Y38-I42 HydrophobicContact CE2-CD1 4.14Å; Y38-I42 HydrophobicContact CE2-CG1 4.48Å; Y38-I42 HydrophobicContact CG-CD1 4.41Å; Y38-I42 VanDerWaalsContact CZ-CD1 3.5Å; Y38-I42 PolarHBondContact O-N 3.44Å; E39-I42 PolarHBondContact O-N 3.29Å
43	E	39.6	Very low	44.5	Very low	172 Å²	172	99.9 Å²	99.9	80%	0.804	56%	0.563	S	S	*	*	S	Bend	trans	-85.2	-12.5	-178.3	-68.6	-173.7	164.6	0	0	113.9	F45	E43-F45 PolarHBondContact O-N 3.01Å; E43-F45 VanDerWaalsContact O-N 3.13Å
44	A	43.7	Very low	44	Very low	62 Å²	62	98.3 Å²	98.3	51%	0.512	55%	0.548	S	S	.	.	S	Bend	trans	-65.7	116.7	179.5	0	0	0	0	0	110.9	N46	A44-N46 PolarHBondContact O-N 3.27Å
45	F	42.6	Very low	43.3	Very low	140 Å²	140	98.4 Å²	98.4	61%	0.614	56%	0.557	S	S	*	*			trans	-52.2	126.4	169.6	-170.7	-96.3	0	0	0	110.1	E43 P47 L50	E43-F45 PolarHBondContact O-N 3.01Å; E43-F45 VanDerWaalsContact O-N 3.13Å; F45-P47 WeakPolarHBondContact O-CD 3.31Å; F45-L50 HydrophobicContact CE1-CD1 3.39Å; F45-L50 HydrophobicContact CE1-CG 3.71Å; F45-L50 HydrophobicContact CZ-CD1 3.29Å; F45-L50 HydrophobicContact CZ-CD2 3.89Å; F45-L50 HydrophobicContact CZ-CG 3.4Å; F45-L50 VanDerWaalsContact CZ-CG 3.4Å
46	N	46.1	Very low	42.6	Very low	51 Å²	51	96 Å²	96	27%	0.273	55%	0.553	S	S	.	*			trans	-86.9	105.9	174.4	-179.2	2.3	0	0	0	109.2	A44 G48 L49	A44-N46 PolarHBondContact O-N 3.27Å; N46-G48 PolarHBondContact O-N 3.45Å; N46-G48 PolarHBondContact OD1-N 3.47Å; N46-G48 VanDerWaalsContact OD1-N 3.08Å; N46-L49 HydrophobicContact CB-CD1 3.96Å; N46-L49 WeakPolarHBondContact O-CB 3.43Å; N46-L49 PolarHBondContact O-N 3.46Å; N46-L49 VanDerWaalsContact O-N 3.12Å
47	P	43	Very low	41.7	Very low	89 Å²	89	100.5 Å²	100.5	58%	0.578	57%	0.572	S	S	*	*	G	3₁₀ helix	trans	-64.8	-20.8	-178.8	26.3	-34	0	0	0	113.4	F45 L49 L50	F45-P47 WeakPolarHBondContact O-CD 3.31Å; P47-L49 PolarHBondContact O-N 2.92Å; P47-L50 PolarHBondContact O-N 3.27Å
48	G	43.6	Very low	40.9	Very low	31 Å²	31	100.2 Å²	100.2	32%	0.32	58%	0.575	S	S	.	*	G	3₁₀ helix	trans	-72.2	-13	175.6	0	0	0	0	0	114.5	N46 S51	N46-G48 PolarHBondContact O-N 3.45Å; N46-G48 PolarHBondContact OD1-N 3.47Å; N46-G48 VanDerWaalsContact OD1-N 3.08Å; G48-S51 PolarHBondContact O-OG 3.42Å
49	L	40.3	Very low	40.5	Very low	114 Å²	114	98.9 Å²	98.9	60%	0.597	58%	0.579	S	S	*	*	G	3₁₀ helix	trans	-82.3	-12.2	175.7	-98	155.2	0	0	0	113.2	N46 P47	N46-L49 HydrophobicContact CB-CD1 3.96Å; N46-L49 WeakPolarHBondContact O-CB 3.43Å; N46-L49 PolarHBondContact O-N 3.46Å; N46-L49 VanDerWaalsContact O-N 3.12Å; P47-L49 PolarHBondContact O-N 2.92Å
50	L	38.7	Very low	40.1	Very low	131 Å²	131	95.1 Å²	95.1	69%	0.686	57%	0.567	S	S	*	*	T	Hydrogen-bonded Turn	trans	-96.9	-24.7	177.4	-70.3	-176.8	0	0	0	114.1	F45 P47 G52	F45-L50 HydrophobicContact CE1-CD1 3.39Å; F45-L50 HydrophobicContact CE1-CG 3.71Å; F45-L50 HydrophobicContact CZ-CD1 3.29Å; F45-L50 HydrophobicContact CZ-CD2 3.89Å; F45-L50 HydrophobicContact CZ-CG 3.4Å; F45-L50 VanDerWaalsContact CZ-CG 3.4Å; P47-L50 PolarHBondContact O-N 3.27Å; L50-G52 PolarHBondContact O-N 3.22Å
51	S	37.5	Very low	39.9	Very low	58 Å²	58	95.9 Å²	95.9	41%	0.406	57%	0.567	S	S	.	*	S	Bend	trans	-79.9	110	168.2	53.9	0	0	0	0	107.2	G48 E53	G48-S51 PolarHBondContact O-OG 3.42Å; S51-E53 PolarHBondContact O-N 3.48Å
52	G	38.2	Very low	39.5	Very low	86 Å²	86	99 Å²	99	89%	0.887	57%	0.572	S	S	*	*	S	Bend	trans	-61.2	22.9	175.2	0	0	0	0	0	115.6	L50	L50-G52 PolarHBondContact O-N 3.22Å
53	E	38.5	Very low	39.2	Very low	173 Å²	173	100.5 Å²	100.5	81%	0.808	57%	0.574	S	S	*	*			trans	-98.8	43.1	171.4	-64.6	-175.5	132.8	0	0	110.4	S51 Q55	S51-E53 PolarHBondContact O-N 3.48Å; E53-Q55 PolarHBondContact O-N 3.36Å
54	D	41.6	Very low	39.2	Very low	88 Å²	88	102.5 Å²	102.5	47%	0.471	58%	0.576	S	S	.	*			trans	-92.7	58.3	173.4	-153.8	17.4	0	0	0	109.7	G56	D54-G56 PolarHBondContact O-N 3.39Å
55	Q	36.7	Very low	39.1	Very low	195 Å²	195	102.3 Å²	102.3	91%	0.911	57%	0.574	S	S	*	*	S	Bend	trans	-84.9	70	165	-70.9	-161.8	26.2	0	0	109.5	E53	E53-Q55 PolarHBondContact O-N 3.36Å
56	G	33.8	Very low	38.9	Very low	36 Å²	36	98.8 Å²	98.8	37%	0.371	56%	0.562	S	S	.	*	S	Bend	trans	79.5	136	168	0	0	0	0	0	113.6	D54	D54-G56 PolarHBondContact O-N 3.39Å
57	L	33.8	Very low	38.7	Very low	160 Å²	160	102.2 Å²	102.2	84%	0.838	59%	0.587	S	S	*	*			trans	74.2	73.6	-179.2	-46.9	169.8	0	0	0	112.8	V59	L57-V59 VanDerWaalsContact C-N 3.31Å; L57-V59 WeakPolarHBondContact O-CG2 3.39Å; L57-V59 PolarHBondContact O-N 3.4Å
58	G	33.1	Very low	38.7	Very low	54 Å²	54	107.8 Å²	107.8	56%	0.557	60%	0.596	S	S	*	*			trans	-51.4	96.9	161.9	0	0	0	0	0	109.9	S60	G58-S60 VanDerWaalsContact C-N 3.3Å; G58-S60 PolarHBondContact O-N 2.88Å
59	V	37.7	Very low	38.6	Very low	87 Å²	87	108.9 Å²	108.9	53%	0.527	61%	0.608	S	S	.	*			trans	-74.3	94.1	-176.2	-143.1	0	0	0	0	106.7	L57 K63	L57-V59 VanDerWaalsContact C-N 3.31Å; L57-V59 WeakPolarHBondContact O-CG2 3.39Å; L57-V59 PolarHBondContact O-N 3.4Å; V59-K63 HydrophobicContact CG1-CD 3.6Å; V59-K63 HydrophobicContact CG1-CG 4.02Å
60	S	37.3	Very low	38.7	Very low	54 Å²	54	112.2 Å²	112.2	38%	0.378	61%	0.613	S	S	.	*			trans	-49.1	138.8	176.9	-131.2	0	0	0	0	110.3	G58 W62 K63	G58-S60 VanDerWaalsContact C-N 3.3Å; G58-S60 PolarHBondContact O-N 2.88Å; S60-W62 VanDerWaalsContact CB-CD1 3.47Å; S60-W62 PolarHBondContact O-N 2.71Å; S60-W62 VanDerWaalsContact OG-CD1 3.29Å; S60-K63 PolarHBondContact O-N 2.77Å
61	P	40.4	Very low	39.1	Very low	72 Å²	72	110.6 Å²	110.6	47%	0.468	61%	0.608	S	S	.	*	G	3₁₀ helix	trans	-55.6	-12	-175.4	-7.5	7.1	0	0	0	114.6	K63 Y64	P61-K63 PolarHBondContact O-N 2.75Å; P61-Y64 PolarHBondContact O-N 3.16Å; P61-Y64 VanDerWaalsContact O-N 3.09Å
62	W	37.7	Very low	39.4	Very low	113 Å²	113	111 Å²	111	43%	0.428	61%	0.608	S	S	.	*	G	3₁₀ helix	trans	-50.2	-18	170.3	-61.8	86.8	0	0	0	115.8	L35 S60 Y64	L35-W62 HydrophobicContact CD2-CH2 3.43Å; L35-W62 VanDerWaalsContact CD2-CH2 3.43Å; L35-W62 HydrophobicContact CD2-CZ2 4.31Å; L35-W62 HydrophobicContact CD2-CZ3 4.16Å; L35-W62 HydrophobicContact CG-CH2 3.63Å; L35-W62 HydrophobicContact CG-CZ3 3.9Å; S60-W62 VanDerWaalsContact CB-CD1 3.47Å; S60-W62 PolarHBondContact O-N 2.71Å; S60-W62 VanDerWaalsContact OG-CD1 3.29Å; W62-Y64 PolarHBondContact O-N 2.8Å
63	K	39.1	Very low	39.6	Very low	145 Å²	145	109.4 Å²	109.4	63%	0.63	59%	0.586	S	S	*	*	G	3₁₀ helix	trans	-64.1	-18.6	172.1	-95.3	-160.7	-176.4	-179.9	0	113.9	V59 S60 P61	V59-K63 HydrophobicContact CG1-CD 3.6Å; V59-K63 HydrophobicContact CG1-CG 4.02Å; S60-K63 PolarHBondContact O-N 2.77Å; P61-K63 PolarHBondContact O-N 2.75Å
64	Y	39.6	Very low	39.8	Very low	214 Å²	214	103.1 Å²	103.1	84%	0.839	56%	0.564	S	S	*	*	S	Bend	trans	-112.2	-5.2	-174.4	-65.9	-78.8	0	0	0	114.9	P61 W62	P61-Y64 PolarHBondContact O-N 3.16Å; P61-Y64 VanDerWaalsContact O-N 3.09Å; W62-Y64 PolarHBondContact O-N 2.8Å
65	A	41.7	Very low	40	Very low	57 Å²	57	101.9 Å²	101.9	47%	0.471	57%	0.566	S	S	.	*	S	Bend	trans	-98.3	2.8	-172.2	0	0	0	0	0	115
66	N	38.9	Very low	40.5	Very low	66 Å²	66	96 Å²	96	35%	0.353	54%	0.543	S	S	.	.			trans	-127.8	101.8	-176.4	-166.9	-7.8	0	0	0	113	R68 G69 R70	N66-R68 PolarHBondContact O-N 2.76Å; N66-R68 WeakPolarHBondContact OD1-CA 3.33Å; N66-R68 WeakPolarHBondContact OD1-CB 3.49Å; N66-R68 PolarHBondContact OD1-N 2.95Å; N66-G69 PolarHBondContact O-N 3.48Å; N66-R70 WeakPolarHBondContact ND2-CB 3.33Å; N66-R70 PolarHBondContact ND2-N 2.82Å; N66-R70 PolarHBondContact ND2-O 2.94Å
67	P	41.4	Very low	41.2	Very low	123 Å²	123	100.6 Å²	100.6	80%	0.799	56%	0.555	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.9	-5.9	174.1	25.7	-31.9	0	0	0	113.7
68	R	43.1	Very low	41.9	Very low	206 Å²	206	96.6 Å²	96.6	78%	0.777	53%	0.534	S	S	*	.	T	Hydrogen-bonded Turn	trans	-102.2	7.6	176	-78.3	-176.4	156	178.4	-4.8	114.7	N66 R70	N66-R68 PolarHBondContact O-N 2.76Å; N66-R68 WeakPolarHBondContact OD1-CA 3.33Å; N66-R68 WeakPolarHBondContact OD1-CB 3.49Å; N66-R68 PolarHBondContact OD1-N 2.95Å; R68-R70 PolarHBondContact O-N 3.43Å
69	G	41.5	Very low	42.6	Very low	55 Å²	55	101.2 Å²	101.2	57%	0.567	54%	0.535	S	S	*	.			trans	56.3	24.7	172.3	0	0	0	0	0	114.4	N66 T71	N66-G69 PolarHBondContact O-N 3.48Å; G69-T71 PolarHBondContact O-N 3.32Å
70	R	43.1	Very low	43.1	Very low	184 Å²	184	98.8 Å²	98.8	69%	0.694	52%	0.524	S	S	*	.			trans	-74.9	85.4	165.3	-58.9	-171.1	-177.3	-178.5	0.2	105.7	N66 R68 A74	N66-R70 WeakPolarHBondContact ND2-CB 3.33Å; N66-R70 PolarHBondContact ND2-N 2.82Å; N66-R70 PolarHBondContact ND2-O 2.94Å; R68-R70 PolarHBondContact O-N 3.43Å; R70-A74 HydrophobicContact CB-CB 4.08Å
71	T	46	Very low	43.7	Very low	97 Å²	97	106.8 Å²	106.8	60%	0.595	55%	0.546	S	S	*	.			trans	-50.6	160.1	179.1	45.9	0	0	0	0	110.1	G69 A73 A74	G69-T71 PolarHBondContact O-N 3.32Å; T71-A73 CarbonylContact O-C 3.6Å; T71-A73 PolarHBondContact O-N 3.17Å; T71-A74 PolarHBondContact O-N 2.99Å
72	V	44.9	Very low	44.2	Very low	67 Å²	67	107.9 Å²	107.9	41%	0.406	55%	0.548	S	S	.	.	H	α-helix	trans	-36.2	-30	170.8	177.9	0	0	0	0	113.5	A74 A75 V76	V72-A74 VanDerWaalsContact C-N 3.31Å; V72-A74 PolarHBondContact O-N 2.99Å; V72-A75 PolarHBondContact O-N 3.24Å; V72-A75 VanDerWaalsContact O-N 3.16Å; V72-V76 HydrophobicContact CG1-CG2 4.14Å; V72-V76 WeakPolarHBondContact O-CG2 3.36Å; V72-V76 PolarHBondContact O-N 3.46Å
73	A	41.2	Very low	44.7	Very low	51 Å²	51	107.3 Å²	107.3	42%	0.421	55%	0.549	S	S	.	.	H	α-helix	trans	-49.9	-40.2	170.4	0	0	0	0	0	115	T71 V76 Q77	T71-A73 CarbonylContact O-C 3.6Å; T71-A73 PolarHBondContact O-N 3.17Å; A73-V76 PolarHBondContact O-N 2.88Å; A73-Q77 WeakPolarHBondContact O-CB 3.31Å; A73-Q77 WeakPolarHBondContact O-CG 3.28Å; A73-Q77 PolarHBondContact O-N 3.3Å
74	A	43.4	Very low	44.8	Very low	41 Å²	41	102.8 Å²	102.8	34%	0.339	54%	0.543	S	S	.	.	H	α-helix	trans	-70.3	-36.7	179.3	0	0	0	0	0	112.2	R70 T71 V72 L78	R70-A74 HydrophobicContact CB-CB 4.08Å; T71-A74 PolarHBondContact O-N 2.99Å; V72-A74 VanDerWaalsContact C-N 3.31Å; V72-A74 PolarHBondContact O-N 2.99Å; A74-L78 WeakPolarHBondContact O-CB 3.27Å; A74-L78 PolarHBondContact O-N 2.93Å
75	A	45.9	Very low	44.8	Very low	62 Å²	62	101.8 Å²	101.8	51%	0.512	55%	0.546	S	S	.	.	H	α-helix	trans	-71.2	-37.3	175.1	0	0	0	0	0	111.5	V72 L78 R79	V72-A75 PolarHBondContact O-N 3.24Å; V72-A75 VanDerWaalsContact O-N 3.16Å; A75-L78 PolarHBondContact O-N 3.13Å; A75-R79 WeakPolarHBondContact O-CB 3.45Å; A75-R79 PolarHBondContact O-N 2.92Å
76	V	47.1	Very low	44.8	Very low	73 Å²	73	102.6 Å²	102.6	44%	0.442	56%	0.56	S	S	.	*	H	α-helix	trans	-65.2	-44.8	173.4	173.3	0	0	0	0	111	V72 A73 L78 R79 A80	V72-V76 HydrophobicContact CG1-CG2 4.14Å; V72-V76 WeakPolarHBondContact O-CG2 3.36Å; V72-V76 PolarHBondContact O-N 3.46Å; A73-V76 PolarHBondContact O-N 2.88Å; V76-L78 VanDerWaalsContact C-N 3.35Å; V76-L78 PolarHBondContact O-N 2.85Å; V76-R79 PolarHBondContact O-N 3.21Å; V76-A80 WeakPolarHBondContact O-CB 3.41Å; V76-A80 PolarHBondContact O-N 3.48Å
77	Q	48.4	Very low	45	Very low	131 Å²	131	105 Å²	105	61%	0.612	58%	0.576	S	S	*	*	H	α-helix	trans	-64.3	-37.3	174.8	-80.4	179.5	-5.8	0	0	112.7	A73 A80 R81	A73-Q77 WeakPolarHBondContact O-CB 3.31Å; A73-Q77 WeakPolarHBondContact O-CG 3.28Å; A73-Q77 PolarHBondContact O-N 3.3Å; Q77-A80 PolarHBondContact O-N 3.44Å; Q77-R81 WeakPolarHBondContact O-CB 3.38Å; Q77-R81 PolarHBondContact O-N 2.96Å
78	L	49.5	Very low	45	Very low	77 Å²	77	103.3 Å²	103.3	40%	0.403	56%	0.558	S	S	.	*	H	α-helix	trans	-65.6	-43.1	174.9	-166.5	76.4	0	0	0	110.6	F30 A74 A75 V76 A80 R81 L82	F30-L78 HydrophobicContact CE1-CD1 4.28Å; A74-L78 WeakPolarHBondContact O-CB 3.27Å; A74-L78 PolarHBondContact O-N 2.93Å; A75-L78 PolarHBondContact O-N 3.13Å; V76-L78 VanDerWaalsContact C-N 3.35Å; V76-L78 PolarHBondContact O-N 2.85Å; L78-A80 VanDerWaalsContact C-N 3.34Å; L78-A80 PolarHBondContact O-N 3.43Å; L78-R81 PolarHBondContact O-N 2.93Å; L78-L82 HydrophobicContact CD2-CD1 4.39Å; L78-L82 HydrophobicContact CG-CD1 4.04Å; L78-L82 WeakPolarHBondContact O-CB 3.37Å; L78-L82 VanDerWaalsContact O-CG 3.31Å; L78-L82 WeakPolarHBondContact O-CG 3.37Å; L78-L82 PolarHBondContact O-N 2.86Å
79	R	46	Very low	44.7	Very low	150 Å²	150	97.4 Å²	97.4	57%	0.566	55%	0.553	S	S	*	*	H	α-helix	trans	-64.9	-37.6	176	-165	174.1	-173.1	-171.7	2.3	112.1	A75 V76 L82 H83	A75-R79 WeakPolarHBondContact O-CB 3.45Å; A75-R79 PolarHBondContact O-N 2.92Å; V76-R79 PolarHBondContact O-N 3.21Å; R79-L82 PolarHBondContact O-N 3.29Å; R79-H83 WeakPolarHBondContact O-CB 3.33Å; R79-H83 PolarHBondContact O-CD2 3.1Å; R79-H83 PolarHBondContact O-N 3.39Å
80	A	48.6	Very low	44.6	Very low	37 Å²	37	97.2 Å²	97.2	31%	0.306	55%	0.551	S	S	.	*	H	α-helix	trans	-65.8	-35.8	173	0	0	0	0	0	113.3	V76 Q77 L78 H88	V76-A80 WeakPolarHBondContact O-CB 3.41Å; V76-A80 PolarHBondContact O-N 3.48Å; Q77-A80 PolarHBondContact O-N 3.44Å; L78-A80 VanDerWaalsContact C-N 3.34Å; L78-A80 PolarHBondContact O-N 3.43Å; A80-H88 WeakPolarHBondContact CB-CD2 3.2Å; A80-H88 WeakPolarHBondContact CB-NE2 3.34Å
81	R	50.7	Low	44.4	Very low	222 Å²	222	93.6 Å²	93.6	84%	0.838	55%	0.545	S	S	*	.	H	α-helix	trans	-73.7	-36.2	174.5	-89.6	-178	166.3	-177.6	-3.2	113	Q77 L78	Q77-R81 WeakPolarHBondContact O-CB 3.38Å; Q77-R81 PolarHBondContact O-N 2.96Å; L78-R81 PolarHBondContact O-N 2.93Å
82	L	50.9	Low	43.9	Very low	95 Å²	95	94.6 Å²	94.6	50%	0.497	54%	0.543	S	S	.	.	H	α-helix	trans	-75.9	-38.2	179.4	-73.1	168.4	0	0	0	112.2	F30 L78 R79 G84	F30-L82 HydrophobicContact CE2-CD1 4.23Å; F30-L82 HydrophobicContact CE2-CD2 3.75Å; F30-L82 HydrophobicContact CZ-CD2 3.99Å; L78-L82 HydrophobicContact CD2-CD1 4.39Å; L78-L82 HydrophobicContact CG-CD1 4.04Å; L78-L82 WeakPolarHBondContact O-CB 3.37Å; L78-L82 VanDerWaalsContact O-CG 3.31Å; L78-L82 WeakPolarHBondContact O-CG 3.37Å; L78-L82 PolarHBondContact O-N 2.86Å; R79-L82 PolarHBondContact O-N 3.29Å; L82-G84 PolarHBondContact O-N 3.34Å
83	H	48.4	Very low	43.7	Very low	101 Å²	101	95 Å²	95	47%	0.468	55%	0.549	S	S	.	.	T	Hydrogen-bonded Turn	trans	-100.4	58.3	175.6	-68.2	-89.6	0	0	0	110.9	R79 H85	R79-H83 WeakPolarHBondContact O-CB 3.33Å; R79-H83 PolarHBondContact O-CD2 3.1Å; R79-H83 PolarHBondContact O-N 3.39Å; H83-H85 PolarHBondContact O-N 3.24Å; H83-H85 VanDerWaalsContact O-N 3.13Å
84	G	39.8	Very low	43.8	Very low	49 Å²	49	99.2 Å²	99.2	51%	0.505	56%	0.56	S	S	.	*			trans	-40.8	126.9	167.8	0	0	0	0	0	110	L82	L82-G84 PolarHBondContact O-N 3.34Å
85	H	41.4	Very low	43.7	Very low	194 Å²	194	103.4 Å²	103.4	90%	0.898	58%	0.576	S	S	*	*	S	Bend	trans	84.1	103.2	-178.4	-49.7	-81.2	0	0	0	116.6	H83	H83-H85 PolarHBondContact O-N 3.24Å; H83-H85 VanDerWaalsContact O-N 3.13Å
86	G	41.1	Very low	43.6	Very low	73 Å²	73	107.4 Å²	107.4	75%	0.753	58%	0.584	S	S	*	*	S	Bend	trans	138.7	-23.8	142.7	0	0	0	0	0	118.6
87	V	43.7	Very low	43.4	Very low	116 Å²	116	112 Å²	112	70%	0.703	60%	0.6	S	S	*	*	S	Bend	trans	-107.3	-13.7	-165.8	-165.8	0	0	0	0	114.3
88	H	39.7	Very low	43.3	Very low	88 Å²	88	114 Å²	114	41%	0.407	61%	0.61	S	S	.	*	T	Hydrogen-bonded Turn	trans	-85.2	-12.7	-177.9	-105.7	-74.9	0	0	0	115.7	A80 G90	A80-H88 WeakPolarHBondContact CB-CD2 3.2Å; A80-H88 WeakPolarHBondContact CB-NE2 3.34Å; H88-G90 VanDerWaalsContact C-N 3.31Å; H88-G90 PolarHBondContact O-N 3.42Å
89	A	38.4	Very low	43.1	Very low	82 Å²	82	114.4 Å²	114.4	68%	0.678	62%	0.624	S	S	*	*	T	Hydrogen-bonded Turn	trans	-75	-19.2	-177.1	0	0	0	0	0	113.6	S93	A89-S93 PolarHBondContact O-OG 3.46Å
90	G	38.3	Very low	42.8	Very low	51 Å²	51	119.2 Å²	119.2	53%	0.526	65%	0.653	S	S	.	*	T	Hydrogen-bonded Turn	trans	-94.3	-22.1	-176.1	0	0	0	0	0	115.5	H88	H88-G90 VanDerWaalsContact C-N 3.31Å; H88-G90 PolarHBondContact O-N 3.42Å
91	L	39.4	Very low	42.5	Very low	108 Å²	108	123.3 Å²	123.3	57%	0.565	67%	0.67	S	S	*	*	T	Hydrogen-bonded Turn	trans	-98.9	-13.3	-175.2	-84.9	160.2	0	0	0	113.5
92	Q	36.1	Very low	42.1	Very low	118 Å²	118	118.1 Å²	118.1	55%	0.551	66%	0.661	S	S	*	*	S	Bend	trans	-82.4	-31.2	175.2	-121.7	162.4	-35.4	0	0	111.7	E94 L95 E96	Q92-E94 PolarHBondContact O-N 3.37Å; Q92-L95 PolarHBondContact O-N 3.49Å; Q92-E96 PolarHBondContact O-N 3.48Å
93	S	39.4	Very low	41.6	Very low	77 Å²	77	119.4 Å²	119.4	54%	0.538	67%	0.671	S	S	.	*	H	α-helix	trans	-70.9	-27.4	178.6	-53.8	0	0	0	0	113.7	A89	A89-S93 PolarHBondContact O-OG 3.46Å
94	E	43.4	Very low	41.2	Very low	139 Å²	139	120.5 Å²	120.5	65%	0.65	68%	0.682	S	S	*	*	H	α-helix	trans	-82.5	-12.2	177	-67.4	-169	137.4	0	0	113.4	Q92	Q92-E94 PolarHBondContact O-N 3.37Å
95	L	42.4	Very low	41.3	Very low	129 Å²	129	124.9 Å²	124.9	68%	0.675	69%	0.694	S	S	*	*	H	α-helix	trans	-97.8	-13.4	177.9	-75.7	169	0	0	0	113.5	Q92	Q92-L95 PolarHBondContact O-N 3.49Å
96	E	42.7	Very low	41.3	Very low	146 Å²	146	120.3 Å²	120.3	68%	0.682	68%	0.68	S	S	*	*	H	α-helix	trans	-89.8	-17.5	174.4	-77.4	177.3	163.6	0	0	112.7	Q92	Q92-E96 PolarHBondContact O-N 3.48Å
97	E	43.9	Very low	41.3	Very low	168 Å²	168	123.7 Å²	123.7	79%	0.785	68%	0.675	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.3	-14.1	178.8	-157.2	173.5	178.7	0	0	113.6
98	E	44.6	Very low	41.1	Very low	175 Å²	175	124.3 Å²	124.3	82%	0.818	67%	0.673	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93.7	5	173.4	-75.3	-163.3	153.9	0	0	113.7
99	A	45.8	Very low	41.3	Very low	84 Å²	84	127.3 Å²	127.3	69%	0.694	70%	0.695	S	S	*	*			trans	-113.7	5.4	-174.5	0	0	0	0	0	115.4
100	E	40.9	Very low	41.5	Very low	251 Å²	251	131.5 Å²	131.5	100%	1.173	70%	0.696	S	S	*	*			trans	-109.5	0	169.9	-80.8	-172.5	155.8	0	0	112

Retrieved 100 of 100 residues in 285.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).