A0A077ZKT2_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZKT2, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 144 aa.

						>A0A077ZKT2_TRITR|A0A077ZKT2
MAWLHMRKAYSLPYMCSRDVGVIVRAPSLPVSSSAASYDKGQLPRRRPAPYVPTFSDKCLHMSLRVRDSFRALKRYSLLWSIAGMAVLFFGSYTLYARWKYPDQPINLYQWRTLEKDDKLTPEMINKSKKLDAFVERRKQIGID
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	48.2	Very low	51.7	Low	200 Å²	200	121 Å²	121	99%	0.985	57%	0.572	S	S	*	*				0	-27.1	0	-82.6	-176.7	174.2	0	0	115	W3 L4 H5	M1-W3 VanDerWaalsContact C-N 3.29Å; M1-W3 PolarHBondContact O-N 3.34Å; M1-L4 PolarHBondContact O-N 3.09Å; M1-H5 PolarHBondContact O-CD2 3.23Å
2	A	47.8	Very low	51.1	Low	51 Å²	51	120.1 Å²	120.1	42%	0.421	57%	0.572	S	S	.	*	H	α-helix	trans	-58	-33.4	-179.1	0	0	0	0	0	115.1	L4 H5 M6 V24	A2-L4 VanDerWaalsContact C-N 3.33Å; A2-L4 PolarHBondContact O-N 3.24Å; A2-H5 PolarHBondContact O-N 3.25Å; A2-M6 PolarHBondContact O-N 3.18Å; A2-V24 HydrophobicContact CB-CG1 4.37Å
3	W	47.3	Very low	50.6	Low	183 Å²	183	114.2 Å²	114.2	69%	0.693	55%	0.549	S	S	*	.	H	α-helix	trans	-64.7	-34.4	178.9	-167.1	80.7	0	0	0	113.4	M1 R7	M1-W3 VanDerWaalsContact C-N 3.29Å; M1-W3 PolarHBondContact O-N 3.34Å; W3-R7 WeakPolarHBondContact O-CB 3.24Å; W3-R7 PolarHBondContact O-N 3.27Å
4	L	52.7	Low	50.3	Low	112 Å²	112	117.3 Å²	117.3	59%	0.586	55%	0.554	S	S	*	*	H	α-helix	trans	-70.2	-34.8	175.5	-100	146.2	0	0	0	112.2	M1 A2 R7 K8	M1-L4 PolarHBondContact O-N 3.09Å; A2-L4 VanDerWaalsContact C-N 3.33Å; A2-L4 PolarHBondContact O-N 3.24Å; L4-R7 PolarHBondContact O-N 3.32Å; L4-K8 PolarHBondContact O-N 2.99Å; L4-K8 VanDerWaalsContact O-N 3.11Å
5	H	52.6	Low	49.8	Very low	123 Å²	123	120.9 Å²	120.9	57%	0.569	57%	0.574	S	S	*	*	H	α-helix	trans	-70.5	-40.5	175.4	-76.7	-78.2	0	0	0	112.2	M1 A2 R7 K8 A9	M1-H5 PolarHBondContact O-CD2 3.23Å; A2-H5 PolarHBondContact O-N 3.25Å; H5-R7 VanDerWaalsContact C-N 3.31Å; H5-R7 PolarHBondContact O-N 3.33Å; H5-K8 PolarHBondContact O-N 3.28Å; H5-A9 VanDerWaalsContact O-CB 3.28Å; H5-A9 WeakPolarHBondContact O-CB 3.36Å; H5-A9 PolarHBondContact O-N 3.5Å
6	M	54.7	Low	49.2	Very low	101 Å²	101	119.1 Å²	119.1	50%	0.498	58%	0.577	S	S	.	*	H	α-helix	trans	-62.1	-40.5	171.4	-75.9	-163.5	175.2	0	0	111.5	A2 K8 A9 Y10 V24	A2-M6 PolarHBondContact O-N 3.18Å; M6-K8 PolarHBondContact O-N 3Å; M6-A9 WeakPolarHBondContact O-CB 3.32Å; M6-A9 PolarHBondContact O-N 3.5Å; M6-Y10 VanDerWaalsContact O-CD2 3.32Å; M6-Y10 WeakPolarHBondContact O-CD2 3.38Å; M6-Y10 PolarHBondContact O-N 3.35Å; M6-V24 HydrophobicContact CE-CG2 4.21Å; M6-V24 HydrophobicContact CG-CG2 4.37Å
7	R	54.3	Low	48.7	Very low	154 Å²	154	119.5 Å²	119.5	58%	0.581	60%	0.595	S	S	*	*	H	α-helix	trans	-64.6	-37.6	179.6	-158.8	174.1	-176.4	-176.9	-0.3	113.3	W3 L4 H5	W3-R7 WeakPolarHBondContact O-CB 3.24Å; W3-R7 PolarHBondContact O-N 3.27Å; L4-R7 PolarHBondContact O-N 3.32Å; H5-R7 VanDerWaalsContact C-N 3.31Å; H5-R7 PolarHBondContact O-N 3.33Å
8	K	51.8	Low	48.1	Very low	147 Å²	147	123.8 Å²	123.8	64%	0.639	60%	0.603	S	S	*	*	H	α-helix	trans	-70.6	-40.5	172.2	-88.9	-177.9	175.6	179.9	0	112.3	L4 H5 M6 Y10 S11 L12	L4-K8 PolarHBondContact O-N 2.99Å; L4-K8 VanDerWaalsContact O-N 3.11Å; H5-K8 PolarHBondContact O-N 3.28Å; M6-K8 PolarHBondContact O-N 3Å; K8-Y10 VanDerWaalsContact C-N 3.34Å; K8-Y10 PolarHBondContact O-N 3Å; K8-S11 PolarHBondContact O-N 3.38Å; K8-S11 PolarHBondContact O-OG 3.17Å; K8-L12 PolarHBondContact O-N 2.94Å
9	A	53.9	Low	47.9	Very low	19 Å²	19	126.7 Å²	126.7	16%	0.157	62%	0.622	C	S	.	*	H	α-helix	trans	-60	-40.4	178	0	0	0	0	0	113.3	H5 M6 S11 P13 V22	H5-A9 VanDerWaalsContact O-CB 3.28Å; H5-A9 WeakPolarHBondContact O-CB 3.36Å; H5-A9 PolarHBondContact O-N 3.5Å; M6-A9 WeakPolarHBondContact O-CB 3.32Å; M6-A9 PolarHBondContact O-N 3.5Å; A9-S11 VanDerWaalsContact C-N 3.32Å; A9-S11 PolarHBondContact O-N 2.81Å; A9-P13 WeakPolarHBondContact O-CD 3.44Å; A9-V22 HydrophobicContact CB-CB 4Å; A9-V22 HydrophobicContact CB-CG1 4.11Å; A9-V22 HydrophobicContact CB-CG2 3.41Å; A9-V22 VanDerWaalsContact CB-CG2 3.41Å
10	Y	52.7	Low	47.8	Very low	172 Å²	172	124.4 Å²	124.4	68%	0.675	62%	0.615	S	S	*	*	H	α-helix	trans	-70.3	-25.3	176.9	-89.6	-82.1	0	0	0	113.6	M6 K8 Y14	M6-Y10 VanDerWaalsContact O-CD2 3.32Å; M6-Y10 WeakPolarHBondContact O-CD2 3.38Å; M6-Y10 PolarHBondContact O-N 3.35Å; K8-Y10 VanDerWaalsContact C-N 3.34Å; K8-Y10 PolarHBondContact O-N 3Å; Y10-Y14 WeakPolarHBondContact O-CD2 3.35Å
11	S	53	Low	47.6	Very low	69 Å²	69	122 Å²	122	48%	0.483	62%	0.622	S	S	.	*	H	α-helix	trans	-84.2	-21	-179.5	61.7	0	0	0	0	114.8	K8 A9	K8-S11 PolarHBondContact O-N 3.38Å; K8-S11 PolarHBondContact O-OG 3.17Å; A9-S11 VanDerWaalsContact C-N 3.32Å; A9-S11 PolarHBondContact O-N 2.81Å
12	L	43.6	Very low	47.6	Very low	110 Å²	110	116 Å²	116	58%	0.576	60%	0.597	S	S	*	*	S	Bend	trans	-76	-40	-175.2	-92	153.2	0	0	0	115.9	K8 Y14 M15	K8-L12 PolarHBondContact O-N 2.94Å; L12-Y14 PolarHBondContact O-N 2.97Å; L12-M15 PolarHBondContact O-N 3.46Å
13	P	45.6	Very low	47.6	Very low	43 Å²	43	121.4 Å²	121.4	28%	0.279	62%	0.617	S	S	.	*	G	3₁₀ helix	trans	-69.8	-21.3	180	25	-31.9	0	0	0	112.8	A9 M15 C16 S17	A9-P13 WeakPolarHBondContact O-CD 3.44Å; P13-M15 VanDerWaalsContact C-N 3.26Å; P13-M15 PolarHBondContact O-N 3.26Å; P13-C16 PolarHBondContact O-N 3.18Å; P13-S17 PolarHBondContact O-N 2.78Å
14	Y	45.7	Very low	47.5	Very low	158 Å²	158	115.5 Å²	115.5	62%	0.62	60%	0.601	S	S	*	*	G	3₁₀ helix	trans	-72.6	-11.4	178.3	-85.6	-80.6	0	0	0	114.7	Y10 L12	Y10-Y14 WeakPolarHBondContact O-CD2 3.35Å; L12-Y14 PolarHBondContact O-N 2.97Å
15	M	42.7	Very low	46.9	Very low	172 Å²	172	121.1 Å²	121.1	85%	0.847	61%	0.614	S	S	*	*	G	3₁₀ helix	trans	-104.3	-9.8	175.5	-66.2	-147.2	125.9	0	0	114.2	L12 P13	L12-M15 PolarHBondContact O-N 3.46Å; P13-M15 VanDerWaalsContact C-N 3.26Å; P13-M15 PolarHBondContact O-N 3.26Å
16	C	40.9	Very low	46.3	Very low	92 Å²	92	118.9 Å²	118.9	62%	0.622	62%	0.617	S	S	*	*	T	Hydrogen-bonded Turn	trans	-142.1	7.9	-169.9	-79.1	0	0	0	0	116.8	P13 R18	P13-C16 PolarHBondContact O-N 3.18Å; C16-R18 PolarHBondContact O-N 2.9Å
17	S	40.3	Very low	45.5	Very low	126 Å²	126	120.2 Å²	120.2	88%	0.881	63%	0.633	S	S	*	*			trans	43.4	45.9	178.4	-61.6	0	0	0	0	113.4	P13	P13-S17 PolarHBondContact O-N 2.78Å
18	R	38.4	Very low	44.8	Very low	196 Å²	196	117.7 Å²	117.7	74%	0.74	64%	0.639	S	S	*	*			trans	-125.2	134.5	174.4	-82	-175.2	174.4	177.7	-1.1	109.2	C16 V20	C16-R18 PolarHBondContact O-N 2.9Å; R18-V20 PolarHBondContact O-N 3.05Å
19	D	42.9	Very low	44.3	Very low	179 Å²	179	118.1 Å²	118.1	96%	0.957	65%	0.647	S	S	*	*			trans	-67	102.6	172.6	-75.1	-32.4	0	0	0	109.4
20	V	46.9	Very low	43.4	Very low	80 Å²	80	123 Å²	123	49%	0.485	68%	0.678	S	S	.	*			trans	-99.4	101	174.9	-176	0	0	0	0	108.5	R18 V22	R18-V20 PolarHBondContact O-N 3.05Å; V20-V22 HydrophobicContact CG1-CG2 3.93Å
21	G	43.3	Very low	42.5	Very low	75 Å²	75	121.7 Å²	121.7	77%	0.773	69%	0.687	S	S	*	*			trans	-75.7	119.2	166.7	0	0	0	0	0	110.4
22	V	48.3	Very low	41.9	Very low	75 Å²	75	122.8 Å²	122.8	46%	0.455	70%	0.695	S	S	.	*			trans	-103.2	107.2	175.8	178.8	0	0	0	0	110.1	A9 V20 V24	A9-V22 HydrophobicContact CB-CB 4Å; A9-V22 HydrophobicContact CB-CG1 4.11Å; A9-V22 HydrophobicContact CB-CG2 3.41Å; A9-V22 VanDerWaalsContact CB-CG2 3.41Å; V20-V22 HydrophobicContact CG1-CG2 3.93Å; V22-V24 HydrophobicContact CG1-CG2 3.93Å; V22-V24 PolarHBondContact O-N 3.04Å
23	I	47.4	Very low	41.4	Very low	163 Å²	163	123.1 Å²	123.1	84%	0.836	71%	0.707	S	S	*	*			trans	-84.9	101.9	171.3	-57.7	174.5	0	0	0	107.6	R25	I23-R25 PolarHBondContact O-N 2.85Å
24	V	46.3	Very low	41	Very low	59 Å²	59	124.9 Å²	124.9	36%	0.358	72%	0.72	S	S	.	*			trans	-83.1	108.8	172.2	-176.8	0	0	0	0	108.4	A2 M6 V22 A26	A2-V24 HydrophobicContact CB-CG1 4.37Å; M6-V24 HydrophobicContact CE-CG2 4.21Å; M6-V24 HydrophobicContact CG-CG2 4.37Å; V22-V24 HydrophobicContact CG1-CG2 3.93Å; V22-V24 PolarHBondContact O-N 3.04Å; V24-A26 PolarHBondContact O-N 3.49Å
25	R	39.9	Very low	40.6	Very low	231 Å²	231	123 Å²	123	87%	0.872	74%	0.737	S	S	*	*			trans	-73	113.9	164.8	-82.6	-175.2	175.7	178	-1	108.6	I23	I23-R25 PolarHBondContact O-N 2.85Å
26	A	40.2	Very low	40.2	Very low	75 Å²	75	117.3 Å²	117.3	62%	0.62	72%	0.717	S	S	*	*			trans	-66.9	134.6	171.1	0	0	0	0	0	110	V24 S28	V24-A26 PolarHBondContact O-N 3.49Å; A26-S28 VanDerWaalsContact C-N 3.31Å; A26-S28 PolarHBondContact O-N 2.99Å; A26-S28 VanDerWaalsContact O-N 3.08Å
27	P	37.3	Very low	39.9	Very low	129 Å²	129	118.7 Å²	118.7	84%	0.838	73%	0.728	S	S	*	*	S	Bend	trans	-84.9	77.3	174.8	34.1	-29.7	0	0	0	109.3
28	S	39.1	Very low	39.8	Very low	102 Å²	102	122.7 Å²	122.7	71%	0.713	73%	0.725	S	S	*	*			trans	-176.9	69.1	157.1	60.9	0	0	0	0	110.2	A26	A26-S28 VanDerWaalsContact C-N 3.31Å; A26-S28 PolarHBondContact O-N 2.99Å; A26-S28 VanDerWaalsContact O-N 3.08Å
29	L	41.1	Very low	39.9	Very low	155 Å²	155	120.7 Å²	120.7	81%	0.812	73%	0.729	S	S	*	*	S	Bend	trans	-126.4	125.4	150.2	-72.9	171.9	0	0	0	104.9	V31	L29-V31 PolarHBondContact O-N 3Å
30	P	35	Very low	39.5	Very low	123 Å²	123	121.4 Å²	121.4	80%	0.799	72%	0.724	S	S	*	*			trans	-58.6	130.6	176	25.6	-31	0	0	0	107.5	S32	P30-S32 PolarHBondContact O-N 3.09Å
31	V	35.4	Very low	39.3	Very low	144 Å²	144	121.1 Å²	121.1	87%	0.873	74%	0.737	S	S	*	*			trans	-64.3	90.1	171	-179.5	0	0	0	0	106.2	L29 S33	L29-V31 PolarHBondContact O-N 3Å; V31-S33 PolarHBondContact O-N 3.31Å
32	S	39	Very low	39.2	Very low	91 Å²	91	127.1 Å²	127.1	64%	0.636	75%	0.745	S	S	*	*			trans	-71.9	107.5	164.1	172.2	0	0	0	0	107	P30 S34	P30-S32 PolarHBondContact O-N 3.09Å; S32-S34 PolarHBondContact O-N 3.31Å
33	S	33.3	Very low	39.3	Very low	118 Å²	118	131.1 Å²	131.1	83%	0.825	76%	0.763	S	S	*	*			trans	-65.3	80.2	165.6	51.9	0	0	0	0	109.6	V31	V31-S33 PolarHBondContact O-N 3.31Å
34	S	37	Very low	39.4	Very low	79 Å²	79	128.7 Å²	128.7	55%	0.552	76%	0.758	S	S	*	*			trans	-152.3	87.6	160	64.8	0	0	0	0	109.5	S32 A36	S32-S34 PolarHBondContact O-N 3.31Å; S34-A36 PolarHBondContact O-N 3.05Å
35	A	37.3	Very low	39.7	Very low	118 Å²	118	137.7 Å²	137.7	98%	0.975	79%	0.785	S	S	*	*			trans	-68.5	69	148.3	0	0	0	0	0	107.5
36	A	34.5	Very low	40.4	Very low	54 Å²	54	138.2 Å²	138.2	45%	0.446	79%	0.787	S	S	.	*			trans	-95.8	110.4	167.3	0	0	0	0	0	106.5	S34 Y38	S34-A36 PolarHBondContact O-N 3.05Å; A36-Y38 HydrophobicContact CB-CD2 4.18Å; A36-Y38 HydrophobicContact CB-CE2 4.21Å; A36-Y38 PolarHBondContact O-N 2.92Å
37	S	35.2	Very low	41.3	Very low	120 Å²	120	145.6 Å²	145.6	84%	0.839	80%	0.799	S	S	*	*			trans	-50.2	104.9	162	49.3	0	0	0	0	109.2
38	Y	37.8	Very low	42.4	Very low	211 Å²	211	145.2 Å²	145.2	83%	0.827	80%	0.797	S	S	*	*			trans	-99.7	93.3	166.9	-97.8	-89.7	0	0	0	108.9	A36	A36-Y38 HydrophobicContact CB-CD2 4.18Å; A36-Y38 HydrophobicContact CB-CE2 4.21Å; A36-Y38 PolarHBondContact O-N 2.92Å
39	D	40.3	Very low	43.5	Very low	153 Å²	153	144.6 Å²	144.6	82%	0.818	80%	0.798	S	S	*	*			trans	-76.6	111.4	152.2	-172	20.9	0	0	0	107.4
40	K	35.2	Very low	44.4	Very low	195 Å²	195	142.6 Å²	142.6	85%	0.848	79%	0.794	S	S	*	*	S	Bend	trans	163.9	105	160	-93.6	168.2	-173.6	-175.3	0	109.4
41	G	41.5	Very low	46.1	Very low	74 Å²	74	144.7 Å²	144.7	76%	0.763	79%	0.787	S	S	*	*			trans	85.4	70.1	164.8	0	0	0	0	0	115.7	L43	G41-L43 PolarHBondContact O-N 2.91Å
42	Q	42	Very low	47.9	Very low	201 Å²	201	143.4 Å²	143.4	94%	0.939	78%	0.779	S	S	*	*			trans	-63.8	94.8	169	-81.2	-179.3	-3.9	0	0	111
43	L	50.2	Low	49.2	Very low	158 Å²	158	141.6 Å²	141.6	83%	0.827	77%	0.765	S	S	*	*			trans	-64.2	131.5	151.8	-84	156	0	0	0	107.6	G41 R45	G41-L43 PolarHBondContact O-N 2.91Å; L43-R45 PolarHBondContact O-N 3.46Å; L43-R45 VanDerWaalsContact O-N 3.16Å
44	P	49.2	Very low	51.3	Low	112 Å²	112	139.4 Å²	139.4	73%	0.727	75%	0.747	S	S	*	*			trans	-60.6	126.4	-178.4	24.8	-32.1	0	0	0	108.6	R46	P44-R46 VanDerWaalsContact C-N 3.32Å; P44-R46 PolarHBondContact O-N 2.87Å
45	R	53.5	Low	53.4	Low	249 Å²	249	143.6 Å²	143.6	94%	0.94	76%	0.755	S	S	*	*			trans	-56.5	93.2	178.1	-157.9	176.6	-171.6	165.7	2.4	108.6	L43 R47	L43-R45 PolarHBondContact O-N 3.46Å; L43-R45 VanDerWaalsContact O-N 3.16Å; R45-R47 PolarHBondContact O-N 3.41Å; R45-R47 VanDerWaalsContact O-N 3.09Å
46	R	54.1	Low	55.2	Low	242 Å²	242	141.6 Å²	141.6	91%	0.913	74%	0.735	S	S	*	*			trans	-61.3	113.4	-179	-126	-179.6	-176.7	-178.2	1.2	107.4	P44	P44-R46 VanDerWaalsContact C-N 3.32Å; P44-R46 PolarHBondContact O-N 2.87Å
47	R	60	Low	57.1	Low	230 Å²	230	141.8 Å²	141.8	87%	0.868	73%	0.728	S	S	*	*	P	Polyproline II helix	trans	-56.5	135.3	172.2	-69.3	-176.6	-171.2	177.2	3.3	107.6	R45 A49	R45-R47 PolarHBondContact O-N 3.41Å; R45-R47 VanDerWaalsContact O-N 3.09Å; R47-A49 PolarHBondContact O-N 3.35Å
48	P	60.3	Low	59	Low	121 Å²	121	141.8 Å²	141.8	79%	0.786	71%	0.713	S	S	*	*	P	Polyproline II helix	trans	-54.8	133.8	172.5	23.4	-31.4	0	0	0	108.1
49	A	60.6	Low	60.9	Low	89 Å²	89	134.6 Å²	134.6	74%	0.736	69%	0.693	S	S	*	*	P	Polyproline II helix	trans	-55.7	139.4	-179.9	0	0	0	0	0	109.3	R47 Y51	R47-A49 PolarHBondContact O-N 3.35Å; A49-Y51 PolarHBondContact O-N 3.45Å
50	P	61.8	Low	62.8	Low	113 Å²	113	132.5 Å²	132.5	73%	0.734	68%	0.681	S	S	*	*	P	Polyproline II helix	trans	-55.8	132.8	177.2	23.5	-31.9	0	0	0	108.9	V52	P50-V52 PolarHBondContact O-N 2.98Å
51	Y	69.7	Low	64.8	Low	166 Å²	166	126.8 Å²	126.8	65%	0.651	66%	0.657	S	S	*	*			trans	-59.2	114.4	177.5	171.7	-103.1	0	0	0	109.1	A49 P53 D57	A49-Y51 PolarHBondContact O-N 3.45Å; Y51-P53 HydrophobicContact CD1-CB 4.45Å; Y51-P53 HydrophobicContact CE1-CB 3.79Å; Y51-P53 VanDerWaalsContact O-CD 3.31Å; Y51-P53 WeakPolarHBondContact O-CD 3.49Å; Y51-D57 WeakPolarHBondContact OH-CB 3.34Å; Y51-D57 PolarHBondContact OH-OD1 3.24Å; Y51-D57 PolarHBondContact OH-OD2 3.24Å
52	V	73.6	Confident	66.5	Low	117 Å²	117	128.6 Å²	128.6	71%	0.709	65%	0.647	S	S	*	*			trans	-93.9	105.3	174.9	-176.9	0	0	0	0	106.8	P50 T54	P50-V52 PolarHBondContact O-N 2.98Å; V52-T54 PolarHBondContact O-N 2.94Å
53	P	66.6	Low	68.4	Low	54 Å²	54	122.3 Å²	122.3	35%	0.351	63%	0.625	S	S	.	*			trans	-62.9	126.8	-177.3	23.2	-31.6	0	0	0	109.7	Y51 D57 K58	Y51-P53 HydrophobicContact CD1-CB 4.45Å; Y51-P53 HydrophobicContact CE1-CB 3.79Å; Y51-P53 VanDerWaalsContact O-CD 3.31Å; Y51-P53 WeakPolarHBondContact O-CD 3.49Å; P53-D57 HydrophobicContact CB-CB 4.15Å; P53-K58 HydrophobicContact CB-CG 4.3Å
54	T	77.4	Confident	69.9	Low	71 Å²	71	118.8 Å²	118.8	44%	0.436	61%	0.607	S	S	.	*			trans	-67.1	162.8	172.3	63.7	0	0	0	0	109.8	V52 S56 D57 K58	V52-T54 PolarHBondContact O-N 2.94Å; T54-S56 PolarHBondContact O-N 2.98Å; T54-S56 PolarHBondContact OG1-OG 3.01Å; T54-D57 WeakPolarHBondContact CB-OD2 3.33Å; T54-D57 PolarHBondContact N-OD2 3.13Å; T54-D57 WeakPolarHBondContact O-CB 3.48Å; T54-D57 PolarHBondContact O-N 3.5Å; T54-D57 PolarHBondContact OG1-N 2.86Å; T54-D57 PolarHBondContact OG1-OD2 3.45Å; T54-K58 PolarHBondContact O-N 3.32Å; T54-K58 VanDerWaalsContact O-N 3.16Å
55	F	80	Confident	71.4	Confident	167 Å²	167	119.4 Å²	119.4	73%	0.732	60%	0.595	S	S	*	*	H	α-helix	trans	-56.6	-38.1	176.1	-178.1	-99.3	0	0	0	111.8	D57 K58 C59	F55-D57 VanDerWaalsContact C-N 3.32Å; F55-D57 PolarHBondContact O-N 3.04Å; F55-K58 PolarHBondContact O-N 3.46Å; F55-C59 VanDerWaalsContact CE1-SG 3.51Å; F55-C59 PolarHBondContact O-N 3.34Å; F55-C59 PolarHBondContact O-SG 2.86Å
56	S	75.4	Confident	72.8	Confident	77 Å²	77	111.2 Å²	111.2	54%	0.538	57%	0.572	S	S	.	*	H	α-helix	trans	-58.8	-40.6	173.5	34	0	0	0	0	112.8	T54 K58 C59 L60	T54-S56 PolarHBondContact O-N 2.98Å; T54-S56 PolarHBondContact OG1-OG 3.01Å; S56-K58 PolarHBondContact O-N 3.22Å; S56-C59 PolarHBondContact O-N 3.41Å; S56-L60 WeakPolarHBondContact O-CB 3.46Å; S56-L60 PolarHBondContact O-N 3.3Å
57	D	75	Confident	74.2	Confident	57 Å²	57	106.8 Å²	106.8	31%	0.305	56%	0.556	S	S	.	*	H	α-helix	trans	-67.1	-38.9	179.3	-60.7	-43.4	0	0	0	111.4	Y51 P53 T54 F55 L60 H61	Y51-D57 WeakPolarHBondContact OH-CB 3.34Å; Y51-D57 PolarHBondContact OH-OD1 3.24Å; Y51-D57 PolarHBondContact OH-OD2 3.24Å; P53-D57 HydrophobicContact CB-CB 4.15Å; T54-D57 WeakPolarHBondContact CB-OD2 3.33Å; T54-D57 PolarHBondContact N-OD2 3.13Å; T54-D57 WeakPolarHBondContact O-CB 3.48Å; T54-D57 PolarHBondContact O-N 3.5Å; T54-D57 PolarHBondContact OG1-N 2.86Å; T54-D57 PolarHBondContact OG1-OD2 3.45Å; F55-D57 VanDerWaalsContact C-N 3.32Å; F55-D57 PolarHBondContact O-N 3.04Å; D57-L60 PolarHBondContact O-N 3.29Å; D57-H61 VanDerWaalsContact O-CB 3.31Å; D57-H61 WeakPolarHBondContact O-CB 3.48Å; D57-H61 PolarHBondContact O-N 2.84Å
58	K	75	Confident	75.2	Confident	120 Å²	120	99.8 Å²	99.8	52%	0.522	54%	0.535	S	S	.	.	H	α-helix	trans	-63.7	-44.9	174.8	-64.9	-179.8	-176.3	178.4	0	111.6	P53 T54 F55 S56 H61 M62	P53-K58 HydrophobicContact CB-CG 4.3Å; T54-K58 PolarHBondContact O-N 3.32Å; T54-K58 VanDerWaalsContact O-N 3.16Å; F55-K58 PolarHBondContact O-N 3.46Å; S56-K58 PolarHBondContact O-N 3.22Å; K58-H61 PolarHBondContact O-N 3.17Å; K58-M62 WeakPolarHBondContact O-CG 3.37Å; K58-M62 PolarHBondContact O-N 3.17Å
59	C	77.4	Confident	76.2	Confident	61 Å²	61	97.7 Å²	97.7	41%	0.412	52%	0.524	S	S	.	.	H	α-helix	trans	-63.5	-42.7	177.1	-73.3	0	0	0	0	112.2	F55 S56 H61 M62 S63	F55-C59 VanDerWaalsContact CE1-SG 3.51Å; F55-C59 PolarHBondContact O-N 3.34Å; F55-C59 PolarHBondContact O-SG 2.86Å; S56-C59 PolarHBondContact O-N 3.41Å; C59-H61 VanDerWaalsContact C-N 3.33Å; C59-H61 PolarHBondContact O-N 3.07Å; C59-M62 PolarHBondContact O-N 3.05Å; C59-S63 PolarHBondContact O-N 3.49Å; C59-S63 PolarHBondContact O-OG 3.5Å
60	L	80.4	Confident	77.2	Confident	108 Å²	108	100 Å²	100	57%	0.565	52%	0.517	S	S	*	.	H	α-helix	trans	-65.2	-40.1	177.1	-162	146.1	0	0	0	110.9	S56 D57 M62 S63 L64	S56-L60 WeakPolarHBondContact O-CB 3.46Å; S56-L60 PolarHBondContact O-N 3.3Å; D57-L60 PolarHBondContact O-N 3.29Å; L60-M62 PolarHBondContact O-N 3.19Å; L60-S63 WeakPolarHBondContact CA-OG 3.44Å; L60-S63 PolarHBondContact O-N 2.93Å; L60-S63 PolarHBondContact O-OG 2.85Å; L60-L64 HydrophobicContact CD2-CD1 3.71Å; L60-L64 HydrophobicContact CD2-CG 4.35Å; L60-L64 WeakPolarHBondContact O-CG 3.35Å; L60-L64 PolarHBondContact O-N 3.38Å
61	H	77.8	Confident	78.1	Confident	76 Å²	76	100.3 Å²	100.3	35%	0.352	50%	0.504	S	S	.	.	H	α-helix	trans	-63.6	-39.9	174.4	-163	-47.9	0	0	0	112.5	D57 K58 C59 R65	D57-H61 VanDerWaalsContact O-CB 3.31Å; D57-H61 WeakPolarHBondContact O-CB 3.48Å; D57-H61 PolarHBondContact O-N 2.84Å; K58-H61 PolarHBondContact O-N 3.17Å; C59-H61 VanDerWaalsContact C-N 3.33Å; C59-H61 PolarHBondContact O-N 3.07Å; H61-R65 PolarHBondContact CE1-NE 3.41Å; H61-R65 PolarHBondContact CE1-NH2 3.43Å; H61-R65 PolarHBondContact ND1-NE 2.93Å; H61-R65 WeakPolarHBondContact O-CG 3.41Å; H61-R65 PolarHBondContact O-N 3.34Å; H61-R65 VanDerWaalsContact O-N 3.1Å
62	M	76.9	Confident	78.4	Confident	112 Å²	112	94.6 Å²	94.6	55%	0.552	49%	0.491	S	S	*	.	H	α-helix	trans	-67.2	-43	176.4	-74.8	-57.7	-162.7	0	0	112	K58 C59 L60 L64 R65 V66	K58-M62 WeakPolarHBondContact O-CG 3.37Å; K58-M62 PolarHBondContact O-N 3.17Å; C59-M62 PolarHBondContact O-N 3.05Å; L60-M62 PolarHBondContact O-N 3.19Å; M62-L64 VanDerWaalsContact C-N 3.3Å; M62-L64 PolarHBondContact O-N 2.95Å; M62-R65 PolarHBondContact O-N 3.47Å; M62-R65 VanDerWaalsContact O-N 3.15Å; M62-V66 WeakPolarHBondContact O-CG2 3.39Å; M62-V66 PolarHBondContact O-N 2.89Å
63	S	81.1	Confident	78.6	Confident	68 Å²	68	94.5 Å²	94.5	48%	0.476	49%	0.486	S	S	.	.	H	α-helix	trans	-63.2	-35.9	177.4	63	0	0	0	0	112.6	C59 L60 R67	C59-S63 PolarHBondContact O-N 3.49Å; C59-S63 PolarHBondContact O-OG 3.5Å; L60-S63 WeakPolarHBondContact CA-OG 3.44Å; L60-S63 PolarHBondContact O-N 2.93Å; L60-S63 PolarHBondContact O-OG 2.85Å; S63-R67 WeakPolarHBondContact O-CB 3.48Å; S63-R67 PolarHBondContact O-N 3.36Å
64	L	82.4	Confident	79.2	Confident	85 Å²	85	99.6 Å²	99.6	45%	0.445	50%	0.502	S	S	.	.	H	α-helix	trans	-63.1	-45.9	171.6	-77.9	169	0	0	0	112	L60 M62 V66 R67 D68	L60-L64 HydrophobicContact CD2-CD1 3.71Å; L60-L64 HydrophobicContact CD2-CG 4.35Å; L60-L64 WeakPolarHBondContact O-CG 3.35Å; L60-L64 PolarHBondContact O-N 3.38Å; M62-L64 VanDerWaalsContact C-N 3.3Å; M62-L64 PolarHBondContact O-N 2.95Å; L64-V66 PolarHBondContact O-N 3.46Å; L64-R67 PolarHBondContact O-N 3.38Å; L64-D68 PolarHBondContact O-N 2.96Å
65	R	81.3	Confident	79	Confident	124 Å²	124	105.9 Å²	105.9	47%	0.468	52%	0.518	S	S	.	.	H	α-helix	trans	-59.4	-47.8	176.6	-75.1	-178.8	-179.2	175.7	4.8	111.6	H61 M62 R67 D68 S69	H61-R65 PolarHBondContact CE1-NE 3.41Å; H61-R65 PolarHBondContact CE1-NH2 3.43Å; H61-R65 PolarHBondContact ND1-NE 2.93Å; H61-R65 WeakPolarHBondContact O-CG 3.41Å; H61-R65 PolarHBondContact O-N 3.34Å; H61-R65 VanDerWaalsContact O-N 3.1Å; M62-R65 PolarHBondContact O-N 3.47Å; M62-R65 VanDerWaalsContact O-N 3.15Å; R65-R67 VanDerWaalsContact C-N 3.31Å; R65-R67 PolarHBondContact O-N 3.22Å; R65-D68 PolarHBondContact O-N 3.23Å; R65-S69 PolarHBondContact O-N 2.88Å; R65-S69 PolarHBondContact O-OG 3.21Å
66	V	81.3	Confident	78.9	Confident	77 Å²	77	104.4 Å²	104.4	47%	0.467	51%	0.509	S	S	.	.	H	α-helix	trans	-59.4	-44.7	177.8	172.1	0	0	0	0	110.6	M62 L64 D68 S69 F70	M62-V66 WeakPolarHBondContact O-CG2 3.39Å; M62-V66 PolarHBondContact O-N 2.89Å; L64-V66 PolarHBondContact O-N 3.46Å; V66-D68 VanDerWaalsContact C-N 3.34Å; V66-D68 PolarHBondContact O-N 3.21Å; V66-S69 WeakPolarHBondContact O-CB 3.49Å; V66-S69 PolarHBondContact O-N 2.66Å; V66-F70 HydrophobicContact CG1-CD2 3.65Å; V66-F70 HydrophobicContact CG1-CE2 3.54Å; V66-F70 VanDerWaalsContact O-CD2 3.23Å; V66-F70 WeakPolarHBondContact O-CD2 3.33Å; V66-F70 PolarHBondContact O-N 2.89Å
67	R	84.2	Confident	79.2	Confident	150 Å²	150	103.6 Å²	103.6	57%	0.566	50%	0.503	S	S	*	.	H	α-helix	trans	-62	-39.8	178.2	-175.1	177.4	-179.5	173.5	3.1	112.7	S63 L64 R65 F70 R71	S63-R67 WeakPolarHBondContact O-CB 3.48Å; S63-R67 PolarHBondContact O-N 3.36Å; L64-R67 PolarHBondContact O-N 3.38Å; R65-R67 VanDerWaalsContact C-N 3.31Å; R65-R67 PolarHBondContact O-N 3.22Å; R67-F70 PolarHBondContact O-N 3.44Å; R67-R71 PolarHBondContact O-N 2.89Å
68	D	81.6	Confident	79.6	Confident	83 Å²	83	106.2 Å²	106.2	44%	0.444	52%	0.516	S	S	.	.	H	α-helix	trans	-72.2	-35.8	177.5	-74.9	-24.3	0	0	0	112	L64 R65 V66 F70 R71 A72	L64-D68 PolarHBondContact O-N 2.96Å; R65-D68 PolarHBondContact O-N 3.23Å; V66-D68 VanDerWaalsContact C-N 3.34Å; V66-D68 PolarHBondContact O-N 3.21Å; D68-F70 VanDerWaalsContact C-N 3.34Å; D68-F70 PolarHBondContact O-N 2.98Å; D68-R71 PolarHBondContact O-N 3.35Å; D68-R71 IonicContact OD1-CZ 3.9Å; D68-R71 IonicContact OD1-NH1 2.81Å; D68-R71 PolarHBondContact OD1-NH1 3.37Å; D68-A72 PolarHBondContact O-N 3.32Å
69	S	80.8	Confident	80.1	Confident	77 Å²	77	105.8 Å²	105.8	54%	0.538	52%	0.519	S	S	.	.	H	α-helix	trans	-58.8	-44.7	168.8	-55.8	0	0	0	0	111.7	R65 V66 R71 A72 L73	R65-S69 PolarHBondContact O-N 2.88Å; R65-S69 PolarHBondContact O-OG 3.21Å; V66-S69 WeakPolarHBondContact O-CB 3.49Å; V66-S69 PolarHBondContact O-N 2.66Å; S69-R71 VanDerWaalsContact C-N 3.34Å; S69-R71 PolarHBondContact O-N 3.48Å; S69-A72 PolarHBondContact O-N 2.86Å; S69-L73 WeakPolarHBondContact O-CB 3.49Å; S69-L73 PolarHBondContact O-N 2.86Å
70	F	80.8	Confident	80.4	Confident	138 Å²	138	112.1 Å²	112.1	61%	0.605	53%	0.534	S	S	*	.	H	α-helix	trans	-62.9	-38.3	175.1	-87.7	-70.2	0	0	0	112.6	V66 R67 D68 L73 K74	V66-F70 HydrophobicContact CG1-CD2 3.65Å; V66-F70 HydrophobicContact CG1-CE2 3.54Å; V66-F70 VanDerWaalsContact O-CD2 3.23Å; V66-F70 WeakPolarHBondContact O-CD2 3.33Å; V66-F70 PolarHBondContact O-N 2.89Å; R67-F70 PolarHBondContact O-N 3.44Å; D68-F70 VanDerWaalsContact C-N 3.34Å; D68-F70 PolarHBondContact O-N 2.98Å; F70-L73 PolarHBondContact O-N 2.96Å; F70-K74 WeakPolarHBondContact O-CB 3.34Å; F70-K74 PolarHBondContact O-N 3.45Å
71	R	80.9	Confident	80.8	Confident	119 Å²	119	109.7 Å²	109.7	45%	0.449	53%	0.527	S	S	.	.	H	α-helix	trans	-65.5	-41.8	174.2	-79.5	-176.2	-174.7	137.7	-5.3	112.3	R67 D68 S69 K74 R75	R67-R71 PolarHBondContact O-N 2.89Å; D68-R71 PolarHBondContact O-N 3.35Å; D68-R71 IonicContact OD1-CZ 3.9Å; D68-R71 IonicContact OD1-NH1 2.81Å; D68-R71 PolarHBondContact OD1-NH1 3.37Å; S69-R71 VanDerWaalsContact C-N 3.34Å; S69-R71 PolarHBondContact O-N 3.48Å; R71-K74 PolarHBondContact O-N 2.9Å; R71-R75 PolarHBondContact O-N 3.25Å
72	A	76.5	Confident	81.3	Confident	45 Å²	45	111 Å²	111	37%	0.372	54%	0.535	S	S	.	.	H	α-helix	trans	-62.1	-48.4	175.7	0	0	0	0	0	110.2	D68 S69 K74 R75 Y76	D68-A72 PolarHBondContact O-N 3.32Å; S69-A72 PolarHBondContact O-N 2.86Å; A72-K74 VanDerWaalsContact C-N 3.28Å; A72-K74 PolarHBondContact O-N 3.42Å; A72-R75 WeakPolarHBondContact O-CB 3.34Å; A72-R75 PolarHBondContact O-N 2.86Å; A72-Y76 WeakPolarHBondContact O-CD2 3.47Å; A72-Y76 PolarHBondContact O-N 2.87Å
73	L	77.2	Confident	82	Confident	116 Å²	116	108 Å²	108	61%	0.607	53%	0.528	S	S	*	.	H	α-helix	trans	-56	-42.8	176.4	-163	80.4	0	0	0	111.7	S69 F70 R75 Y76 S77	S69-L73 WeakPolarHBondContact O-CB 3.49Å; S69-L73 PolarHBondContact O-N 2.86Å; F70-L73 PolarHBondContact O-N 2.96Å; L73-R75 VanDerWaalsContact C-N 3.28Å; L73-R75 PolarHBondContact O-N 3.47Å; L73-Y76 CarbonylContact O-C 3.58Å; L73-Y76 PolarHBondContact O-N 2.92Å; L73-S77 WeakPolarHBondContact O-CB 3.4Å; L73-S77 PolarHBondContact O-N 2.86Å
74	K	78.7	Confident	82.5	Confident	161 Å²	161	106.4 Å²	106.4	70%	0.7	52%	0.522	S	S	*	.	H	α-helix	trans	-65.2	-27.2	178	-167.1	174.7	-177.8	176.5	0	113.6	F70 R71 A72 S77	F70-K74 WeakPolarHBondContact O-CB 3.34Å; F70-K74 PolarHBondContact O-N 3.45Å; R71-K74 PolarHBondContact O-N 2.9Å; A72-K74 VanDerWaalsContact C-N 3.28Å; A72-K74 PolarHBondContact O-N 3.42Å; K74-S77 PolarHBondContact O-OG 3.45Å
75	R	75	Confident	83	Confident	203 Å²	203	108.4 Å²	108.4	77%	0.766	53%	0.531	S	S	*	.	H	α-helix	trans	-72.1	-41	173.1	-72.4	-179.6	178.1	179.4	-1	111.2	R71 A72 L73	R71-R75 PolarHBondContact O-N 3.25Å; A72-R75 WeakPolarHBondContact O-CB 3.34Å; A72-R75 PolarHBondContact O-N 2.86Å; L73-R75 VanDerWaalsContact C-N 3.28Å; L73-R75 PolarHBondContact O-N 3.47Å
76	Y	78	Confident	83.6	Confident	136 Å²	136	104.3 Å²	104.3	53%	0.533	52%	0.524	S	S	.	.	H	α-helix	trans	-78.7	-22.2	178.4	-64.4	-70.8	0	0	0	113	A72 L73 L78 L79 W80	A72-Y76 WeakPolarHBondContact O-CD2 3.47Å; A72-Y76 PolarHBondContact O-N 2.87Å; L73-Y76 CarbonylContact O-C 3.58Å; L73-Y76 PolarHBondContact O-N 2.92Å; Y76-L78 PolarHBondContact O-N 2.81Å; Y76-L79 HydrophobicContact CD1-CD1 4.07Å; Y76-L79 WeakPolarHBondContact O-CB 3.22Å; Y76-L79 PolarHBondContact O-N 3.49Å; Y76-W80 PolarHBondContact O-N 2.8Å
77	S	81.4	Confident	84.2	Confident	59 Å²	59	105.7 Å²	105.7	41%	0.413	53%	0.532	S	S	.	.	H	α-helix	trans	-59.8	-33.8	-179.4	69.2	0	0	0	0	112.3	L73 K74 W80 S81	L73-S77 WeakPolarHBondContact O-CB 3.4Å; L73-S77 PolarHBondContact O-N 2.86Å; K74-S77 PolarHBondContact O-OG 3.45Å; S77-W80 PolarHBondContact O-N 3.02Å; S77-S81 WeakPolarHBondContact O-CB 3.32Å; S77-S81 PolarHBondContact O-N 3.37Å; S77-S81 PolarHBondContact O-OG 2.85Å
78	L	82.7	Confident	84.7	Confident	113 Å²	113	104.3 Å²	104.3	59%	0.592	54%	0.535	S	S	*	.	H	α-helix	trans	-65.1	-45.9	174.7	-113.6	159.5	0	0	0	111.2	Y76 W80 S81 I82	Y76-L78 PolarHBondContact O-N 2.81Å; L78-W80 PolarHBondContact O-N 3.05Å; L78-S81 WeakPolarHBondContact CA-OG 3.5Å; L78-S81 PolarHBondContact O-N 2.88Å; L78-S81 PolarHBondContact O-OG 3.33Å; L78-I82 HydrophobicContact CD2-CD1 4.35Å; L78-I82 WeakPolarHBondContact O-CG1 3.36Å; L78-I82 PolarHBondContact O-N 3.44Å
79	L	85.1	Confident	85.3	Confident	110 Å²	110	106.6 Å²	106.6	58%	0.576	54%	0.541	S	S	*	.	H	α-helix	trans	-62.8	-43.6	176.1	-69.6	170.5	0	0	0	111.7	Y76 S81 I82 A83	Y76-L79 HydrophobicContact CD1-CD1 4.07Å; Y76-L79 WeakPolarHBondContact O-CB 3.22Å; Y76-L79 PolarHBondContact O-N 3.49Å; L79-S81 VanDerWaalsContact C-N 3.31Å; L79-S81 PolarHBondContact O-N 2.95Å; L79-I82 PolarHBondContact O-N 2.66Å; L79-A83 WeakPolarHBondContact O-CB 3.39Å; L79-A83 PolarHBondContact O-N 3.21Å
80	W	85.2	Confident	85.8	Confident	194 Å²	194	109.3 Å²	109.3	74%	0.735	54%	0.544	S	S	*	.	H	α-helix	trans	-62.3	-38.3	174.7	-76.3	112.3	0	0	0	112.3	Y76 S77 L78 A83 G84	Y76-W80 PolarHBondContact O-N 2.8Å; S77-W80 PolarHBondContact O-N 3.02Å; L78-W80 PolarHBondContact O-N 3.05Å; W80-A83 PolarHBondContact O-N 2.84Å; W80-G84 PolarHBondContact O-N 3.5Å
81	S	87	Confident	86.2	Confident	58 Å²	58	104 Å²	104	41%	0.406	53%	0.528	S	S	.	.	H	α-helix	trans	-66.5	-42.5	176.6	70.2	0	0	0	0	112	S77 L78 L79 G84 M85	S77-S81 WeakPolarHBondContact O-CB 3.32Å; S77-S81 PolarHBondContact O-N 3.37Å; S77-S81 PolarHBondContact O-OG 2.85Å; L78-S81 WeakPolarHBondContact CA-OG 3.5Å; L78-S81 PolarHBondContact O-N 2.88Å; L78-S81 PolarHBondContact O-OG 3.33Å; L79-S81 VanDerWaalsContact C-N 3.31Å; L79-S81 PolarHBondContact O-N 2.95Å; S81-G84 PolarHBondContact O-N 2.86Å; S81-M85 WeakPolarHBondContact O-CB 3.47Å; S81-M85 VanDerWaalsContact O-CG 3.24Å; S81-M85 WeakPolarHBondContact O-CG 3.26Å; S81-M85 PolarHBondContact O-N 3.39Å
82	I	89.8	Confident	86.8	Confident	104 Å²	104	101.8 Å²	101.8	53%	0.533	53%	0.531	S	S	.	.	H	α-helix	trans	-66.1	-44.2	177.5	-66	164.2	0	0	0	110	L78 L79 M85 A86	L78-I82 HydrophobicContact CD2-CD1 4.35Å; L78-I82 WeakPolarHBondContact O-CG1 3.36Å; L78-I82 PolarHBondContact O-N 3.44Å; L79-I82 PolarHBondContact O-N 2.66Å; I82-M85 PolarHBondContact O-N 3.28Å; I82-A86 WeakPolarHBondContact O-CB 3.24Å; I82-A86 PolarHBondContact O-N 3.18Å
83	A	90.5	Very high	87.4	Confident	48 Å²	48	106.6 Å²	106.6	40%	0.397	54%	0.54	S	S	.	.	H	α-helix	trans	-60.9	-45.8	176.4	0	0	0	0	0	111.4	L79 W80 M85 A86 V87	L79-A83 WeakPolarHBondContact O-CB 3.39Å; L79-A83 PolarHBondContact O-N 3.21Å; W80-A83 PolarHBondContact O-N 2.84Å; A83-M85 PolarHBondContact O-N 2.95Å; A83-A86 PolarHBondContact O-N 3.23Å; A83-V87 VanDerWaalsContact O-CG2 3.3Å; A83-V87 WeakPolarHBondContact O-CG2 3.31Å; A83-V87 PolarHBondContact O-N 3.49Å
84	G	92.4	Very high	87.8	Confident	34 Å²	34	103.8 Å²	103.8	35%	0.351	53%	0.528	S	S	.	.	H	α-helix	trans	-60.2	-45.5	175.4	0	0	0	0	0	112.3	W80 S81 A86 V87 L88	W80-G84 PolarHBondContact O-N 3.5Å; S81-G84 PolarHBondContact O-N 2.86Å; G84-A86 PolarHBondContact O-N 3.19Å; G84-V87 PolarHBondContact O-N 3.32Å; G84-L88 WeakPolarHBondContact O-CG 3.36Å; G84-L88 PolarHBondContact O-N 2.89Å
85	M	93.4	Very high	88.2	Confident	127 Å²	127	102.1 Å²	102.1	63%	0.626	53%	0.526	S	S	*	.	H	α-helix	trans	-63.4	-40.4	177	-73.4	-59.1	-64.7	0	0	112.4	S81 I82 A83 L88 F89	S81-M85 WeakPolarHBondContact O-CB 3.47Å; S81-M85 VanDerWaalsContact O-CG 3.24Å; S81-M85 WeakPolarHBondContact O-CG 3.26Å; S81-M85 PolarHBondContact O-N 3.39Å; I82-M85 PolarHBondContact O-N 3.28Å; A83-M85 PolarHBondContact O-N 2.95Å; M85-L88 PolarHBondContact O-N 3.22Å; M85-L88 HydrophobicContact SD-CD1 4.46Å; M85-F89 VanDerWaalsContact O-CB 3.28Å; M85-F89 WeakPolarHBondContact O-CB 3.44Å; M85-F89 PolarHBondContact O-N 2.88Å
86	A	93.4	Very high	88.9	Confident	39 Å²	39	98.7 Å²	98.7	32%	0.322	51%	0.514	S	S	.	.	H	α-helix	trans	-62.8	-45.3	174.9	0	0	0	0	0	111.1	I82 A83 G84 L88 F89 F90	I82-A86 WeakPolarHBondContact O-CB 3.24Å; I82-A86 PolarHBondContact O-N 3.18Å; A83-A86 PolarHBondContact O-N 3.23Å; G84-A86 PolarHBondContact O-N 3.19Å; A86-L88 PolarHBondContact O-N 3.34Å; A86-F89 PolarHBondContact O-N 3.49Å; A86-F90 HydrophobicContact CB-CD2 4.46Å; A86-F90 WeakPolarHBondContact O-CD2 3.29Å; A86-F90 PolarHBondContact O-N 3.29Å
87	V	93.7	Very high	89.2	Confident	106 Å²	106	93.2 Å²	93.2	64%	0.642	50%	0.497	S	S	*	.	H	α-helix	trans	-62.1	-43.3	177.3	171.9	0	0	0	0	111.2	A83 G84 G91	A83-V87 VanDerWaalsContact O-CG2 3.3Å; A83-V87 WeakPolarHBondContact O-CG2 3.31Å; A83-V87 PolarHBondContact O-N 3.49Å; G84-V87 PolarHBondContact O-N 3.32Å; V87-G91 WeakPolarHBondContact O-CA 3.47Å; V87-G91 PolarHBondContact O-N 3.02Å
88	L	94.9	Very high	89.3	Confident	120 Å²	120	97.8 Å²	97.8	63%	0.628	51%	0.505	S	S	*	.	H	α-helix	trans	-64.1	-41.7	175.6	-71.5	172.8	0	0	0	111.9	G84 M85 A86 S92	G84-L88 WeakPolarHBondContact O-CG 3.36Å; G84-L88 PolarHBondContact O-N 2.89Å; M85-L88 PolarHBondContact O-N 3.22Å; M85-L88 HydrophobicContact SD-CD1 4.46Å; A86-L88 PolarHBondContact O-N 3.34Å; L88-S92 VanDerWaalsContact O-CB 3.3Å; L88-S92 WeakPolarHBondContact O-CB 3.25Å; L88-S92 PolarHBondContact O-N 2.92Å; L88-S92 PolarHBondContact O-OG 2.94Å
89	F	94.6	Very high	89.5	Confident	132 Å²	132	102.7 Å²	102.7	58%	0.579	52%	0.516	S	S	*	.	H	α-helix	trans	-64.1	-52.6	178	-178.3	-97.2	0	0	0	111.9	M85 A86 G91 S92 Y93	M85-F89 VanDerWaalsContact O-CB 3.28Å; M85-F89 WeakPolarHBondContact O-CB 3.44Å; M85-F89 PolarHBondContact O-N 2.88Å; A86-F89 PolarHBondContact O-N 3.49Å; F89-G91 VanDerWaalsContact C-N 3.33Å; F89-G91 PolarHBondContact O-N 2.8Å; F89-S92 PolarHBondContact O-N 3.5Å; F89-S92 PolarHBondContact O-OG 3.41Å; F89-Y93 VanDerWaalsContact O-CB 3.26Å; F89-Y93 WeakPolarHBondContact O-CB 3.42Å; F89-Y93 PolarHBondContact O-N 3.11Å
90	F	90.1	Very high	89.6	Confident	133 Å²	133	102.7 Å²	102.7	58%	0.583	51%	0.512	S	S	*	.	H	α-helix	trans	-66.5	-35.7	177.7	-73.8	-67	0	0	0	112.3	A86 T94	A86-F90 HydrophobicContact CB-CD2 4.46Å; A86-F90 WeakPolarHBondContact O-CD2 3.29Å; A86-F90 PolarHBondContact O-N 3.29Å; F90-T94 WeakPolarHBondContact O-CB 3.39Å; F90-T94 VanDerWaalsContact O-CG2 3.26Å; F90-T94 WeakPolarHBondContact O-CG2 3.43Å; F90-T94 PolarHBondContact O-N 3.45Å; F90-T94 PolarHBondContact O-OG1 3.17Å
91	G	90.9	Very high	89.4	Confident	28 Å²	28	98.3 Å²	98.3	29%	0.289	50%	0.495	S	S	.	.	H	α-helix	trans	-63.3	-49.3	175	0	0	0	0	0	112.4	V87 F89 T94 L95	V87-G91 WeakPolarHBondContact O-CA 3.47Å; V87-G91 PolarHBondContact O-N 3.02Å; F89-G91 VanDerWaalsContact C-N 3.33Å; F89-G91 PolarHBondContact O-N 2.8Å; G91-T94 PolarHBondContact O-N 2.99Å; G91-T94 PolarHBondContact O-OG1 3.43Å; G91-L95 WeakPolarHBondContact O-CB 3.14Å; G91-L95 WeakPolarHBondContact O-CG 3.34Å; G91-L95 PolarHBondContact O-N 2.89Å
92	S	92.8	Very high	88.9	Confident	71 Å²	71	100 Å²	100	50%	0.497	51%	0.505	S	S	.	.	H	α-helix	trans	-65.2	-40.2	176.2	57.5	0	0	0	0	112.4	L88 F89 T94 L95 Y96	L88-S92 VanDerWaalsContact O-CB 3.3Å; L88-S92 WeakPolarHBondContact O-CB 3.25Å; L88-S92 PolarHBondContact O-N 2.92Å; L88-S92 PolarHBondContact O-OG 2.94Å; F89-S92 PolarHBondContact O-N 3.5Å; F89-S92 PolarHBondContact O-OG 3.41Å; S92-T94 PolarHBondContact O-N 3.45Å; S92-L95 PolarHBondContact O-N 3.27Å; S92-Y96 VanDerWaalsContact O-CB 3.31Å; S92-Y96 WeakPolarHBondContact O-CB 3.43Å; S92-Y96 PolarHBondContact O-N 3.38Å
93	Y	89.2	Confident	88.2	Confident	146 Å²	146	101.7 Å²	101.7	57%	0.573	52%	0.515	S	S	*	.	H	α-helix	trans	-60.5	-45.4	175.4	177.3	-97.7	0	0	0	112.2	F89 Y96 A97	F89-Y93 VanDerWaalsContact O-CB 3.26Å; F89-Y93 WeakPolarHBondContact O-CB 3.42Å; F89-Y93 PolarHBondContact O-N 3.11Å; Y93-Y96 PolarHBondContact O-N 3.49Å; Y93-A97 VanDerWaalsContact O-CB 3.32Å; Y93-A97 WeakPolarHBondContact O-CB 3.28Å; Y93-A97 PolarHBondContact O-N 2.87Å
94	T	85.1	Confident	87.3	Confident	57 Å²	57	102.3 Å²	102.3	35%	0.35	51%	0.51	S	S	.	.	H	α-helix	trans	-68.7	-39	179.6	50.7	0	0	0	0	112.4	F90 G91 S92 A97 R98 I106	F90-T94 WeakPolarHBondContact O-CB 3.39Å; F90-T94 VanDerWaalsContact O-CG2 3.26Å; F90-T94 WeakPolarHBondContact O-CG2 3.43Å; F90-T94 PolarHBondContact O-N 3.45Å; F90-T94 PolarHBondContact O-OG1 3.17Å; G91-T94 PolarHBondContact O-N 2.99Å; G91-T94 PolarHBondContact O-OG1 3.43Å; S92-T94 PolarHBondContact O-N 3.45Å; T94-A97 PolarHBondContact O-N 3.46Å; T94-R98 WeakPolarHBondContact O-CB 3.26Å; T94-R98 PolarHBondContact O-N 2.8Å; T94-I106 HydrophobicContact CG2-CG2 4.05Å
95	L	88	Confident	86.2	Confident	127 Å²	127	101.9 Å²	101.9	67%	0.665	50%	0.501	S	S	*	.	H	α-helix	trans	-61.8	-45.6	172.1	-76	167.8	0	0	0	111.7	G91 S92 R98 W99	G91-L95 WeakPolarHBondContact O-CB 3.14Å; G91-L95 WeakPolarHBondContact O-CG 3.34Å; G91-L95 PolarHBondContact O-N 2.89Å; S92-L95 PolarHBondContact O-N 3.27Å; L95-R98 PolarHBondContact O-N 3.06Å; L95-W99 PolarHBondContact O-N 3.34Å
96	Y	89.1	Confident	85.1	Confident	131 Å²	131	99.1 Å²	99.1	51%	0.514	49%	0.488	S	S	.	.	H	α-helix	trans	-62.9	-45	177.5	179.9	-97.6	0	0	0	111.9	S92 Y93 R98 W99 K100	S92-Y96 VanDerWaalsContact O-CB 3.31Å; S92-Y96 WeakPolarHBondContact O-CB 3.43Å; S92-Y96 PolarHBondContact O-N 3.38Å; Y93-Y96 PolarHBondContact O-N 3.49Å; Y96-R98 VanDerWaalsContact C-N 3.33Å; Y96-R98 PolarHBondContact O-N 3.23Å; Y96-W99 PolarHBondContact O-N 3.29Å; Y96-K100 HydrophobicContact CE1-CD 4.05Å; Y96-K100 WeakPolarHBondContact O-CB 3.39Å; Y96-K100 PolarHBondContact O-N 3.36Å
97	A	83.7	Confident	84.2	Confident	21 Å²	21	101 Å²	101	17%	0.174	49%	0.493	C	S	.	.	H	α-helix	trans	-60.8	-43.3	177	0	0	0	0	0	111.5	Y93 T94 W99 K100 Y101	Y93-A97 VanDerWaalsContact O-CB 3.32Å; Y93-A97 WeakPolarHBondContact O-CB 3.28Å; Y93-A97 PolarHBondContact O-N 2.87Å; T94-A97 PolarHBondContact O-N 3.46Å; A97-W99 VanDerWaalsContact C-N 3.31Å; A97-W99 PolarHBondContact O-N 3.32Å; A97-K100 PolarHBondContact O-N 3.41Å; A97-Y101 PolarHBondContact O-N 3.2Å
98	R	84	Confident	83.3	Confident	154 Å²	154	102.4 Å²	102.4	58%	0.581	50%	0.496	S	S	*	.	H	α-helix	trans	-64	-35.9	176.6	-168.7	169.3	-178.5	128.7	0.1	112.5	T94 L95 Y96 P102 I106	T94-R98 WeakPolarHBondContact O-CB 3.26Å; T94-R98 PolarHBondContact O-N 2.8Å; L95-R98 PolarHBondContact O-N 3.06Å; Y96-R98 VanDerWaalsContact C-N 3.33Å; Y96-R98 PolarHBondContact O-N 3.23Å; R98-P102 WeakPolarHBondContact O-CA 3.3Å; R98-I106 HydrophobicContact CB-CD1 3.7Å; R98-I106 HydrophobicContact CG-CD1 3.83Å
99	W	86.7	Confident	82.2	Confident	217 Å²	217	105.3 Å²	105.3	82%	0.822	50%	0.5	S	S	*	.	H	α-helix	trans	-72.6	-39.3	178.2	-169.6	45.6	0	0	0	112.3	L95 Y96 A97	L95-W99 PolarHBondContact O-N 3.34Å; Y96-W99 PolarHBondContact O-N 3.29Å; A97-W99 VanDerWaalsContact C-N 3.31Å; A97-W99 PolarHBondContact O-N 3.32Å
100	K	86.7	Confident	81.4	Confident	110 Å²	110	102.6 Å²	102.6	48%	0.478	49%	0.489	S	S	.	.	H	α-helix	trans	-76.9	-32.9	179.7	-169.2	172.4	-177.7	174.1	0	113.2	Y96 A97	Y96-K100 HydrophobicContact CE1-CD 4.05Å; Y96-K100 WeakPolarHBondContact O-CB 3.39Å; Y96-K100 PolarHBondContact O-N 3.36Å; A97-K100 PolarHBondContact O-N 3.41Å
101	Y	81.1	Confident	80.9	Confident	101 Å²	101	99.5 Å²	99.5	40%	0.396	47%	0.474	S	S	.	.			trans	-133.3	75.5	-176.5	-51.7	-67.3	0	0	0	110.3	A97 D103 Q104	A97-Y101 PolarHBondContact O-N 3.2Å; Y101-D103 PolarHBondContact O-N 3.23Å; Y101-Q104 PolarHBondContact O-N 3.47Å
102	P	75.9	Confident	80.3	Confident	93 Å²	93	105.7 Å²	105.7	60%	0.604	49%	0.488	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.8	-31.3	-173.4	23.9	-33.9	0	0	0	113.4	R98	R98-P102 WeakPolarHBondContact O-CA 3.3Å
103	D	75.5	Confident	79.8	Confident	141 Å²	141	106.1 Å²	106.1	75%	0.754	49%	0.488	S	S	*	.	T	Hydrogen-bonded Turn	trans	-93.1	-3.3	-176	-53.3	-45	0	0	0	113.4	Y101	Y101-D103 PolarHBondContact O-N 3.23Å
104	Q	72.2	Confident	79.2	Confident	60 Å²	60	101.5 Å²	101.5	28%	0.28	47%	0.473	S	S	.	.	S	Bend	trans	-89.6	130.8	-179.5	-70.3	-169.8	-23.9	0	0	111.3	Y101 I106 K127	Y101-Q104 PolarHBondContact O-N 3.47Å; Q104-I106 PolarHBondContact O-N 3.04Å; Q104-K127 VanDerWaalsContact NE2-NZ 3.13Å
105	P	69.7	Low	79	Confident	26 Å²	26	104.3 Å²	104.3	17%	0.169	48%	0.482	C	S	.	.			trans	-64.6	128.8	175.2	27.8	-36	0	0	0	110	Q110 W111 L114 M124	P105-Q110 HydrophobicContact CB-CB 3.63Å; P105-W111 HydrophobicContact CG-CB 4.44Å; P105-W111 HydrophobicContact CG-CD2 4.37Å; P105-W111 HydrophobicContact CG-CE3 3.44Å; P105-W111 VanDerWaalsContact CG-CE3 3.44Å; P105-W111 HydrophobicContact CG-CZ3 4.02Å; P105-L114 HydrophobicContact CB-CD1 3.85Å; P105-L114 HydrophobicContact CG-CD1 3.96Å; P105-M124 VanDerWaalsContact CD-SD 3.6Å; P105-M124 HydrophobicContact CG-CE 3.49Å; P105-M124 VanDerWaalsContact CG-CE 3.49Å
106	I	70.1	Confident	78.8	Confident	68 Å²	68	106.8 Å²	106.8	35%	0.349	49%	0.487	S	S	.	.	S	Bend	trans	-83.6	-23.1	-173.3	-58.2	165.5	0	0	0	110.6	T94 R98 Q104	T94-I106 HydrophobicContact CG2-CG2 4.05Å; R98-I106 HydrophobicContact CB-CD1 3.7Å; R98-I106 HydrophobicContact CG-CD1 3.83Å; Q104-I106 PolarHBondContact O-N 3.04Å
107	N	74	Confident	78.5	Confident	78 Å²	78	104.9 Å²	104.9	42%	0.417	49%	0.486	S	S	.	.	S	Bend	trans	-129.2	160.5	-179.6	85.8	15	0	0	0	112.8	Y109 Q110 W111	N107-Y109 PolarHBondContact O-N 2.99Å; N107-Y109 VanDerWaalsContact OD1-CA 3.29Å; N107-Y109 WeakPolarHBondContact OD1-CA 3.48Å; N107-Y109 VanDerWaalsContact OD1-CB 3.25Å; N107-Y109 WeakPolarHBondContact OD1-CB 3.33Å; N107-Y109 PolarHBondContact OD1-N 3.42Å; N107-Q110 PolarHBondContact O-N 3.24Å; N107-Q110 WeakPolarHBondContact OD1-CB 3.24Å; N107-Q110 WeakPolarHBondContact OD1-CG 3.5Å; N107-Q110 PolarHBondContact OD1-N 3.43Å; N107-W111 PolarHBondContact O-N 3Å
108	L	74.3	Confident	78.2	Confident	136 Å²	136	111.2 Å²	111.2	71%	0.712	52%	0.517	S	S	*	.	H	α-helix	trans	-62.7	-26.6	177.5	-72.5	164.7	0	0	0	113.2	R112	L108-R112 PolarHBondContact O-N 2.92Å
109	Y	73.6	Confident	77.9	Confident	181 Å²	181	110.4 Å²	110.4	71%	0.71	52%	0.518	S	S	*	.	H	α-helix	trans	-68.4	-46.7	176.2	-84.5	-85.8	0	0	0	111.8	N107 W111 R112 T113	N107-Y109 PolarHBondContact O-N 2.99Å; N107-Y109 VanDerWaalsContact OD1-CA 3.29Å; N107-Y109 WeakPolarHBondContact OD1-CA 3.48Å; N107-Y109 VanDerWaalsContact OD1-CB 3.25Å; N107-Y109 WeakPolarHBondContact OD1-CB 3.33Å; N107-Y109 PolarHBondContact OD1-N 3.42Å; Y109-W111 VanDerWaalsContact C-N 3.29Å; Y109-W111 PolarHBondContact O-N 3.27Å; Y109-R112 PolarHBondContact O-N 3.47Å; Y109-T113 WeakPolarHBondContact O-CG2 3.3Å; Y109-T113 PolarHBondContact O-N 3.19Å; Y109-T113 PolarHBondContact O-OG1 2.97Å
110	Q	76.7	Confident	77.2	Confident	75 Å²	75	101.4 Å²	101.4	35%	0.35	49%	0.485	S	S	.	.	H	α-helix	trans	-62.2	-40.7	175.3	-75.9	-177.9	-22.2	0	0	110	P105 N107 T113 L114	P105-Q110 HydrophobicContact CB-CB 3.63Å; N107-Q110 PolarHBondContact O-N 3.24Å; N107-Q110 WeakPolarHBondContact OD1-CB 3.24Å; N107-Q110 WeakPolarHBondContact OD1-CG 3.5Å; N107-Q110 PolarHBondContact OD1-N 3.43Å; Q110-T113 VanDerWaalsContact CA-OG1 3.24Å; Q110-T113 WeakPolarHBondContact CA-OG1 3.44Å; Q110-T113 PolarHBondContact O-N 2.95Å; Q110-T113 PolarHBondContact O-OG1 2.81Å; Q110-L114 WeakPolarHBondContact O-CB 3.45Å; Q110-L114 WeakPolarHBondContact O-CG 3.38Å; Q110-L114 PolarHBondContact O-N 3.25Å
111	W	79.8	Confident	76.8	Confident	69 Å²	69	99.8 Å²	99.8	26%	0.261	49%	0.485	S	S	.	.	H	α-helix	trans	-56.9	-53.6	172	-170.7	-81	0	0	0	111.3	P105 N107 Y109 T113 L114 E115 L120 M124	P105-W111 HydrophobicContact CG-CB 4.44Å; P105-W111 HydrophobicContact CG-CD2 4.37Å; P105-W111 HydrophobicContact CG-CE3 3.44Å; P105-W111 VanDerWaalsContact CG-CE3 3.44Å; P105-W111 HydrophobicContact CG-CZ3 4.02Å; N107-W111 PolarHBondContact O-N 3Å; Y109-W111 VanDerWaalsContact C-N 3.29Å; Y109-W111 PolarHBondContact O-N 3.27Å; W111-T113 VanDerWaalsContact C-N 3.32Å; W111-T113 PolarHBondContact O-N 3.42Å; W111-L114 PolarHBondContact O-N 2.96Å; W111-E115 WeakPolarHBondContact O-CB 3.48Å; W111-E115 PolarHBondContact O-N 2.92Å; W111-L120 HydrophobicContact CD2-CD2 4.48Å; W111-L120 HydrophobicContact CH2-CD2 3.59Å; W111-L120 HydrophobicContact CZ2-CD2 3.32Å; W111-L120 HydrophobicContact CZ3-CD2 4.31Å; W111-M124 HydrophobicContact CE3-CE 3.89Å; W111-M124 HydrophobicContact CH2-CB 4.25Å; W111-M124 HydrophobicContact CH2-CE 3.9Å; W111-M124 HydrophobicContact CZ3-CE 3.39Å
112	R	77.7	Confident	76.8	Confident	158 Å²	158	100 Å²	100	60%	0.596	50%	0.498	S	S	*	.	H	α-helix	trans	-62.1	-36	178.9	-77.1	-169.9	-152.8	175.1	6.2	113.4	L108 Y109 K116	L108-R112 PolarHBondContact O-N 2.92Å; Y109-R112 PolarHBondContact O-N 3.47Å; R112-K116 WeakPolarHBondContact O-CB 3.34Å; R112-K116 WeakPolarHBondContact O-CG 3.12Å; R112-K116 PolarHBondContact O-N 3.07Å
113	T	82.6	Confident	77.1	Confident	79 Å²	79	102.2 Å²	102.2	49%	0.485	50%	0.501	S	S	.	.	H	α-helix	trans	-68.1	-41	176.6	48.9	0	0	0	0	111.2	Y109 Q110 W111 E115 K116 D117	Y109-T113 WeakPolarHBondContact O-CG2 3.3Å; Y109-T113 PolarHBondContact O-N 3.19Å; Y109-T113 PolarHBondContact O-OG1 2.97Å; Q110-T113 VanDerWaalsContact CA-OG1 3.24Å; Q110-T113 WeakPolarHBondContact CA-OG1 3.44Å; Q110-T113 PolarHBondContact O-N 2.95Å; Q110-T113 PolarHBondContact O-OG1 2.81Å; W111-T113 VanDerWaalsContact C-N 3.32Å; W111-T113 PolarHBondContact O-N 3.42Å; T113-E115 VanDerWaalsContact C-N 3.32Å; T113-E115 PolarHBondContact O-N 3.25Å; T113-K116 PolarHBondContact O-N 3.05Å; T113-D117 WeakPolarHBondContact O-CB 3.33Å; T113-D117 PolarHBondContact O-N 3.41Å
114	L	77.7	Confident	77.2	Confident	49 Å²	49	96.2 Å²	96.2	26%	0.257	47%	0.468	S	S	.	.	H	α-helix	trans	-66.6	-37.1	176.4	-70.9	168.1	0	0	0	111.5	P105 Q110 W111 D117 D118 K119 L120 M124	P105-L114 HydrophobicContact CB-CD1 3.85Å; P105-L114 HydrophobicContact CG-CD1 3.96Å; Q110-L114 WeakPolarHBondContact O-CB 3.45Å; Q110-L114 WeakPolarHBondContact O-CG 3.38Å; Q110-L114 PolarHBondContact O-N 3.25Å; W111-L114 PolarHBondContact O-N 2.96Å; L114-D117 PolarHBondContact O-N 3.23Å; L114-D118 PolarHBondContact O-N 3.08Å; L114-K119 HydrophobicContact CD2-CB 4.17Å; L114-K119 PolarHBondContact O-N 3.39Å; L114-L120 HydrophobicContact CB-CD1 3.6Å; L114-L120 HydrophobicContact CB-CG 4.38Å; L114-L120 WeakPolarHBondContact O-CD1 3.41Å; L114-M124 HydrophobicContact CD1-CE 4.49Å
115	E	79.5	Confident	77.6	Confident	116 Å²	116	96.6 Å²	96.6	54%	0.542	47%	0.472	S	S	.	.	H	α-helix	trans	-66.3	-39.5	178	-174.2	177.6	-157.6	0	0	111.6	W111 T113 D118 L120	W111-E115 WeakPolarHBondContact O-CB 3.48Å; W111-E115 PolarHBondContact O-N 2.92Å; T113-E115 VanDerWaalsContact C-N 3.32Å; T113-E115 PolarHBondContact O-N 3.25Å; E115-D118 PolarHBondContact O-N 3.35Å; E115-L120 HydrophobicContact CB-CD1 3.89Å
116	K	84.4	Confident	78.4	Confident	180 Å²	180	99.9 Å²	99.9	78%	0.783	49%	0.488	S	S	*	.	H	α-helix	trans	-68.2	-35.7	173.4	-76.3	-177.8	177.1	-169.2	0	113.3	R112 T113 D118	R112-K116 WeakPolarHBondContact O-CB 3.34Å; R112-K116 WeakPolarHBondContact O-CG 3.12Å; R112-K116 PolarHBondContact O-N 3.07Å; T113-K116 PolarHBondContact O-N 3.05Å; K116-D118 PolarHBondContact O-N 3.45Å
117	D	82.6	Confident	79	Confident	91 Å²	91	101.4 Å²	101.4	49%	0.487	49%	0.492	S	S	.	.	T	Hydrogen-bonded Turn	trans	-80.6	-2.5	-179.3	-84.1	18.2	0	0	0	113.2	T113 L114 K119	T113-D117 WeakPolarHBondContact O-CB 3.33Å; T113-D117 PolarHBondContact O-N 3.41Å; L114-D117 PolarHBondContact O-N 3.23Å; D117-K119 HydrophobicContact CB-CB 4.31Å; D117-K119 HydrophobicContact CB-CD 3.92Å; D117-K119 HydrophobicContact CB-CG 4.05Å; D117-K119 PolarHBondContact O-N 3.24Å; D117-K119 VanDerWaalsContact O-N 3.07Å; D117-K119 IonicContact OD2-NZ 2.89Å; D117-K119 PolarHBondContact OD2-NZ 3.23Å
118	D	76.9	Confident	79.3	Confident	154 Å²	154	99.2 Å²	99.2	82%	0.824	48%	0.483	S	S	*	.	T	Hydrogen-bonded Turn	trans	53.1	25.5	-174.1	-130.1	4.5	0	0	0	113.5	L114 E115 K116 L120	L114-D118 PolarHBondContact O-N 3.08Å; E115-D118 PolarHBondContact O-N 3.35Å; K116-D118 PolarHBondContact O-N 3.45Å; D118-L120 VanDerWaalsContact C-N 3.35Å
119	K	77.6	Confident	79.9	Confident	137 Å²	137	99.2 Å²	99.2	60%	0.596	48%	0.477	S	S	*	.			trans	-92	9	-178.8	-75.6	173.5	-168.4	153.4	0	113.1	L114 D117 T121	L114-K119 HydrophobicContact CD2-CB 4.17Å; L114-K119 PolarHBondContact O-N 3.39Å; D117-K119 HydrophobicContact CB-CB 4.31Å; D117-K119 HydrophobicContact CB-CD 3.92Å; D117-K119 HydrophobicContact CB-CG 4.05Å; D117-K119 PolarHBondContact O-N 3.24Å; D117-K119 VanDerWaalsContact O-N 3.07Å; D117-K119 IonicContact OD2-NZ 2.89Å; D117-K119 PolarHBondContact OD2-NZ 3.23Å; K119-T121 PolarHBondContact O-N 3.41Å
120	L	73	Confident	80.5	Confident	27 Å²	27	97.5 Å²	97.5	14%	0.141	47%	0.473	C	S	.	.			trans	-70.5	123	177.3	-96	96.3	0	0	0	110.6	W111 L114 E115 D118 M124 I125	W111-L120 HydrophobicContact CD2-CD2 4.48Å; W111-L120 HydrophobicContact CH2-CD2 3.59Å; W111-L120 HydrophobicContact CZ2-CD2 3.32Å; W111-L120 HydrophobicContact CZ3-CD2 4.31Å; L114-L120 HydrophobicContact CB-CD1 3.6Å; L114-L120 HydrophobicContact CB-CG 4.38Å; L114-L120 WeakPolarHBondContact O-CD1 3.41Å; E115-L120 HydrophobicContact CB-CD1 3.89Å; D118-L120 VanDerWaalsContact C-N 3.35Å; L120-M124 HydrophobicContact CD2-CB 4.26Å; L120-M124 HydrophobicContact CD2-CE 3.91Å; L120-M124 HydrophobicContact CG-CE 4.01Å; L120-I125 HydrophobicContact CB-CD1 4.08Å; L120-I125 HydrophobicContact CB-CG1 3.9Å; L120-I125 HydrophobicContact CD2-CG1 3.97Å
121	T	78.8	Confident	80.9	Confident	76 Å²	76	99.5 Å²	99.5	47%	0.466	49%	0.485	S	S	.	.			trans	-64	144.9	171	49.4	0	0	0	0	110.5	K119 E123 M124 I125	K119-T121 PolarHBondContact O-N 3.41Å; T121-E123 PolarHBondContact O-N 3.04Å; T121-E123 VanDerWaalsContact O-N 3.13Å; T121-M124 WeakPolarHBondContact O-CB 3.45Å; T121-M124 PolarHBondContact O-N 3.38Å; T121-I125 PolarHBondContact O-N 3.34Å
122	P	80.6	Confident	81.2	Confident	105 Å²	105	100.9 Å²	100.9	68%	0.682	50%	0.498	S	S	*	.	H	α-helix	trans	-59.3	-29.5	-178.5	22.3	-32.9	0	0	0	112.3	I125 N126	P122-I125 PolarHBondContact O-N 3.39Å; P122-N126 WeakPolarHBondContact O-CB 3.28Å; P122-N126 PolarHBondContact O-N 3.47Å
123	E	82.2	Confident	81.8	Confident	141 Å²	141	95.1 Å²	95.1	66%	0.659	48%	0.484	S	S	*	.	H	α-helix	trans	-62.4	-40.8	173.1	-72.8	-162.6	157.3	0	0	113.2	T121 N126 K127	T121-E123 PolarHBondContact O-N 3.04Å; T121-E123 VanDerWaalsContact O-N 3.13Å; E123-N126 PolarHBondContact O-N 3.48Å; E123-K127 WeakPolarHBondContact O-CG 3.32Å; E123-K127 PolarHBondContact O-N 3.15Å
124	M	77.3	Confident	81.9	Confident	14 Å²	14	97.2 Å²	97.2	7%	0.069	49%	0.487	C	S	.	.	H	α-helix	trans	-68.2	-40.9	178.3	-80.6	-174.8	37.3	0	0	111.7	P105 W111 L114 L120 T121 N126 K127 S128	P105-M124 VanDerWaalsContact CD-SD 3.6Å; P105-M124 HydrophobicContact CG-CE 3.49Å; P105-M124 VanDerWaalsContact CG-CE 3.49Å; W111-M124 HydrophobicContact CE3-CE 3.89Å; W111-M124 HydrophobicContact CH2-CB 4.25Å; W111-M124 HydrophobicContact CH2-CE 3.9Å; W111-M124 HydrophobicContact CZ3-CE 3.39Å; L114-M124 HydrophobicContact CD1-CE 4.49Å; L120-M124 HydrophobicContact CD2-CB 4.26Å; L120-M124 HydrophobicContact CD2-CE 3.91Å; L120-M124 HydrophobicContact CG-CE 4.01Å; T121-M124 WeakPolarHBondContact O-CB 3.45Å; T121-M124 PolarHBondContact O-N 3.38Å; M124-N126 VanDerWaalsContact C-N 3.26Å; M124-N126 PolarHBondContact O-N 2.92Å; M124-K127 PolarHBondContact O-N 2.84Å; M124-S128 PolarHBondContact O-N 2.92Å
125	I	81.4	Confident	82.3	Confident	68 Å²	68	97.6 Å²	97.6	35%	0.349	49%	0.491	S	S	.	.	H	α-helix	trans	-61.1	-40.3	174.6	-60.5	172.8	0	0	0	110.2	L120 T121 P122 S128 K129	L120-I125 HydrophobicContact CB-CD1 4.08Å; L120-I125 HydrophobicContact CB-CG1 3.9Å; L120-I125 HydrophobicContact CD2-CG1 3.97Å; T121-I125 PolarHBondContact O-N 3.34Å; P122-I125 PolarHBondContact O-N 3.39Å; I125-S128 PolarHBondContact O-N 2.91Å; I125-S128 PolarHBondContact O-OG 2.8Å; I125-K129 HydrophobicContact CG2-CD 4.36Å; I125-K129 WeakPolarHBondContact O-CG 3.44Å; I125-K129 PolarHBondContact O-N 3.47Å
126	N	85.5	Confident	82.8	Confident	95 Å²	95	97.9 Å²	97.9	51%	0.508	49%	0.493	S	S	.	.	H	α-helix	trans	-70.9	-35.6	179.4	-142.5	-4.5	0	0	0	111.7	P122 E123 M124 K130	P122-N126 WeakPolarHBondContact O-CB 3.28Å; P122-N126 PolarHBondContact O-N 3.47Å; E123-N126 PolarHBondContact O-N 3.48Å; M124-N126 VanDerWaalsContact C-N 3.26Å; M124-N126 PolarHBondContact O-N 2.92Å; N126-K130 WeakPolarHBondContact O-CG 3Å; N126-K130 PolarHBondContact O-N 3.19Å; N126-K130 VanDerWaalsContact O-N 3.09Å
127	K	82.2	Confident	83	Confident	101 Å²	101	96.3 Å²	96.3	44%	0.439	48%	0.482	S	S	.	.	H	α-helix	trans	-65.6	-43.5	172.5	-80.7	176.5	176.8	166.9	0	112	Q104 E123 M124 K130 L131	Q104-K127 VanDerWaalsContact NE2-NZ 3.13Å; E123-K127 WeakPolarHBondContact O-CG 3.32Å; E123-K127 PolarHBondContact O-N 3.15Å; M124-K127 PolarHBondContact O-N 2.84Å; K127-K130 PolarHBondContact O-N 3.31Å; K127-L131 PolarHBondContact O-N 3.49Å
128	S	81.8	Confident	83	Confident	32 Å²	32	96.3 Å²	96.3	22%	0.224	48%	0.475	C	S	.	.	H	α-helix	trans	-62.8	-46.1	177.5	65.1	0	0	0	0	111.2	M124 I125 K130 L131 D132	M124-S128 PolarHBondContact O-N 2.92Å; I125-S128 PolarHBondContact O-N 2.91Å; I125-S128 PolarHBondContact O-OG 2.8Å; S128-K130 VanDerWaalsContact C-N 3.31Å; S128-K130 PolarHBondContact O-N 3.1Å; S128-L131 CarbonylContact O-C 3.59Å; S128-L131 WeakPolarHBondContact O-CA 3.43Å; S128-L131 WeakPolarHBondContact O-CB 3.32Å; S128-L131 PolarHBondContact O-N 3.33Å; S128-D132 PolarHBondContact O-N 2.9Å
129	K	85.6	Confident	83.5	Confident	136 Å²	136	95.9 Å²	95.9	59%	0.591	47%	0.466	S	S	*	.	H	α-helix	trans	-57.3	-41.6	175.3	-73.8	179.1	180	-177.2	0	113	I125 L131 D132 A133	I125-K129 HydrophobicContact CG2-CD 4.36Å; I125-K129 WeakPolarHBondContact O-CG 3.44Å; I125-K129 PolarHBondContact O-N 3.47Å; K129-L131 VanDerWaalsContact C-N 3.31Å; K129-D132 PolarHBondContact O-N 3.45Å; K129-A133 WeakPolarHBondContact O-CB 3.23Å; K129-A133 PolarHBondContact O-N 3.26Å
130	K	87.2	Confident	83.9	Confident	145 Å²	145	96.7 Å²	96.7	63%	0.63	47%	0.471	S	S	*	.	H	α-helix	trans	-64.6	-37.3	175.2	-77	178	-178.4	-179.5	0	112.1	N126 K127 S128 F134	N126-K130 WeakPolarHBondContact O-CG 3Å; N126-K130 PolarHBondContact O-N 3.19Å; N126-K130 VanDerWaalsContact O-N 3.09Å; K127-K130 PolarHBondContact O-N 3.31Å; S128-K130 VanDerWaalsContact C-N 3.31Å; S128-K130 PolarHBondContact O-N 3.1Å; K130-F134 WeakPolarHBondContact O-CB 3.48Å; K130-F134 PolarHBondContact O-N 2.72Å
131	L	84.1	Confident	84.5	Confident	116 Å²	116	101.2 Å²	101.2	61%	0.607	49%	0.494	S	S	*	.	H	α-helix	trans	-68	-45.6	178	-149.7	111.3	0	0	0	110.8	K127 S128 K129 A133 F134 V135	K127-L131 PolarHBondContact O-N 3.49Å; S128-L131 CarbonylContact O-C 3.59Å; S128-L131 WeakPolarHBondContact O-CA 3.43Å; S128-L131 WeakPolarHBondContact O-CB 3.32Å; S128-L131 PolarHBondContact O-N 3.33Å; K129-L131 VanDerWaalsContact C-N 3.31Å; L131-A133 PolarHBondContact O-N 2.93Å; L131-F134 WeakPolarHBondContact O-CA 3.47Å; L131-F134 WeakPolarHBondContact O-CB 3.48Å; L131-F134 PolarHBondContact O-N 3.47Å; L131-V135 WeakPolarHBondContact O-CG2 3.44Å; L131-V135 PolarHBondContact O-N 2.62Å
132	D	87.2	Confident	84.3	Confident	99 Å²	99	100.5 Å²	100.5	53%	0.529	50%	0.503	S	S	.	.	H	α-helix	trans	-60.9	-45.3	176.5	-67.1	-28.7	0	0	0	110.9	S128 K129 F134 V135 E136	S128-D132 PolarHBondContact O-N 2.9Å; K129-D132 PolarHBondContact O-N 3.45Å; D132-F134 PolarHBondContact O-N 2.91Å; D132-V135 PolarHBondContact O-N 2.93Å; D132-E136 WeakPolarHBondContact O-CB 3.31Å; D132-E136 PolarHBondContact O-N 3.38Å
133	A	89.3	Confident	83.9	Confident	37 Å²	37	100.1 Å²	100.1	31%	0.306	49%	0.494	S	S	.	.	H	α-helix	trans	-64.1	-25.9	175	0	0	0	0	0	113.4	K129 L131 R137	K129-A133 WeakPolarHBondContact O-CB 3.23Å; K129-A133 PolarHBondContact O-N 3.26Å; L131-A133 PolarHBondContact O-N 2.93Å; A133-R137 WeakPolarHBondContact O-CB 3.37Å; A133-R137 WeakPolarHBondContact O-CG 3.39Å; A133-R137 PolarHBondContact O-N 3.41Å; A133-R137 PolarHBondContact O-NE 3.5Å
134	F	86.1	Confident	82.7	Confident	123 Å²	123	100.4 Å²	100.4	54%	0.539	50%	0.5	S	S	.	.	H	α-helix	trans	-75.8	-44.4	173.1	177.2	-94.2	0	0	0	111.2	K130 L131 D132 E136 R137 R138	K130-F134 WeakPolarHBondContact O-CB 3.48Å; K130-F134 PolarHBondContact O-N 2.72Å; L131-F134 WeakPolarHBondContact O-CA 3.47Å; L131-F134 WeakPolarHBondContact O-CB 3.48Å; L131-F134 PolarHBondContact O-N 3.47Å; D132-F134 PolarHBondContact O-N 2.91Å; F134-E136 VanDerWaalsContact C-N 3.34Å; F134-R137 PolarHBondContact O-N 2.77Å; F134-R138 HydrophobicContact CD1-CG 4.45Å; F134-R138 HydrophobicContact CE1-CG 4Å; F134-R138 HydrophobicContact CZ-CG 4.15Å; F134-R138 PolarHBondContact O-N 3.27Å
135	V	85.7	Confident	82.9	Confident	57 Å²	57	104.7 Å²	104.7	35%	0.345	52%	0.521	S	S	.	.	H	α-helix	trans	-62.1	-42.8	175.9	173.1	0	0	0	0	110.8	L131 D132 R137 R138 K139	L131-V135 WeakPolarHBondContact O-CG2 3.44Å; L131-V135 PolarHBondContact O-N 2.62Å; D132-V135 PolarHBondContact O-N 2.93Å; V135-R137 PolarHBondContact O-N 3.35Å; V135-R138 WeakPolarHBondContact O-CB 3.38Å; V135-R138 PolarHBondContact O-N 3.16Å; V135-K139 WeakPolarHBondContact O-CG 3.5Å; V135-K139 PolarHBondContact O-N 3.01Å
136	E	90.1	Very high	83	Confident	122 Å²	122	106.6 Å²	106.6	57%	0.57	53%	0.53	S	S	*	.	H	α-helix	trans	-65.9	-39.4	179	-164.1	165.7	-158.1	0	0	111.8	D132 F134 R138 K139 Q140	D132-E136 WeakPolarHBondContact O-CB 3.31Å; D132-E136 PolarHBondContact O-N 3.38Å; F134-E136 VanDerWaalsContact C-N 3.34Å; E136-R138 PolarHBondContact O-N 3.02Å; E136-K139 PolarHBondContact O-N 3.02Å; E136-Q140 WeakPolarHBondContact O-CG 3.48Å; E136-Q140 PolarHBondContact O-N 3.06Å
137	R	87.6	Confident	82.9	Confident	147 Å²	147	107.3 Å²	107.3	56%	0.555	53%	0.532	S	S	*	.	H	α-helix	trans	-61.3	-42.8	171.3	-83.3	-177.1	-81.9	-162.7	-3.4	112.5	A133 F134 V135 Q140 I141	A133-R137 WeakPolarHBondContact O-CB 3.37Å; A133-R137 WeakPolarHBondContact O-CG 3.39Å; A133-R137 PolarHBondContact O-N 3.41Å; A133-R137 PolarHBondContact O-NE 3.5Å; F134-R137 PolarHBondContact O-N 2.77Å; V135-R137 PolarHBondContact O-N 3.35Å; R137-Q140 PolarHBondContact O-N 3.25Å; R137-I141 WeakPolarHBondContact O-CD1 3.46Å; R137-I141 VanDerWaalsContact O-CG1 3.24Å; R137-I141 WeakPolarHBondContact O-CG1 3.31Å; R137-I141 PolarHBondContact O-N 3.03Å
138	R	83.6	Confident	82.9	Confident	91 Å²	91	107.6 Å²	107.6	34%	0.343	54%	0.537	S	S	.	.	H	α-helix	trans	-62.5	-42	176.1	-79.3	-106.6	-62.9	-162.6	1.1	112.5	F134 V135 E136 I141 G142 I143 D144	F134-R138 HydrophobicContact CD1-CG 4.45Å; F134-R138 HydrophobicContact CE1-CG 4Å; F134-R138 HydrophobicContact CZ-CG 4.15Å; F134-R138 PolarHBondContact O-N 3.27Å; V135-R138 WeakPolarHBondContact O-CB 3.38Å; V135-R138 PolarHBondContact O-N 3.16Å; E136-R138 PolarHBondContact O-N 3.02Å; R138-I141 PolarHBondContact O-N 2.92Å; R138-G142 PolarHBondContact O-N 2.76Å; R138-I143 PolarHBondContact O-N 3.26Å; R138-D144 IonicContact CZ-OD1 3.69Å; R138-D144 IonicContact CZ-OD2 3.64Å; R138-D144 IonicContact NE-OD1 3.17Å; R138-D144 IonicContact NE-OD2 3.89Å; R138-D144 PolarHBondContact NE-OD2 3.16Å; R138-D144 IonicContact NH2-OD1 3.38Å; R138-D144 PolarHBondContact NH2-OD1 3.48Å; R138-D144 IonicContact NH2-OD2 2.78Å; R138-D144 PolarHBondContact NH2-OD2 3.09Å
139	K	86.6	Confident	83	Confident	145 Å²	145	112.4 Å²	112.4	63%	0.63	56%	0.557	S	S	*	*	H	α-helix	trans	-60.3	-43.6	174.2	-76.4	-177.5	177	-178.3	0	112.1	V135 E136 I141 G142	V135-K139 WeakPolarHBondContact O-CG 3.5Å; V135-K139 PolarHBondContact O-N 3.01Å; E136-K139 PolarHBondContact O-N 3.02Å; K139-I141 VanDerWaalsContact C-N 3.25Å; K139-I141 PolarHBondContact O-N 3.29Å; K139-G142 PolarHBondContact O-N 3.29Å; K139-G142 VanDerWaalsContact O-N 3.09Å
140	Q	86	Confident	82.8	Confident	153 Å²	153	110.8 Å²	110.8	72%	0.715	55%	0.554	S	S	*	*	H	α-helix	trans	-64.3	-29.8	178.3	-73.2	177.9	0.9	0	0	113.2	E136 R137 G142	E136-Q140 WeakPolarHBondContact O-CG 3.48Å; E136-Q140 PolarHBondContact O-N 3.06Å; R137-Q140 PolarHBondContact O-N 3.25Å; Q140-G142 VanDerWaalsContact C-N 3.3Å
141	I	86.2	Confident	82.5	Confident	122 Å²	122	108.4 Å²	108.4	63%	0.626	55%	0.549	S	S	*	.	H	α-helix	trans	-83.6	-7.6	177.7	-56.7	161.3	0	0	0	111.4	R137 R138 K139 I143	R137-I141 WeakPolarHBondContact O-CD1 3.46Å; R137-I141 VanDerWaalsContact O-CG1 3.24Å; R137-I141 WeakPolarHBondContact O-CG1 3.31Å; R137-I141 PolarHBondContact O-N 3.03Å; R138-I141 PolarHBondContact O-N 2.92Å; K139-I141 VanDerWaalsContact C-N 3.25Å; K139-I141 PolarHBondContact O-N 3.29Å; I141-I143 HydrophobicContact CB-CD1 4.11Å; I141-I143 HydrophobicContact CB-CG1 4.28Å; I141-I143 HydrophobicContact CG2-CD1 3.53Å; I141-I143 HydrophobicContact CG2-CG1 3.86Å
142	G	73.6	Confident	82.4	Confident	62 Å²	62	107.8 Å²	107.8	64%	0.639	54%	0.544	S	S	*	.	T	Hydrogen-bonded Turn	trans	72.6	26.2	179.3	0	0	0	0	0	114.1	R138 K139 Q140 D144	R138-G142 PolarHBondContact O-N 2.76Å; K139-G142 PolarHBondContact O-N 3.29Å; K139-G142 VanDerWaalsContact O-N 3.09Å; Q140-G142 VanDerWaalsContact C-N 3.3Å; G142-D144 VanDerWaalsContact C-N 3.34Å
143	I	73.6	Confident	82	Confident	96 Å²	96	108.5 Å²	108.5	49%	0.492	55%	0.546	S	S	.	.			trans	-88	-6.4	-179.1	-65.2	172.6	0	0	0	111.9	R138 I141	R138-I143 PolarHBondContact O-N 3.26Å; I141-I143 HydrophobicContact CB-CD1 4.11Å; I141-I143 HydrophobicContact CB-CG1 4.28Å; I141-I143 HydrophobicContact CG2-CD1 3.53Å; I141-I143 HydrophobicContact CG2-CG1 3.86Å
144	D	55.5	Low	81.3	Confident	147 Å²	147	115 Å²	115	79%	0.786	57%	0.567	S	S	*	*			trans	-126.4	0	174.8	-66.9	-51	0	0	0	111	R138 G142	R138-D144 IonicContact CZ-OD1 3.69Å; R138-D144 IonicContact CZ-OD2 3.64Å; R138-D144 IonicContact NE-OD1 3.17Å; R138-D144 IonicContact NE-OD2 3.89Å; R138-D144 PolarHBondContact NE-OD2 3.16Å; R138-D144 IonicContact NH2-OD1 3.38Å; R138-D144 PolarHBondContact NH2-OD1 3.48Å; R138-D144 IonicContact NH2-OD2 2.78Å; R138-D144 PolarHBondContact NH2-OD2 3.09Å; G142-D144 VanDerWaalsContact C-N 3.34Å

Retrieved 144 of 144 residues in 35.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).