A0A077ZKU6_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZKU6, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 43 aa.

						>A0A077ZKU6_TRITR|A0A077ZKU6
MANGPKTYTASGRMRAPSLTLLCQFVIKAWSKVKTETVVKSFR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	39.2	Very low	74.1	Confident	238 Å²	238	105.5 Å²	105.5	100%	1.172	63%	0.632	S	S	*	*				0	102.7	0	-66.9	170.8	173.9	0	0	108.1	N3	M1-N3 VanDerWaalsContact C-N 3.34Å; M1-N3 PolarHBondContact O-N 3.15Å; M1-N3 VanDerWaalsContact O-N 3.07Å
2	A	53.2	Low	75.4	Confident	102 Å²	102	101 Å²	101	84%	0.843	62%	0.624	S	S	*	*			trans	-83.2	81.8	-179.2	0	0	0	0	0	109.2	G4	A2-G4 VanDerWaalsContact C-N 3.25Å; A2-G4 PolarHBondContact O-N 3.43Å
3	N	61.6	Low	76.5	Confident	121 Å²	121	107.7 Å²	107.7	65%	0.647	63%	0.63	S	S	*	*			trans	-66.9	94.5	163.3	-83.4	-23.7	0	0	0	106.3	M1 K6	M1-N3 VanDerWaalsContact C-N 3.34Å; M1-N3 PolarHBondContact O-N 3.15Å; M1-N3 VanDerWaalsContact O-N 3.07Å; N3-K6 PolarHBondContact OD1-NZ 3.48Å
4	G	65.8	Low	77.5	Confident	25 Å²	25	107.6 Å²	107.6	26%	0.258	62%	0.623	S	S	.	*			trans	-52.7	158.6	163.8	0	0	0	0	0	109.6	A2 K6	A2-G4 VanDerWaalsContact C-N 3.25Å; A2-G4 PolarHBondContact O-N 3.43Å; G4-K6 PolarHBondContact O-N 3.39Å
5	P	70.7	Confident	78.2	Confident	109 Å²	109	109.7 Å²	109.7	71%	0.708	62%	0.616	S	S	*	*			trans	-57.5	105.5	-178.3	22.3	-31.4	0	0	0	109.7	T7	P5-T7 PolarHBondContact O-N 3.09Å
6	K	80.1	Confident	78.8	Confident	107 Å²	107	108.4 Å²	108.4	47%	0.465	62%	0.623	S	S	.	*			trans	-78.1	112.3	174.8	-71.6	172.7	177.6	176.6	0	106.7	N3 G4 Y8 M14	N3-K6 PolarHBondContact OD1-NZ 3.48Å; G4-K6 PolarHBondContact O-N 3.39Å; K6-Y8 HydrophobicContact CB-CE2 3.99Å; K6-M14 HydrophobicContact CB-CE 4.19Å; K6-M14 HydrophobicContact CD-CE 3.5Å; K6-M14 HydrophobicContact CG-CE 3.7Å
7	T	82.9	Confident	79.3	Confident	78 Å²	78	105.7 Å²	105.7	48%	0.479	61%	0.611	S	S	.	*			trans	-100.2	145.5	173	55.9	0	0	0	0	109.2	P5 R15	P5-T7 PolarHBondContact O-N 3.09Å; T7-R15 WeakPolarHBondContact O-CB 3.49Å; T7-R15 PolarHBondContact O-N 2.9Å; T7-R15 WeakPolarHBondContact OG1-CB 3.36Å
8	Y	87.6	Confident	79.8	Confident	127 Å²	127	103.8 Å²	103.8	50%	0.498	61%	0.605	S	S	.	*	B	Isolated β-bridge	trans	-116.2	152.3	-176.5	-67.3	-94.3	0	0	0	110.6	K6 G12 R13 M14 R15	K6-Y8 HydrophobicContact CB-CE2 3.99Å; Y8-G12 WeakPolarHBondContact CD1-O 3.35Å; Y8-R13 CarbonylContact C-O 3.46Å; Y8-R13 VanDerWaalsContact CA-O 3.25Å; Y8-R13 WeakPolarHBondContact CA-O 3.22Å; Y8-M14 HydrophobicContact CE1-CB 4.45Å; Y8-R15 PolarHBondContact O-NE 3.21Å
9	T	90.3	Very high	80.4	Confident	46 Å²	46	105.3 Å²	105.3	28%	0.282	61%	0.609	S	S	.	*			trans	-74	164.5	168	63.1	0	0	0	0	109.6	S11 G12 R13 R15	T9-S11 PolarHBondContact O-N 2.94Å; T9-S11 VanDerWaalsContact O-N 3.15Å; T9-S11 PolarHBondContact OG1-OG 3.36Å; T9-G12 PolarHBondContact O-N 2.9Å; T9-R13 HydrophobicContact CG2-CB 4.33Å; T9-R13 PolarHBondContact N-O 3.29Å; T9-R13 WeakPolarHBondContact OG1-CB 3.3Å; T9-R13 PolarHBondContact OG1-N 3.39Å; T9-R13 PolarHBondContact OG1-O 3.35Å; T9-R15 HydrophobicContact CG2-CG 3.8Å
10	A	90.5	Very high	81	Confident	116 Å²	116	104.8 Å²	104.8	96%	0.959	61%	0.608	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.8	-27.5	173.9	0	0	0	0	0	112.5	G12	A10-G12 VanDerWaalsContact C-N 3.28Å; A10-G12 PolarHBondContact O-N 3.39Å
11	S	93	Very high	81.4	Confident	91 Å²	91	101.3 Å²	101.3	64%	0.636	59%	0.587	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.1	5.4	173.9	55.3	0	0	0	0	114.8	T9 R13	T9-S11 PolarHBondContact O-N 2.94Å; T9-S11 VanDerWaalsContact O-N 3.15Å; T9-S11 PolarHBondContact OG1-OG 3.36Å; S11-R13 PolarHBondContact O-N 3Å
12	G	90.2	Very high	83.9	Confident	52 Å²	52	94 Å²	94	54%	0.536	55%	0.552	S	S	.	*	S	Bend	trans	79.1	8.7	178.2	0	0	0	0	0	115.6	Y8 T9 A10	Y8-G12 WeakPolarHBondContact CD1-O 3.35Å; T9-G12 PolarHBondContact O-N 2.9Å; A10-G12 VanDerWaalsContact C-N 3.28Å; A10-G12 PolarHBondContact O-N 3.39Å
13	R	89.9	Confident	85.9	Confident	188 Å²	188	91.9 Å²	91.9	71%	0.709	53%	0.531	S	S	*	.	P	Polyproline II helix	trans	-79.3	143.9	174.4	-59.8	-177	-179.6	173.4	-0.5	110.2	Y8 T9 S11 R15	Y8-R13 CarbonylContact C-O 3.46Å; Y8-R13 VanDerWaalsContact CA-O 3.25Å; Y8-R13 WeakPolarHBondContact CA-O 3.22Å; T9-R13 HydrophobicContact CG2-CB 4.33Å; T9-R13 PolarHBondContact N-O 3.29Å; T9-R13 WeakPolarHBondContact OG1-CB 3.3Å; T9-R13 PolarHBondContact OG1-N 3.39Å; T9-R13 PolarHBondContact OG1-O 3.35Å; S11-R13 PolarHBondContact O-N 3Å; R13-R15 PolarHBondContact O-N 3.37Å
14	M	90	Very high	87.4	Confident	107 Å²	107	90.5 Å²	90.5	53%	0.527	52%	0.52	S	S	.	.	B	Isolated β-bridge	trans	-64.2	128.7	172.3	-176.1	174.5	-73.9	0	0	109.4	K6 Y8	K6-M14 HydrophobicContact CB-CE 4.19Å; K6-M14 HydrophobicContact CD-CE 3.5Å; K6-M14 HydrophobicContact CG-CE 3.7Å; Y8-M14 HydrophobicContact CE1-CB 4.45Å
15	R	88.4	Confident	88.6	Confident	138 Å²	138	93.8 Å²	93.8	52%	0.521	53%	0.528	S	S	.	.	P	Polyproline II helix	trans	-73.3	143	172.2	-67.9	-176	-178.9	-155.8	-4.5	109.4	T7 Y8 T9 R13	T7-R15 WeakPolarHBondContact O-CB 3.49Å; T7-R15 PolarHBondContact O-N 2.9Å; T7-R15 WeakPolarHBondContact OG1-CB 3.36Å; Y8-R15 PolarHBondContact O-NE 3.21Å; T9-R15 HydrophobicContact CG2-CG 3.8Å; R13-R15 PolarHBondContact O-N 3.37Å
16	A	88	Confident	89.7	Confident	89 Å²	89	92.5 Å²	92.5	74%	0.736	52%	0.518	S	S	*	.	P	Polyproline II helix	trans	-56.8	138.4	169.5	0	0	0	0	0	109.6
17	P	86.1	Confident	90.5	Very high	63 Å²	63	92.4 Å²	92.4	41%	0.409	52%	0.521	S	S	.	.	P	Polyproline II helix	trans	-52.3	148.2	169	-28.1	36.8	0	0	0	111.5	L21 L22	P17-L21 HydrophobicContact CB-CB 4.33Å; P17-L21 HydrophobicContact CB-CD2 4.03Å; P17-L21 HydrophobicContact CB-CG 4.33Å; P17-L22 HydrophobicContact CB-CD2 3.84Å; P17-L22 HydrophobicContact CB-CG 4.02Å; P17-L22 HydrophobicContact CG-CD2 4.14Å
18	S	88.1	Confident	91	Very high	71 Å²	71	95 Å²	95	50%	0.497	53%	0.526	S	S	.	.	P	Polyproline II helix	trans	-64.1	153.4	169.6	62.3	0	0	0	0	110.6	T20 L21 L22	S18-T20 PolarHBondContact O-N 3.4Å; S18-L21 WeakPolarHBondContact O-CB 3.4Å; S18-L21 PolarHBondContact O-N 3.15Å; S18-L21 WeakPolarHBondContact OG-CB 3.49Å; S18-L21 PolarHBondContact OG-N 3.16Å; S18-L22 PolarHBondContact O-N 3.35Å
19	L	91.4	Very high	91.3	Very high	133 Å²	133	91.7 Å²	91.7	70%	0.696	53%	0.525	S	S	*	.	H	α-helix	trans	-52.4	-42.2	174.6	179.2	61.8	0	0	0	111.4	L21 L22 C23	L19-L21 VanDerWaalsContact C-N 3.32Å; L19-L21 PolarHBondContact O-N 3.45Å; L19-L22 WeakPolarHBondContact O-CB 3.43Å; L19-L22 PolarHBondContact O-N 3.07Å; L19-C23 PolarHBondContact O-N 2.89Å; L19-C23 PolarHBondContact O-SG 3.07Å
20	T	92.6	Very high	91.5	Very high	94 Å²	94	97.1 Å²	97.1	58%	0.577	54%	0.54	S	S	*	.	H	α-helix	trans	-56.6	-44.2	175.7	-49.4	0	0	0	0	112.4	S18 C23 Q24	S18-T20 PolarHBondContact O-N 3.4Å; T20-C23 PolarHBondContact O-N 2.75Å; T20-Q24 WeakPolarHBondContact O-CG 3.49Å; T20-Q24 PolarHBondContact O-N 2.99Å
21	L	89.5	Confident	91.6	Very high	33 Å²	33	96.2 Å²	96.2	17%	0.173	53%	0.527	C	S	.	.	H	α-helix	trans	-68.1	-39.3	179.1	-176.1	57.9	0	0	0	111.3	P17 S18 L19 Q24 F25	P17-L21 HydrophobicContact CB-CB 4.33Å; P17-L21 HydrophobicContact CB-CD2 4.03Å; P17-L21 HydrophobicContact CB-CG 4.33Å; S18-L21 WeakPolarHBondContact O-CB 3.4Å; S18-L21 PolarHBondContact O-N 3.15Å; S18-L21 WeakPolarHBondContact OG-CB 3.49Å; S18-L21 PolarHBondContact OG-N 3.16Å; L19-L21 VanDerWaalsContact C-N 3.32Å; L19-L21 PolarHBondContact O-N 3.45Å; L21-Q24 PolarHBondContact O-N 2.82Å; L21-F25 HydrophobicContact CD1-CE1 4.24Å; L21-F25 HydrophobicContact CD1-CE2 4.06Å; L21-F25 HydrophobicContact CD1-CZ 3.81Å; L21-F25 HydrophobicContact CD2-CE2 4.2Å; L21-F25 HydrophobicContact CD2-CZ 4.29Å; L21-F25 HydrophobicContact CG-CD2 4.31Å; L21-F25 HydrophobicContact CG-CE2 3.67Å; L21-F25 HydrophobicContact CG-CZ 3.89Å; L21-F25 VanDerWaalsContact O-CD2 3.3Å; L21-F25 WeakPolarHBondContact O-CD2 3.22Å; L21-F25 WeakPolarHBondContact O-CG 3.34Å; L21-F25 PolarHBondContact O-N 3.24Å
22	L	91.2	Very high	91.7	Very high	83 Å²	83	100.3 Å²	100.3	44%	0.435	53%	0.534	S	S	.	.	H	α-helix	trans	-60.7	-47.4	173.5	-64.9	175.7	0	0	0	111.4	P17 S18 L19 Q24 F25 V26	P17-L22 HydrophobicContact CB-CD2 3.84Å; P17-L22 HydrophobicContact CB-CG 4.02Å; P17-L22 HydrophobicContact CG-CD2 4.14Å; S18-L22 PolarHBondContact O-N 3.35Å; L19-L22 WeakPolarHBondContact O-CB 3.43Å; L19-L22 PolarHBondContact O-N 3.07Å; L22-Q24 VanDerWaalsContact C-N 3.32Å; L22-Q24 PolarHBondContact O-N 3.21Å; L22-F25 WeakPolarHBondContact O-CB 3.47Å; L22-F25 PolarHBondContact O-N 2.92Å; L22-F25 VanDerWaalsContact O-N 3.14Å; L22-V26 WeakPolarHBondContact O-CG2 3.43Å; L22-V26 PolarHBondContact O-N 3.44Å
23	C	95	Very high	91.9	Very high	59 Å²	59	100.7 Å²	100.7	40%	0.399	53%	0.525	S	S	.	.	H	α-helix	trans	-59.3	-43.2	176.1	-67.4	0	0	0	0	111.5	L19 T20 F25 V26 I27	L19-C23 PolarHBondContact O-N 2.89Å; L19-C23 PolarHBondContact O-SG 3.07Å; T20-C23 PolarHBondContact O-N 2.75Å; C23-F25 VanDerWaalsContact C-N 3.31Å; C23-F25 PolarHBondContact O-N 3.48Å; C23-V26 PolarHBondContact O-N 2.94Å; C23-I27 WeakPolarHBondContact O-CB 3.26Å; C23-I27 VanDerWaalsContact O-CG1 3.24Å; C23-I27 WeakPolarHBondContact O-CG1 3.36Å; C23-I27 PolarHBondContact O-N 2.86Å
24	Q	93.7	Very high	92	Very high	92 Å²	92	98.6 Å²	98.6	43%	0.43	52%	0.521	S	S	.	.	H	α-helix	trans	-61.8	-37.2	176.1	-76.3	-178.6	-4.7	0	0	112.8	T20 L21 L22 K28	T20-Q24 WeakPolarHBondContact O-CG 3.49Å; T20-Q24 PolarHBondContact O-N 2.99Å; L21-Q24 PolarHBondContact O-N 2.82Å; L22-Q24 VanDerWaalsContact C-N 3.32Å; L22-Q24 PolarHBondContact O-N 3.21Å; Q24-K28 VanDerWaalsContact O-CB 3.26Å; Q24-K28 WeakPolarHBondContact O-CB 3.24Å; Q24-K28 WeakPolarHBondContact O-CG 3.45Å; Q24-K28 PolarHBondContact O-N 3.06Å
25	F	91.6	Very high	92.1	Very high	94 Å²	94	98.8 Å²	98.8	41%	0.412	53%	0.528	S	S	.	.	H	α-helix	trans	-64.3	-45.7	174.5	-69.7	-42.7	0	0	0	111.7	L21 L22 C23 K28 A29	L21-F25 HydrophobicContact CD1-CE1 4.24Å; L21-F25 HydrophobicContact CD1-CE2 4.06Å; L21-F25 HydrophobicContact CD1-CZ 3.81Å; L21-F25 HydrophobicContact CD2-CE2 4.2Å; L21-F25 HydrophobicContact CD2-CZ 4.29Å; L21-F25 HydrophobicContact CG-CD2 4.31Å; L21-F25 HydrophobicContact CG-CE2 3.67Å; L21-F25 HydrophobicContact CG-CZ 3.89Å; L21-F25 VanDerWaalsContact O-CD2 3.3Å; L21-F25 WeakPolarHBondContact O-CD2 3.22Å; L21-F25 WeakPolarHBondContact O-CG 3.34Å; L21-F25 PolarHBondContact O-N 3.24Å; L22-F25 WeakPolarHBondContact O-CB 3.47Å; L22-F25 PolarHBondContact O-N 2.92Å; L22-F25 VanDerWaalsContact O-N 3.14Å; C23-F25 VanDerWaalsContact C-N 3.31Å; C23-F25 PolarHBondContact O-N 3.48Å; F25-K28 PolarHBondContact O-N 3.24Å; F25-A29 WeakPolarHBondContact O-CB 3.3Å; F25-A29 PolarHBondContact O-N 3.4Å
26	V	94.2	Very high	92.4	Very high	82 Å²	82	99.3 Å²	99.3	50%	0.497	54%	0.537	S	S	.	.	H	α-helix	trans	-61.9	-48.4	178.1	174.8	0	0	0	0	110.6	L22 C23 K28 A29 W30	L22-V26 WeakPolarHBondContact O-CG2 3.43Å; L22-V26 PolarHBondContact O-N 3.44Å; C23-V26 PolarHBondContact O-N 2.94Å; V26-K28 PolarHBondContact O-N 3.14Å; V26-A29 PolarHBondContact O-N 3.01Å; V26-W30 WeakPolarHBondContact O-CB 3.46Å; V26-W30 VanDerWaalsContact O-CD1 3.3Å; V26-W30 PolarHBondContact O-N 3.4Å
27	I	95.2	Very high	92.6	Very high	105 Å²	105	98.7 Å²	98.7	54%	0.538	52%	0.524	S	S	.	.	H	α-helix	trans	-60.6	-48.4	178.8	-67.8	164.2	0	0	0	110.5	C23 A29 W30 S31	C23-I27 WeakPolarHBondContact O-CB 3.26Å; C23-I27 VanDerWaalsContact O-CG1 3.24Å; C23-I27 WeakPolarHBondContact O-CG1 3.36Å; C23-I27 PolarHBondContact O-N 2.86Å; I27-A29 VanDerWaalsContact C-N 3.28Å; I27-A29 PolarHBondContact O-N 3.23Å; I27-W30 PolarHBondContact O-N 2.93Å; I27-S31 WeakPolarHBondContact O-CB 3.49Å; I27-S31 PolarHBondContact O-N 3.01Å; I27-S31 PolarHBondContact O-OG 2.82Å; I27-S31 VanDerWaalsContact O-OG 3.07Å
28	K	94.8	Very high	92.9	Very high	131 Å²	131	97.7 Å²	97.7	57%	0.57	52%	0.517	S	S	*	.	H	α-helix	trans	-62.3	-35.8	178.8	-76.8	175.1	179	174.8	0	112.6	Q24 F25 V26 K32	Q24-K28 VanDerWaalsContact O-CB 3.26Å; Q24-K28 WeakPolarHBondContact O-CB 3.24Å; Q24-K28 WeakPolarHBondContact O-CG 3.45Å; Q24-K28 PolarHBondContact O-N 3.06Å; F25-K28 PolarHBondContact O-N 3.24Å; V26-K28 PolarHBondContact O-N 3.14Å; K28-K32 WeakPolarHBondContact O-CG 3.46Å
29	A	93.3	Very high	93.2	Very high	59 Å²	59	97.4 Å²	97.4	49%	0.488	51%	0.512	S	S	.	.	H	α-helix	trans	-66.4	-49.9	174.9	0	0	0	0	0	110.2	F25 V26 I27 S31 K32	F25-A29 WeakPolarHBondContact O-CB 3.3Å; F25-A29 PolarHBondContact O-N 3.4Å; V26-A29 PolarHBondContact O-N 3.01Å; I27-A29 VanDerWaalsContact C-N 3.28Å; I27-A29 PolarHBondContact O-N 3.23Å; A29-S31 PolarHBondContact O-N 3.18Å; A29-K32 WeakPolarHBondContact O-CB 3.47Å; A29-K32 PolarHBondContact O-N 3.32Å; A29-K32 VanDerWaalsContact O-N 3.15Å
30	W	94.1	Very high	93.4	Very high	159 Å²	159	99.2 Å²	99.2	60%	0.602	51%	0.514	S	S	*	.	H	α-helix	trans	-62	-40.3	178.9	-87.8	106.2	0	0	0	113.5	V26 I27 K32 V33 V38	V26-W30 WeakPolarHBondContact O-CB 3.46Å; V26-W30 VanDerWaalsContact O-CD1 3.3Å; V26-W30 PolarHBondContact O-N 3.4Å; I27-W30 PolarHBondContact O-N 2.93Å; W30-K32 PolarHBondContact O-N 3.32Å; W30-K32 VanDerWaalsContact O-N 3.16Å; W30-V33 HydrophobicContact CE3-CB 4.45Å; W30-V33 HydrophobicContact CE3-CG2 4.45Å; W30-V33 WeakPolarHBondContact O-CB 3.49Å; W30-V33 PolarHBondContact O-N 3.36Å; W30-V38 HydrophobicContact CZ3-CG2 4.09Å
31	S	93.7	Very high	93.4	Very high	98 Å²	98	99 Å²	99	69%	0.685	52%	0.517	S	S	*	.	H	α-helix	trans	-63.7	-19.9	177	-61.9	0	0	0	0	113.7	I27 A29	I27-S31 WeakPolarHBondContact O-CB 3.49Å; I27-S31 PolarHBondContact O-N 3.01Å; I27-S31 PolarHBondContact O-OG 2.82Å; I27-S31 VanDerWaalsContact O-OG 3.07Å; A29-S31 PolarHBondContact O-N 3.18Å
32	K	94.7	Very high	93.5	Very high	177 Å²	177	105.9 Å²	105.9	77%	0.77	55%	0.545	S	S	*	.	H	α-helix	trans	-85.3	-17.5	174.4	-70.2	177.6	178.9	-174.4	0	112.9	K28 A29 W30 K34	K28-K32 WeakPolarHBondContact O-CG 3.46Å; A29-K32 WeakPolarHBondContact O-CB 3.47Å; A29-K32 PolarHBondContact O-N 3.32Å; A29-K32 VanDerWaalsContact O-N 3.15Å; W30-K32 PolarHBondContact O-N 3.32Å; W30-K32 VanDerWaalsContact O-N 3.16Å; K32-K34 PolarHBondContact O-N 2.97Å
33	V	93.7	Very high	93.1	Very high	59 Å²	59	114.5 Å²	114.5	36%	0.358	57%	0.572	S	S	.	*	S	Bend	trans	-75.5	123	178.5	-176.2	0	0	0	0	108.1	W30 T37 V38	W30-V33 HydrophobicContact CE3-CB 4.45Å; W30-V33 HydrophobicContact CE3-CG2 4.45Å; W30-V33 WeakPolarHBondContact O-CB 3.49Å; W30-V33 PolarHBondContact O-N 3.36Å; V33-T37 HydrophobicContact CG1-CG2 4.43Å; V33-V38 HydrophobicContact CG1-CG2 3.71Å
34	K	92.8	Very high	93	Very high	144 Å²	144	117.3 Å²	117.3	63%	0.626	58%	0.581	S	S	*	*			trans	-67.1	137	173.7	-66.2	-175.9	178.4	-175	0	109.4	K32 E36 T37 V38	K32-K34 PolarHBondContact O-N 2.97Å; K34-E36 PolarHBondContact O-N 2.95Å; K34-E36 VanDerWaalsContact O-N 3.15Å; K34-T37 VanDerWaalsContact O-CB 3.3Å; K34-T37 WeakPolarHBondContact O-CB 3.5Å; K34-T37 PolarHBondContact O-N 2.86Å; K34-V38 PolarHBondContact O-N 2.83Å
35	T	92.4	Very high	92.9	Very high	111 Å²	111	118.6 Å²	118.6	68%	0.681	59%	0.589	S	S	*	*	H	α-helix	trans	-53.5	-37.3	176.4	-49	0	0	0	0	112.1	T37 V38 V39	T35-T37 VanDerWaalsContact C-N 3.31Å; T35-T37 PolarHBondContact O-N 3.37Å; T35-V38 WeakPolarHBondContact O-CB 3.48Å; T35-V38 PolarHBondContact O-N 3.47Å; T35-V38 VanDerWaalsContact O-N 3.09Å; T35-V39 HydrophobicContact CG2-CG2 4.38Å; T35-V39 WeakPolarHBondContact O-CG2 3.46Å; T35-V39 PolarHBondContact O-N 2.89Å
36	E	93.5	Very high	93	Very high	149 Å²	149	120 Å²	120	70%	0.696	60%	0.599	S	S	*	*	H	α-helix	trans	-58.1	-39.3	175.5	-64.8	173.5	178.1	0	0	113.3	K34 V38 V39 K40	K34-E36 PolarHBondContact O-N 2.95Å; K34-E36 VanDerWaalsContact O-N 3.15Å; E36-V38 VanDerWaalsContact C-N 3.29Å; E36-V38 PolarHBondContact O-N 2.99Å; E36-V39 PolarHBondContact O-N 3.41Å; E36-K40 WeakPolarHBondContact O-CB 3.41Å; E36-K40 PolarHBondContact O-N 3.27Å
37	T	93.7	Very high	92.9	Very high	76 Å²	76	122.2 Å²	122.2	47%	0.466	61%	0.605	S	S	.	*	H	α-helix	trans	-63.3	-40.4	176.4	-55.1	0	0	0	0	110.5	V33 K34 T35 S41	V33-T37 HydrophobicContact CG1-CG2 4.43Å; K34-T37 VanDerWaalsContact O-CB 3.3Å; K34-T37 WeakPolarHBondContact O-CB 3.5Å; K34-T37 PolarHBondContact O-N 2.86Å; T35-T37 VanDerWaalsContact C-N 3.31Å; T35-T37 PolarHBondContact O-N 3.37Å; T37-S41 PolarHBondContact O-N 3.22Å; T37-S41 PolarHBondContact O-OG 2.81Å
38	V	92	Very high	92.8	Very high	42 Å²	42	123.3 Å²	123.3	26%	0.255	61%	0.609	S	S	.	*	H	α-helix	trans	-64.3	-52.8	175.6	-173.3	0	0	0	0	109.8	W30 V33 K34 T35 E36 K40 S41 F42	W30-V38 HydrophobicContact CZ3-CG2 4.09Å; V33-V38 HydrophobicContact CG1-CG2 3.71Å; K34-V38 PolarHBondContact O-N 2.83Å; T35-V38 WeakPolarHBondContact O-CB 3.48Å; T35-V38 PolarHBondContact O-N 3.47Å; T35-V38 VanDerWaalsContact O-N 3.09Å; E36-V38 VanDerWaalsContact C-N 3.29Å; E36-V38 PolarHBondContact O-N 2.99Å; V38-K40 VanDerWaalsContact C-N 3.31Å; V38-K40 PolarHBondContact O-N 2.77Å; V38-S41 WeakPolarHBondContact O-CB 3.44Å; V38-S41 PolarHBondContact O-N 3.15Å; V38-F42 HydrophobicContact CG1-CD2 3.95Å; V38-F42 HydrophobicContact CG1-CE2 3.75Å; V38-F42 VanDerWaalsContact O-CD2 3.22Å; V38-F42 WeakPolarHBondContact O-CD2 3.25Å; V38-F42 PolarHBondContact O-N 3.46Å
39	V	94.1	Very high	92.7	Very high	66 Å²	66	122.8 Å²	122.8	40%	0.4	61%	0.611	S	S	.	*	H	α-helix	trans	-56.5	-42.9	180	173.9	0	0	0	0	112	T35 E36 S41 F42 R43	T35-V39 HydrophobicContact CG2-CG2 4.38Å; T35-V39 WeakPolarHBondContact O-CG2 3.46Å; T35-V39 PolarHBondContact O-N 2.89Å; E36-V39 PolarHBondContact O-N 3.41Å; V39-S41 VanDerWaalsContact C-N 3.27Å; V39-S41 PolarHBondContact O-N 2.99Å; V39-F42 PolarHBondContact O-N 3.35Å; V39-R43 PolarHBondContact O-N 3.37Å
40	K	94.7	Very high	92.6	Very high	170 Å²	170	127.4 Å²	127.4	74%	0.739	62%	0.62	S	S	*	*	H	α-helix	trans	-66.6	-27.2	178.2	-172.3	176.2	179.9	-179.9	0	113.1	E36 V38 F42	E36-K40 WeakPolarHBondContact O-CB 3.41Å; E36-K40 PolarHBondContact O-N 3.27Å; V38-K40 VanDerWaalsContact C-N 3.31Å; V38-K40 PolarHBondContact O-N 2.77Å; K40-F42 VanDerWaalsContact C-N 3.32Å
41	S	93.5	Very high	92.5	Very high	90 Å²	90	124.9 Å²	124.9	63%	0.629	62%	0.622	S	S	*	*	H	α-helix	trans	-78.7	-18.3	-179.5	-55.1	0	0	0	0	113	T37 V38 V39	T37-S41 PolarHBondContact O-N 3.22Å; T37-S41 PolarHBondContact O-OG 2.81Å; V38-S41 WeakPolarHBondContact O-CB 3.44Å; V38-S41 PolarHBondContact O-N 3.15Å; V39-S41 VanDerWaalsContact C-N 3.27Å; V39-S41 PolarHBondContact O-N 2.99Å
42	F	91.9	Very high	92.4	Very high	177 Å²	177	127.2 Å²	127.2	78%	0.776	62%	0.616	S	S	*	*	T	Hydrogen-bonded Turn	trans	-109.1	8.5	179.7	-68.4	-74.8	0	0	0	113.6	V38 V39 K40	V38-F42 HydrophobicContact CG1-CD2 3.95Å; V38-F42 HydrophobicContact CG1-CE2 3.75Å; V38-F42 VanDerWaalsContact O-CD2 3.22Å; V38-F42 WeakPolarHBondContact O-CD2 3.25Å; V38-F42 PolarHBondContact O-N 3.46Å; V39-F42 PolarHBondContact O-N 3.35Å; K40-F42 VanDerWaalsContact C-N 3.32Å
43	R	82	Confident	92.2	Very high	265 Å²	265	122.6 Å²	122.6	100%	1	60%	0.602	S	S	*	*			trans	-108.3	0	170.2	-77.1	-175.6	178.9	-171	0.4	109.3	V39	V39-R43 PolarHBondContact O-N 3.37Å

Retrieved 43 of 43 residues in 13.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).