A0A077ZKU8_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZKU8, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 144 aa.

						>A0A077ZKU8_TRITR|A0A077ZKU8
MVPIAVNFSYVHKKATRRLGTVDGLRPGDLDRSSSRRPSVHVKSGVNMVTAKELTATRLGTVDGLRPGDLDRATSRRPSVRVKNGVNMVTAKELTATRSPGLKPSTVPSLRVAGLQASATTPGGDRCGQIAQMPSLTLSSIRWE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	39.7	Very low	34.4	Very low	212 Å²	212	105.1 Å²	105.1	100%	1.044	56%	0.562	S	S	*	*				0	114.4	0	-160	159.6	124.6	0	0	106.9
2	V	31.5	Very low	34.7	Very low	106 Å²	106	107.8 Å²	107.8	64%	0.642	57%	0.568	S	S	*	*			trans	-96.5	128	-174.2	-178.8	0	0	0	0	109	T121	V2-T121 HydrophobicContact CG1-CG2 4.41Å
3	P	33.4	Very low	34.7	Very low	63 Å²	63	114.1 Å²	114.1	41%	0.409	59%	0.588	S	S	.	*			trans	-70.5	133.8	175.5	25	-29.7	0	0	0	111.8	M88 P122	P3-M88 HydrophobicContact CB-CE 3.72Å; P3-M88 HydrophobicContact CB-CG 3.84Å; P3-M88 HydrophobicContact CB-SD 3.24Å; P3-M88 WeakPolarHBondContact CB-SD 3.48Å; P3-M88 HydrophobicContact CG-SD 4.08Å; P3-P122 WeakPolarHBondContact O-CD 3.16Å
4	I	31.8	Very low	34.7	Very low	80 Å²	80	120 Å²	120	41%	0.41	61%	0.607	S	S	.	*			trans	-106.8	128.6	171.4	-59.5	175.6	0	0	0	108.1	V6 A119	I4-V6 HydrophobicContact CG2-CG2 4.26Å; I4-A119 HydrophobicContact CG2-CB 3.71Å
5	A	33.4	Very low	34.9	Very low	15 Å²	15	117.5 Å²	117.5	12%	0.124	61%	0.613	C	S	.	*	E	Extended strand (participates in β ladder)	trans	-86.9	131.4	168.9	0	0	0	0	0	109.3	V86	A5-V86 HydrophobicContact CB-CG1 3.47Å; A5-V86 VanDerWaalsContact CB-CG1 3.47Å
6	V	34.8	Very low	34.7	Very low	35 Å²	35	118.1 Å²	118.1	21%	0.212	62%	0.623	C	S	.	*	E	Extended strand (participates in β ladder)	trans	-119.2	119.2	174.9	-174.4	0	0	0	0	108.7	I4 F8 A117	I4-V6 HydrophobicContact CG2-CG2 4.26Å; V6-F8 HydrophobicContact CB-CE2 4.34Å; V6-F8 HydrophobicContact CG1-CD2 4.4Å; V6-F8 HydrophobicContact CG1-CE1 4.06Å; V6-F8 HydrophobicContact CG1-CE2 3.8Å; V6-F8 HydrophobicContact CG1-CZ 3.62Å; V6-A117 HydrophobicContact CG1-CB 3.99Å
7	N	35.5	Very low	35	Very low	131 Å²	131	124.4 Å²	124.4	70%	0.701	64%	0.636	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-96.8	129.8	173.4	-88.3	-43.8	0	0	0	110.2
8	F	35.7	Very low	35.2	Very low	124 Å²	124	131.2 Å²	131.2	54%	0.544	65%	0.653	S	S	.	*			trans	-107.1	119.8	173.4	-64.2	-77.3	0	0	0	110.1	V6 L115 A117	V6-F8 HydrophobicContact CB-CE2 4.34Å; V6-F8 HydrophobicContact CG1-CD2 4.4Å; V6-F8 HydrophobicContact CG1-CE1 4.06Å; V6-F8 HydrophobicContact CG1-CE2 3.8Å; V6-F8 HydrophobicContact CG1-CZ 3.62Å; F8-L115 HydrophobicContact CD1-CD2 3.68Å; F8-L115 HydrophobicContact CE1-CD2 3.61Å; F8-A117 HydrophobicContact CE1-CB 4.25Å
9	S	31.9	Very low	35.3	Very low	105 Å²	105	133.8 Å²	133.8	73%	0.734	67%	0.668	S	S	*	*			trans	-104.7	120.7	171	-71.5	0	0	0	0	109.8
10	Y	34.5	Very low	35.4	Very low	169 Å²	169	130.4 Å²	130.4	66%	0.663	67%	0.669	S	S	*	*			trans	-92.6	121.4	175.4	-167.1	-85	0	0	0	110.7	H12	Y10-H12 AromaticContact CD1-ND1 3.33Å; Y10-H12 VanDerWaalsContact CD1-ND1 3.33Å; Y10-H12 WeakPolarHBondContact CD1-ND1 3.4Å; Y10-H12 AromaticContact CE1-CE1 3.66Å; Y10-H12 AromaticContact CE1-CG 3.98Å; Y10-H12 AromaticContact CE1-ND1 3.14Å; Y10-H12 WeakPolarHBondContact CE1-ND1 3.24Å
11	V	36.9	Very low	35.2	Very low	116 Å²	116	130.4 Å²	130.4	70%	0.703	68%	0.675	S	S	*	*			trans	-92.5	111.3	172.4	-179.9	0	0	0	0	108.9	K13	V11-K13 PolarHBondContact O-N 3.36Å
12	H	37.8	Very low	35.1	Very low	137 Å²	137	127 Å²	127	63%	0.634	67%	0.666	S	S	*	*			trans	-76.8	108.7	173.7	-114.4	69.9	0	0	0	109.8	Y10	Y10-H12 AromaticContact CD1-ND1 3.33Å; Y10-H12 VanDerWaalsContact CD1-ND1 3.33Å; Y10-H12 WeakPolarHBondContact CD1-ND1 3.4Å; Y10-H12 AromaticContact CE1-CE1 3.66Å; Y10-H12 AromaticContact CE1-CG 3.98Å; Y10-H12 AromaticContact CE1-ND1 3.14Å; Y10-H12 WeakPolarHBondContact CE1-ND1 3.24Å
13	K	34.3	Very low	35.1	Very low	190 Å²	190	129.1 Å²	129.1	83%	0.826	67%	0.673	S	S	*	*			trans	-84.5	121.8	162.5	-81.2	-172.4	175.4	-178.6	0	108.8	V11 A15	V11-K13 PolarHBondContact O-N 3.36Å; K13-A15 PolarHBondContact O-N 3.25Å; K13-A15 VanDerWaalsContact O-N 3.16Å
14	K	34.9	Very low	35.1	Very low	197 Å²	197	129.5 Å²	129.5	86%	0.857	69%	0.689	S	S	*	*			trans	-65.8	108.7	177.4	-172.4	178.5	-177.6	-179.5	0	109.5
15	A	37.1	Very low	35.3	Very low	83 Å²	83	133.9 Å²	133.9	69%	0.686	71%	0.713	S	S	*	*			trans	-94.4	107.3	170.8	0	0	0	0	0	109.6	K13 R17	K13-A15 PolarHBondContact O-N 3.25Å; K13-A15 VanDerWaalsContact O-N 3.16Å; A15-R17 PolarHBondContact O-N 2.95Å
16	T	32.8	Very low	35.4	Very low	127 Å²	127	144 Å²	144	78%	0.779	75%	0.748	S	S	*	*			trans	-70.8	100.1	165.1	37.6	0	0	0	0	109.1
17	R	39.9	Very low	35.6	Very low	224 Å²	224	148.9 Å²	148.9	85%	0.845	78%	0.78	S	S	*	*			trans	-108.2	119.9	166.8	-75.3	-169	177.1	-167	0.6	109.5	A15 L19	A15-R17 PolarHBondContact O-N 2.95Å; R17-L19 PolarHBondContact O-N 3.26Å
18	R	37.6	Very low	35.6	Very low	247 Å²	247	145.4 Å²	145.4	93%	0.932	78%	0.775	S	S	*	*			trans	-61.5	124.5	177.6	-62.1	171.5	81.2	-178.3	4	108.5	G20	R18-G20 PolarHBondContact O-N 3.16Å
19	L	37.5	Very low	35.8	Very low	181 Å²	181	146.3 Å²	146.3	95%	0.948	79%	0.786	S	S	*	*			trans	-70.2	109.3	179.2	-122.7	82.7	0	0	0	109.1	R17	R17-L19 PolarHBondContact O-N 3.26Å
20	G	37	Very low	36.2	Very low	66 Å²	66	148.5 Å²	148.5	68%	0.68	79%	0.788	S	S	*	*			trans	-95.6	127.7	164.2	0	0	0	0	0	108.9	R18	R18-G20 PolarHBondContact O-N 3.16Å
21	T	30.6	Very low	36.4	Very low	130 Å²	130	147.1 Å²	147.1	80%	0.798	79%	0.792	S	S	*	*			trans	-50.7	124.6	-174.3	-15.1	0	0	0	0	113.1
22	V	37.8	Very low	36.3	Very low	142 Å²	142	153.1 Å²	153.1	86%	0.861	80%	0.802	S	S	*	*			trans	-123.5	118.2	155.8	177.3	0	0	0	0	106.5
23	D	33.2	Very low	36.1	Very low	149 Å²	149	151.7 Å²	151.7	80%	0.797	81%	0.808	S	S	*	*			trans	-54.4	145.6	-172.5	-62.2	-62.4	0	0	0	114.3
24	G	32.1	Very low	36.1	Very low	72 Å²	72	147.3 Å²	147.3	74%	0.742	80%	0.801	S	S	*	*			trans	127	-3.4	142.5	0	0	0	0	0	119.5
25	L	36.8	Very low	35.9	Very low	172 Å²	172	142.9 Å²	142.9	90%	0.901	80%	0.795	S	S	*	*			trans	-113	104.2	-177.7	-62.7	178.7	0	0	0	112.2
26	R	34.8	Very low	35.8	Very low	227 Å²	227	150.6 Å²	150.6	86%	0.857	81%	0.807	S	S	*	*			trans	-47.3	128.1	172.8	-95.2	-179.5	165.2	-179.7	-3.8	110.8	G28	R26-G28 PolarHBondContact O-N 3.31Å; R26-G28 VanDerWaalsContact O-N 3.1Å
27	P	39.8	Very low	35.9	Very low	138 Å²	138	155.7 Å²	155.7	90%	0.896	81%	0.811	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.7	94.8	173	30.8	-29.6	0	0	0	108.1
28	G	35.4	Very low	35.8	Very low	58 Å²	58	150.7 Å²	150.7	60%	0.598	81%	0.808	S	S	*	*	T	Hydrogen-bonded Turn	trans	-168.5	-30	179.8	0	0	0	0	0	116.1	R26	R26-G28 PolarHBondContact O-N 3.31Å; R26-G28 VanDerWaalsContact O-N 3.1Å
29	D	40	Very low	35.5	Very low	143 Å²	143	143 Å²	143	77%	0.765	79%	0.792	S	S	*	*	S	Bend	trans	-107.9	4.2	-170.5	-67.9	-51.2	0	0	0	114.8	D31	D29-D31 VanDerWaalsContact C-N 3.27Å; D29-D31 PolarHBondContact O-N 3.46Å
30	L	38.8	Very low	35.5	Very low	150 Å²	150	140.2 Å²	140.2	79%	0.785	78%	0.782	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.3	19.4	-179.2	-148.4	92.9	0	0	0	113.9
31	D	38.9	Very low	35.3	Very low	140 Å²	140	145.1 Å²	145.1	75%	0.749	79%	0.787	S	S	*	*	T	Hydrogen-bonded Turn	trans	-111.3	-0.1	-174.2	-129	9.5	0	0	0	114.3	D29	D29-D31 VanDerWaalsContact C-N 3.27Å; D29-D31 PolarHBondContact O-N 3.46Å
32	R	35.3	Very low	35.5	Very low	242 Å²	242	143.9 Å²	143.9	91%	0.913	78%	0.779	S	S	*	*	S	Bend	trans	-114.6	-5.4	178.5	-91.1	-179.4	171.6	149.5	-1.9	116.2
33	S	33.9	Very low	35.1	Very low	107 Å²	107	146.6 Å²	146.6	75%	0.748	78%	0.78	S	S	*	*	S	Bend	trans	-98.9	-0.6	-175.7	-42.6	0	0	0	0	113.7	S35	S33-S35 PolarHBondContact O-N 2.95Å
34	S	33.6	Very low	34.8	Very low	98 Å²	98	145.6 Å²	145.6	69%	0.685	78%	0.784	S	S	*	*			trans	-96.1	36.4	-172	62.4	0	0	0	0	113.9
35	S	32.2	Very low	34.6	Very low	105 Å²	105	145 Å²	145	73%	0.734	78%	0.777	S	S	*	*			trans	-136.6	19.7	-178.1	-162.8	0	0	0	0	116.2	S33	S33-S35 PolarHBondContact O-N 2.95Å
36	R	33.6	Very low	34.4	Very low	245 Å²	245	143.4 Å²	143.4	93%	0.925	78%	0.775	S	S	*	*			trans	-108.3	84.5	167.6	-75.6	-171.9	-178.1	-137.9	1.8	110.7	P38	R36-P38 VanDerWaalsContact O-CD 3.29Å; R36-P38 WeakPolarHBondContact O-CD 3.14Å
37	R	35	Very low	34.5	Very low	233 Å²	233	138.4 Å²	138.4	88%	0.879	77%	0.765	S	S	*	*			trans	-63.1	115.1	163.2	-73.4	176.8	165.7	173.4	-2.3	108.8	S39	R37-S39 VanDerWaalsContact C-N 3.32Å; R37-S39 PolarHBondContact O-N 3.43Å; R37-S39 VanDerWaalsContact O-N 3.16Å
38	P	38.3	Very low	34.1	Very low	120 Å²	120	139.5 Å²	139.5	78%	0.779	76%	0.76	S	S	*	*			trans	-84	85.5	162.4	26.7	-13.5	0	0	0	107	R36 V40	R36-P38 VanDerWaalsContact O-CD 3.29Å; R36-P38 WeakPolarHBondContact O-CD 3.14Å; P38-V40 PolarHBondContact O-N 3.04Å
39	S	31.3	Very low	34.1	Very low	84 Å²	84	139.8 Å²	139.8	59%	0.587	75%	0.75	S	S	*	*			trans	-79.9	89.5	167.8	50	0	0	0	0	108.8	R37 H41	R37-S39 VanDerWaalsContact C-N 3.32Å; R37-S39 PolarHBondContact O-N 3.43Å; R37-S39 VanDerWaalsContact O-N 3.16Å; S39-H41 PolarHBondContact O-N 3.09Å
40	V	37.8	Very low	33.6	Very low	124 Å²	124	137.2 Å²	137.2	75%	0.752	74%	0.74	S	S	*	*			trans	-78.4	102.7	169.2	-173.7	0	0	0	0	107.8	P38 V42	P38-V40 PolarHBondContact O-N 3.04Å; V40-V42 HydrophobicContact CG1-CG2 3.98Å
41	H	31.2	Very low	33.4	Very low	168 Å²	168	134.1 Å²	134.1	78%	0.778	74%	0.736	S	S	*	*			trans	-84	109	170.1	-74.3	91.8	0	0	0	108.6	S39	S39-H41 PolarHBondContact O-N 3.09Å
42	V	36.1	Very low	33.2	Very low	104 Å²	104	136.4 Å²	136.4	63%	0.63	74%	0.739	S	S	*	*			trans	-98.3	104.2	168.9	-174.4	0	0	0	0	108.1	V40	V40-V42 HydrophobicContact CG1-CG2 3.98Å
43	K	30.1	Very low	33.2	Very low	200 Å²	200	129 Å²	129	87%	0.87	72%	0.715	S	S	*	*			trans	-76.1	125.7	169.3	-99	174.4	171.6	178.3	0	108.1
44	S	26.6	Very low	33.3	Very low	128 Å²	128	130.1 Å²	130.1	90%	0.895	71%	0.712	S	S	*	*	S	Bend	trans	48.8	90.2	157.4	178	0	0	0	0	115.7
45	G	28.2	Very low	33.1	Very low	58 Å²	58	131.9 Å²	131.9	60%	0.598	72%	0.718	S	S	*	*			trans	-178.4	125.9	166.7	0	0	0	0	0	110.8	N47	G45-N47 VanDerWaalsContact C-N 3.26Å; G45-N47 PolarHBondContact O-N 3.06Å
46	V	31.4	Very low	33	Very low	140 Å²	140	128.1 Å²	128.1	85%	0.848	69%	0.694	S	S	*	*			trans	-57.7	94.4	165	177.9	0	0	0	0	106.7	M48	V46-M48 PolarHBondContact O-N 3.21Å; V46-M48 VanDerWaalsContact O-N 3.15Å
47	N	36.6	Very low	33.1	Very low	121 Å²	121	122.1 Å²	122.1	65%	0.647	68%	0.684	S	S	*	*			trans	-86	93.3	-178.6	-143.3	15.9	0	0	0	107.2	G45 V49	G45-N47 VanDerWaalsContact C-N 3.26Å; G45-N47 PolarHBondContact O-N 3.06Å; N47-V49 VanDerWaalsContact C-N 3.32Å; N47-V49 PolarHBondContact O-N 3.21Å
48	M	31.2	Very low	33.1	Very low	161 Å²	161	119.5 Å²	119.5	79%	0.793	68%	0.675	S	S	*	*			trans	-62.6	97.4	168.3	-76.5	-169.9	-61.5	0	0	107.9	V46 T50	V46-M48 PolarHBondContact O-N 3.21Å; V46-M48 VanDerWaalsContact O-N 3.15Å; M48-T50 PolarHBondContact O-N 3.47Å; M48-T50 VanDerWaalsContact O-N 3.15Å
49	V	35.5	Very low	32.6	Very low	64 Å²	64	121.8 Å²	121.8	39%	0.388	68%	0.679	S	S	.	*			trans	-82.9	93.4	168.1	-173	0	0	0	0	107.1	N47 A51 L54	N47-V49 VanDerWaalsContact C-N 3.32Å; N47-V49 PolarHBondContact O-N 3.21Å; V49-A51 PolarHBondContact O-N 2.95Å; V49-L54 HydrophobicContact CB-CD1 4.3Å; V49-L54 HydrophobicContact CG1-CB 4.13Å; V49-L54 HydrophobicContact CG1-CD1 3.54Å; V49-L54 HydrophobicContact CG1-CG 3.64Å
50	T	29.9	Very low	32.4	Very low	89 Å²	89	120.2 Å²	120.2	55%	0.546	68%	0.676	S	S	.	*			trans	-55.2	128.6	158.9	35.3	0	0	0	0	106.9	M48 K52 E53	M48-T50 PolarHBondContact O-N 3.47Å; M48-T50 VanDerWaalsContact O-N 3.15Å; T50-K52 PolarHBondContact O-N 3.22Å; T50-E53 PolarHBondContact O-N 3.12Å
51	A	35.3	Very low	31.8	Very low	85 Å²	85	121 Å²	121	70%	0.702	68%	0.681	S	S	*	*	T	Hydrogen-bonded Turn	trans	-58.2	-4.7	-179	0	0	0	0	0	114	V49 E53	V49-A51 PolarHBondContact O-N 2.95Å; A51-E53 VanDerWaalsContact C-N 3.3Å
52	K	34.9	Very low	31.7	Very low	188 Å²	188	118 Å²	118	82%	0.817	68%	0.675	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65	-25.6	165.2	-110	174.6	175.5	176.8	0	113.9	T50 A56	T50-K52 PolarHBondContact O-N 3.22Å; K52-A56 WeakPolarHBondContact O-CB 3.33Å
53	E	34.2	Very low	31.4	Very low	87 Å²	87	121.1 Å²	121.1	41%	0.407	69%	0.688	S	S	.	*	T	Hydrogen-bonded Turn	trans	-108.6	-5.1	-175.2	-82.3	-162.3	126.1	0	0	115.5	T50 A51 A56 T57 R58	T50-E53 PolarHBondContact O-N 3.12Å; A51-E53 VanDerWaalsContact C-N 3.3Å; E53-A56 CarbonylContact O-C 3.06Å; E53-A56 PolarHBondContact O-N 2.83Å; E53-T57 PolarHBondContact O-N 3.46Å; E53-T57 PolarHBondContact O-OG1 2.94Å; E53-R58 IonicContact OE1-CZ 3.9Å; E53-R58 IonicContact OE1-NH2 2.93Å; E53-R58 PolarHBondContact OE1-NH2 3.43Å
54	L	35.6	Very low	31.4	Very low	131 Å²	131	114.9 Å²	114.9	69%	0.686	68%	0.681	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86.6	-17.4	170.4	-102.7	164	0	0	0	113.8	V49 A56	V49-L54 HydrophobicContact CB-CD1 4.3Å; V49-L54 HydrophobicContact CG1-CB 4.13Å; V49-L54 HydrophobicContact CG1-CD1 3.54Å; V49-L54 HydrophobicContact CG1-CG 3.64Å; L54-A56 VanDerWaalsContact C-N 3.31Å
55	T	31.2	Very low	31.7	Very low	134 Å²	134	115.2 Å²	115.2	82%	0.822	67%	0.672	S	S	*	*	S	Bend	trans	-86.6	-11.9	163.1	-43.8	0	0	0	0	111.1
56	A	29.5	Very low	31.9	Very low	26 Å²	26	122.4 Å²	122.4	22%	0.215	68%	0.681	C	S	.	*			trans	-133.8	44.6	-175.1	0	0	0	0	0	112.2	K52 E53 L54 R58 L59	K52-A56 WeakPolarHBondContact O-CB 3.33Å; E53-A56 CarbonylContact O-C 3.06Å; E53-A56 PolarHBondContact O-N 2.83Å; L54-A56 VanDerWaalsContact C-N 3.31Å; A56-R58 WeakPolarHBondContact O-CG 3.48Å; A56-R58 PolarHBondContact O-N 3.25Å; A56-L59 HydrophobicContact CB-CD1 4.43Å
57	T	35.1	Very low	32.3	Very low	119 Å²	119	122 Å²	122	73%	0.73	68%	0.681	S	S	*	*	S	Bend	trans	-75.9	58.8	139.1	-51.2	0	0	0	0	106.4	E53	E53-T57 PolarHBondContact O-N 3.46Å; E53-T57 PolarHBondContact O-OG1 2.94Å
58	R	34.6	Very low	32.3	Very low	179 Å²	179	119.1 Å²	119.1	68%	0.675	68%	0.68	S	S	*	*				77.7	84.7	114.5	-68.6	-177.8	-171.4	-174.2	-0.2	105.9	E53 A56 G60	E53-R58 IonicContact OE1-CZ 3.9Å; E53-R58 IonicContact OE1-NH2 2.93Å; E53-R58 PolarHBondContact OE1-NH2 3.43Å; A56-R58 WeakPolarHBondContact O-CG 3.48Å; A56-R58 PolarHBondContact O-N 3.25Å; R58-G60 PolarHBondContact O-N 3.48Å
59	L	27.9	Very low	32.6	Very low	168 Å²	168	116.3 Å²	116.3	88%	0.88	67%	0.668	S	S	*	*				36.7	39.2	79.9	-67	167.1	0	0	0	111	A56	A56-L59 HydrophobicContact CB-CD1 4.43Å
60	G	27.4	Very low	32.7	Very low	50 Å²	50	119.3 Å²	119.3	52%	0.515	68%	0.681	S	S	.	*			trans	-84.4	105.4	153.5	0	0	0	0	0	105.7	R58 V62	R58-G60 PolarHBondContact O-N 3.48Å; G60-V62 PolarHBondContact O-N 2.8Å
61	T	25	Very low	33.1	Very low	140 Å²	140	121.8 Å²	121.8	86%	0.859	69%	0.691	S	S	*	*			trans	-7.8	94.4	149.8	47.2	0	0	0	0	113.8
62	V	29.9	Very low	33	Very low	106 Å²	106	125.7 Å²	125.7	64%	0.642	69%	0.687	S	S	*	*			trans	-141.4	88.7	156.9	-168	0	0	0	0	106.5	G60 G64 L65	G60-V62 PolarHBondContact O-N 2.8Å; V62-G64 PolarHBondContact O-N 3.31Å; V62-G64 VanDerWaalsContact O-N 3.14Å; V62-L65 HydrophobicContact CG1-CD1 4.47Å
63	D	28.8	Very low	33.1	Very low	169 Å²	169	119.8 Å²	119.8	90%	0.904	67%	0.674	S	S	*	*	T	Hydrogen-bonded Turn	trans	-46.1	118.2	161.1	-67.7	-53.2	0	0	0	108.7
64	G	31.5	Very low	33.2	Very low	70 Å²	70	120.6 Å²	120.6	72%	0.722	69%	0.685	S	S	*	*	T	Hydrogen-bonded Turn	trans	123.5	3	163.6	0	0	0	0	0	119.2	V62	V62-G64 PolarHBondContact O-N 3.31Å; V62-G64 VanDerWaalsContact O-N 3.14Å
65	L	31.4	Very low	33.2	Very low	135 Å²	135	118.3 Å²	118.3	71%	0.707	68%	0.68	S	S	*	*			trans	-95.5	115.1	-180	-64.8	178.8	0	0	0	112.9	V62	V62-L65 HydrophobicContact CG1-CD1 4.47Å
66	R	32.6	Very low	33.2	Very low	208 Å²	208	120.6 Å²	120.6	79%	0.785	67%	0.674	S	S	*	*			trans	-68.4	150.7	-174.7	-80.1	179.9	158.8	-172.5	-5.2	111.9	G68 D69	R66-G68 PolarHBondContact O-N 3.27Å; R66-D69 PolarHBondContact O-N 3.1Å
67	P	41.1	Very low	33.5	Very low	132 Å²	132	128.8 Å²	128.8	86%	0.857	70%	0.699	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59	0.8	-179.3	-23.1	32.7	0	0	0	117.1
68	G	36	Very low	33.4	Very low	60 Å²	60	128.6 Å²	128.6	62%	0.619	70%	0.699	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.9	-16.9	-176.9	0	0	0	0	0	115.4	R66	R66-G68 PolarHBondContact O-N 3.27Å
69	D	37.6	Very low	33.3	Very low	102 Å²	102	125 Å²	125	55%	0.545	70%	0.702	S	S	.	*	S	Bend	trans	-87.7	-12.2	-175.4	-65.8	-46.8	0	0	0	113.5	R66 D71 R72 A73	R66-D69 PolarHBondContact O-N 3.1Å; D69-D71 VanDerWaalsContact C-N 3.31Å; D69-D71 PolarHBondContact O-N 2.83Å; D69-R72 PolarHBondContact O-N 3.15Å; D69-A73 PolarHBondContact O-N 2.92Å
70	L	38.3	Very low	33.7	Very low	128 Å²	128	122.4 Å²	122.4	67%	0.67	69%	0.693	S	S	*	*	H	α-helix	trans	-68.7	-30.7	-178.4	-153.8	73.6	0	0	0	112.1	R72 A73 T74	L70-R72 PolarHBondContact O-N 3.31Å; L70-A73 PolarHBondContact O-N 3.15Å; L70-T74 WeakPolarHBondContact O-CG2 3.34Å; L70-T74 PolarHBondContact O-N 2.79Å; L70-T74 VanDerWaalsContact O-N 3.1Å; L70-T74 PolarHBondContact O-OG1 2.85Å
71	D	36.4	Very low	33.9	Very low	140 Å²	140	131.3 Å²	131.3	75%	0.749	71%	0.711	S	S	*	*	H	α-helix	trans	-71.1	-19.4	-179.8	-118.7	8.5	0	0	0	113	D69 T74	D69-D71 VanDerWaalsContact C-N 3.31Å; D69-D71 PolarHBondContact O-N 2.83Å; D71-T74 PolarHBondContact O-OG1 2.84Å
72	R	35.1	Very low	34.3	Very low	167 Å²	167	128.6 Å²	128.6	63%	0.63	69%	0.694	S	S	*	*	H	α-helix	trans	-91.8	-27.1	173.8	-165.2	172.4	-178.8	144.8	-1.8	112.3	D69 L70	D69-R72 PolarHBondContact O-N 3.15Å; L70-R72 PolarHBondContact O-N 3.31Å
73	A	35	Very low	34.3	Very low	65 Å²	65	133 Å²	133	54%	0.537	70%	0.704	S	S	.	*	H	α-helix	trans	-74.4	-33.9	176.9	0	0	0	0	0	112.4	D69 L70 S75	D69-A73 PolarHBondContact O-N 2.92Å; L70-A73 PolarHBondContact O-N 3.15Å; A73-S75 VanDerWaalsContact C-N 3.27Å; A73-S75 PolarHBondContact O-N 2.99Å
74	T	37.2	Very low	34.2	Very low	104 Å²	104	132.9 Å²	132.9	64%	0.638	70%	0.704	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72.8	-19	174.8	54.2	0	0	0	0	113.3	L70 D71	L70-T74 WeakPolarHBondContact O-CG2 3.34Å; L70-T74 PolarHBondContact O-N 2.79Å; L70-T74 VanDerWaalsContact O-N 3.1Å; L70-T74 PolarHBondContact O-OG1 2.85Å; D71-T74 PolarHBondContact O-OG1 2.84Å
75	S	35.6	Very low	34.1	Very low	83 Å²	83	131.7 Å²	131.7	58%	0.58	69%	0.691	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84.9	-16.5	180	-157.7	0	0	0	0	113.7	A73 R77	A73-S75 VanDerWaalsContact C-N 3.27Å; A73-S75 PolarHBondContact O-N 2.99Å; S75-R77 PolarHBondContact O-N 2.97Å
76	R	31.6	Very low	34.1	Very low	182 Å²	182	130.2 Å²	130.2	69%	0.687	69%	0.688	S	S	*	*	S	Bend	trans	-104	77.7	178.7	-66.7	-171	-179	-147.5	-2.3	110.5
77	R	36.4	Very low	34.2	Very low	198 Å²	198	126 Å²	126	75%	0.747	68%	0.681	S	S	*	*			trans	-17.7	112.7	168	-81.3	177.7	154.9	179	-5.8	112.9	S75 S79	S75-R77 PolarHBondContact O-N 2.97Å; R77-S79 VanDerWaalsContact C-N 3.28Å; R77-S79 PolarHBondContact O-N 3.2Å
78	P	33.1	Very low	33.7	Very low	114 Å²	114	125 Å²	125	74%	0.74	67%	0.666	S	S	*	*			trans	-65.8	101.7	152	28	-27.6	0	0	0	105.5	V80	P78-V80 HydrophobicContact CB-CG2 4.47Å; P78-V80 PolarHBondContact O-N 2.89Å
79	S	32	Very low	33.8	Very low	104 Å²	104	126.9 Å²	126.9	73%	0.727	67%	0.665	S	S	*	*			trans	-68.5	80.3	173.2	51.8	0	0	0	0	108.6	R77 R81	R77-S79 VanDerWaalsContact C-N 3.28Å; R77-S79 PolarHBondContact O-N 3.2Å; S79-R81 PolarHBondContact O-N 3.16Å; S79-R81 VanDerWaalsContact O-N 3.09Å
80	V	35.7	Very low	33.5	Very low	113 Å²	113	127.3 Å²	127.3	69%	0.685	67%	0.672	S	S	*	*			trans	-74.5	95.3	168.4	-170.8	0	0	0	0	106.5	P78 V82	P78-V80 HydrophobicContact CB-CG2 4.47Å; P78-V80 PolarHBondContact O-N 2.89Å; V80-V82 VanDerWaalsContact C-N 3.32Å; V80-V82 HydrophobicContact CB-CG2 4.42Å; V80-V82 HydrophobicContact CG1-CG2 3.57Å; V80-V82 PolarHBondContact O-N 3.26Å
81	R	31	Very low	33.3	Very low	238 Å²	238	126.1 Å²	126.1	90%	0.898	68%	0.681	S	S	*	*			trans	-72.6	92.1	165.7	-75.4	-175.1	-161.4	-178.9	4.2	107.6	S79 K83	S79-R81 PolarHBondContact O-N 3.16Å; S79-R81 VanDerWaalsContact O-N 3.09Å; R81-K83 PolarHBondContact O-N 3.35Å
82	V	34.5	Very low	33.2	Very low	82 Å²	82	128 Å²	128	50%	0.497	68%	0.682	S	S	.	*			trans	-80.8	96.5	169.8	-165.6	0	0	0	0	107.9	V80 N84 G85	V80-V82 VanDerWaalsContact C-N 3.32Å; V80-V82 HydrophobicContact CB-CG2 4.42Å; V80-V82 HydrophobicContact CG1-CG2 3.57Å; V80-V82 PolarHBondContact O-N 3.26Å; V82-N84 PolarHBondContact O-N 3.23Å; V82-G85 VanDerWaalsContact CG1-CA 3.49Å; V82-G85 VanDerWaalsContact CG1-N 3.34Å; V82-G85 WeakPolarHBondContact CG1-O 3.41Å
83	K	29.7	Very low	33.1	Very low	199 Å²	199	128 Å²	128	87%	0.865	69%	0.689	S	S	*	*	S	Bend	trans	-74.5	102.4	159.8	-100.5	175.8	169.7	-178	0	106.2	R81	R81-K83 PolarHBondContact O-N 3.35Å
84	N	27	Very low	33.1	Very low	167 Å²	167	133.9 Å²	133.9	89%	0.893	71%	0.711	S	S	*	*	S	Bend	trans	73.1	52	166.7	-53.3	32.4	0	0	0	117	V82	V82-N84 PolarHBondContact O-N 3.23Å
85	G	28.5	Very low	32.8	Very low	45 Å²	45	133.3 Å²	133.3	46%	0.464	71%	0.707	S	S	.	*			trans	-140.7	114.4	176.5	0	0	0	0	0	112	V82 N87	V82-G85 VanDerWaalsContact CG1-CA 3.49Å; V82-G85 VanDerWaalsContact CG1-N 3.34Å; V82-G85 WeakPolarHBondContact CG1-O 3.41Å; G85-N87 PolarHBondContact O-N 3.32Å
86	V	31.9	Very low	32.7	Very low	104 Å²	104	133.7 Å²	133.7	63%	0.63	72%	0.715	S	S	*	*	P	Polyproline II helix	trans	-73.5	119.3	174.4	177.9	0	0	0	0	108.5	A5 M88	A5-V86 HydrophobicContact CB-CG1 3.47Å; A5-V86 VanDerWaalsContact CB-CG1 3.47Å; V86-M88 HydrophobicContact CG1-CG 4.48Å
87	N	35.6	Very low	32.7	Very low	120 Å²	120	131.5 Å²	131.5	64%	0.642	72%	0.722	S	S	*	*	P	Polyproline II helix	trans	-80.7	117.7	170.1	-103.4	-7.8	0	0	0	109.2	G85	G85-N87 PolarHBondContact O-N 3.32Å
88	M	30.2	Very low	32.5	Very low	109 Å²	109	133.4 Å²	133.4	54%	0.537	73%	0.729	S	S	.	*	B	Isolated β-bridge	trans	-103.1	118.9	174.4	-91.9	152	35.6	0	0	109.6	P3 V86	P3-M88 HydrophobicContact CB-CE 3.72Å; P3-M88 HydrophobicContact CB-CG 3.84Å; P3-M88 HydrophobicContact CB-SD 3.24Å; P3-M88 WeakPolarHBondContact CB-SD 3.48Å; P3-M88 HydrophobicContact CG-SD 4.08Å; V86-M88 HydrophobicContact CG1-CG 4.48Å
89	V	36.8	Very low	32.4	Very low	100 Å²	100	132.8 Å²	132.8	61%	0.606	73%	0.728	S	S	*	*	P	Polyproline II helix	trans	-103.7	116	170.7	179.2	0	0	0	0	108	A91	V89-A91 PolarHBondContact O-N 3.34Å
90	T	31.2	Very low	32.3	Very low	111 Å²	111	134.3 Å²	134.3	68%	0.681	74%	0.735	S	S	*	*			trans	-83.1	107.2	169.9	37.7	0	0	0	0	109.2	K92	T90-K92 VanDerWaalsContact C-N 3.3Å; T90-K92 PolarHBondContact O-N 3.43Å
91	A	34.4	Very low	32	Very low	104 Å²	104	132.3 Å²	132.3	86%	0.86	74%	0.738	S	S	*	*			trans	-72.8	84.4	171.3	0	0	0	0	0	109.8	V89	V89-A91 PolarHBondContact O-N 3.34Å
92	K	34.4	Very low	32.1	Very low	180 Å²	180	128.6 Å²	128.6	78%	0.783	74%	0.735	S	S	*	*			trans	-127.7	119.5	162.4	-101	178.4	172.1	-177.6	0	107.1	T90	T90-K92 VanDerWaalsContact C-N 3.3Å; T90-K92 PolarHBondContact O-N 3.43Å
93	E	32.7	Very low	32	Very low	167 Å²	167	134.2 Å²	134.2	78%	0.78	75%	0.753	S	S	*	*			trans	66.2	81.8	178.5	-74.5	-171.5	95.6	0	0	117.2	T95	E93-T95 WeakPolarHBondContact CB-OG1 3.43Å; E93-T95 WeakPolarHBondContact CG-OG1 3.49Å; E93-T95 PolarHBondContact O-N 3.39Å; E93-T95 VanDerWaalsContact O-N 3.12Å; E93-T95 PolarHBondContact OE1-OG1 2.9Å
94	L	36.9	Very low	32	Very low	188 Å²	188	130.9 Å²	130.9	98%	0.984	75%	0.751	S	S	*	*			trans	-76.7	64.4	142.7	-88.4	161.3	0	0	0	108.3	A96	L94-A96 PolarHBondContact O-N 3.38Å
95	T	29.6	Very low	32.2	Very low	91 Å²	91	128.1 Å²	128.1	56%	0.558	75%	0.745	S	S	*	*			trans	-82.1	99.7	171.1	-51.6	0	0	0	0	106.5	E93 T97	E93-T95 WeakPolarHBondContact CB-OG1 3.43Å; E93-T95 WeakPolarHBondContact CG-OG1 3.49Å; E93-T95 PolarHBondContact O-N 3.39Å; E93-T95 VanDerWaalsContact O-N 3.12Å; E93-T95 PolarHBondContact OE1-OG1 2.9Å; T95-T97 PolarHBondContact O-N 3.28Å
96	A	33.4	Very low	32.3	Very low	91 Å²	91	132.4 Å²	132.4	75%	0.752	76%	0.762	S	S	*	*			trans	-48.2	106.6	178.8	0	0	0	0	0	110.9	L94 R98	L94-A96 PolarHBondContact O-N 3.38Å; A96-R98 PolarHBondContact O-N 3.43Å
97	T	32.8	Very low	32.1	Very low	136 Å²	136	133.2 Å²	133.2	83%	0.834	77%	0.767	S	S	*	*			trans	-70.3	86.6	167.8	23.5	0	0	0	0	108.5	T95 S99	T95-T97 PolarHBondContact O-N 3.28Å; T97-S99 PolarHBondContact O-N 3.42Å
98	R	30.8	Very low	31.9	Very low	238 Å²	238	133.6 Å²	133.6	90%	0.898	78%	0.776	S	S	*	*			trans	-41.4	105.4	157	-105.2	178.2	163.7	-163.9	-2.6	108.5	A96 P100	A96-R98 PolarHBondContact O-N 3.43Å; R98-P100 WeakPolarHBondContact O-CD 3.42Å
99	S	32	Very low	31.7	Very low	102 Å²	102	133 Å²	133	71%	0.713	78%	0.783	S	S	*	*			trans	-66.8	120.4	165.9	-38.3	0	0	0	0	107.6	T97 G101	T97-S99 PolarHBondContact O-N 3.42Å; S99-G101 PolarHBondContact O-N 2.8Å
100	P	30.4	Very low	31.4	Very low	135 Å²	135	136.2 Å²	136.2	88%	0.877	80%	0.796	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.4	115.1	173.1	29.7	-28.1	0	0	0	107	R98	R98-P100 WeakPolarHBondContact O-CD 3.42Å
101	G	28.9	Very low	31.6	Very low	72 Å²	72	142.3 Å²	142.3	74%	0.742	81%	0.806	S	S	*	*	T	Hydrogen-bonded Turn	trans	148.2	-8.4	167.4	0	0	0	0	0	118	S99	S99-G101 PolarHBondContact O-N 2.8Å
102	L	32.5	Very low	31.7	Very low	159 Å²	159	142.5 Å²	142.5	83%	0.832	80%	0.796	S	S	*	*	S	Bend	trans	-121.4	115.7	179.5	-62.6	175.9	0	0	0	110
103	K	33	Very low	31.6	Very low	201 Å²	201	138.8 Å²	138.8	87%	0.874	80%	0.799	S	S	*	*			trans	-49.7	125.6	178	-66.9	176.3	178.5	175.2	0	109.1	S105	K103-S105 PolarHBondContact O-N 2.86Å
104	P	30.2	Very low	31.7	Very low	129 Å²	129	133.4 Å²	133.4	84%	0.838	79%	0.789	S	S	*	*			trans	-69.4	97.6	177.1	27.1	-30.2	0	0	0	108.1	T106	P104-T106 PolarHBondContact O-N 3.02Å
105	S	30	Very low	31.7	Very low	109 Å²	109	130.3 Å²	130.3	76%	0.762	77%	0.773	S	S	*	*			trans	-86.8	107.7	171.5	-177.7	0	0	0	0	108.6	K103 V107	K103-S105 PolarHBondContact O-N 2.86Å; S105-V107 PolarHBondContact O-N 2.93Å
106	T	30.1	Very low	31.9	Very low	135 Å²	135	134.2 Å²	134.2	83%	0.828	78%	0.784	S	S	*	*	S	Bend	trans	-29	89.1	165.5	-50.7	0	0	0	0	115.5	P104	P104-T106 PolarHBondContact O-N 3.02Å
107	V	29	Very low	32.1	Very low	121 Å²	121	133 Å²	133	73%	0.733	77%	0.774	S	S	*	*			trans	-163.6	129.6	144.1	-137	0	0	0	0	110.2	S105	S105-V107 PolarHBondContact O-N 2.93Å
108	P	30.8	Very low	32.2	Very low	127 Å²	127	130.1 Å²	130.1	83%	0.825	76%	0.76	S	S	*	*			trans	-95.6	106.2	-178.3	34.4	-26.5	0	0	0	110.7
109	S	25.6	Very low	32.6	Very low	96 Å²	96	122.1 Å²	122.1	67%	0.671	74%	0.744	S	S	*	*			trans	-171.6	92.4	163.5	50.8	0	0	0	0	112.9
110	L	31.9	Very low	33.1	Very low	168 Å²	168	121.1 Å²	121.1	88%	0.88	73%	0.734	S	S	*	*			trans	-122.8	86	146.8	-75.7	175.9	0	0	0	107.8	V112	L110-V112 VanDerWaalsContact C-N 3.3Å; L110-V112 PolarHBondContact O-N 3.1Å
111	R	34.7	Very low	33.7	Very low	240 Å²	240	119.5 Å²	119.5	91%	0.906	72%	0.722	S	S	*	*			trans	-60.5	96.2	160.5	-69.3	-176.3	-177.8	-175.8	1	107.1	A113	R111-A113 PolarHBondContact O-N 3.33Å
112	V	35.8	Very low	34	Very low	108 Å²	108	120.1 Å²	120.1	66%	0.655	71%	0.713	S	S	*	*			trans	-74.5	86.9	163.9	-178.5	0	0	0	0	106.9	L110 G114 L115	L110-V112 VanDerWaalsContact C-N 3.3Å; L110-V112 PolarHBondContact O-N 3.1Å; V112-G114 PolarHBondContact O-N 3.14Å; V112-L115 HydrophobicContact CG1-CD1 3.65Å
113	A	32.7	Very low	34.1	Very low	101 Å²	101	116.1 Å²	116.1	84%	0.835	71%	0.71	S	S	*	*	T	Hydrogen-bonded Turn	trans	-68.2	108.9	166.1	0	0	0	0	0	108	R111	R111-A113 PolarHBondContact O-N 3.33Å
114	G	34.9	Very low	34.2	Very low	55 Å²	55	110.2 Å²	110.2	57%	0.567	71%	0.707	S	S	*	*	T	Hydrogen-bonded Turn	trans	143.1	1.7	165.7	0	0	0	0	0	118.3	V112	V112-G114 PolarHBondContact O-N 3.14Å
115	L	36.9	Very low	34.5	Very low	123 Å²	123	111.5 Å²	111.5	64%	0.644	71%	0.706	S	S	*	*			trans	-105.3	94.5	172.6	-83.2	118.5	0	0	0	110.6	F8 V112	F8-L115 HydrophobicContact CD1-CD2 3.68Å; F8-L115 HydrophobicContact CE1-CD2 3.61Å; V112-L115 HydrophobicContact CG1-CD1 3.65Å
116	Q	34.7	Very low	34.7	Very low	172 Å²	172	117.4 Å²	117.4	80%	0.804	71%	0.712	S	S	*	*			trans	-96.3	108.5	160.8	-167.9	-179.3	-13.4	0	0	107.1
117	A	36	Very low	34.9	Very low	66 Å²	66	117.4 Å²	117.4	55%	0.545	72%	0.716	S	S	.	*			trans	-87.5	124.9	169.6	0	0	0	0	0	108.2	V6 F8	V6-A117 HydrophobicContact CG1-CB 3.99Å; F8-A117 HydrophobicContact CE1-CB 4.25Å
118	S	36.3	Very low	35	Very low	76 Å²	76	114.8 Å²	114.8	53%	0.531	71%	0.713	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-109.2	119.2	167	-157.8	0	0	0	0	107.7
119	A	37.4	Very low	35.2	Very low	69 Å²	69	117.8 Å²	117.8	57%	0.57	72%	0.716	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-85.8	120.6	173.3	0	0	0	0	0	108.5	I4	I4-A119 HydrophobicContact CG2-CB 3.71Å
120	T	42.8	Very low	35.7	Very low	81 Å²	81	121.6 Å²	121.6	50%	0.497	73%	0.727	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-115.7	118.6	168.5	53.6	0	0	0	0	108	P122	T120-P122 WeakPolarHBondContact O-CD 3.29Å
121	T	42.7	Very low	35.8	Very low	102 Å²	102	117.3 Å²	117.3	63%	0.626	72%	0.716	S	S	*	*			trans	-71.8	122.8	172.1	14.3	0	0	0	0	109.4	V2 G123	V2-T121 HydrophobicContact CG1-CG2 4.41Å; T121-G123 PolarHBondContact O-N 2.94Å
122	P	36	Very low	35.7	Very low	84 Å²	84	114.3 Å²	114.3	55%	0.545	71%	0.712	S	S	.	*			trans	-84.9	102.8	172	31.1	-25.4	0	0	0	108.6	P3 T120	P3-P122 WeakPolarHBondContact O-CD 3.16Å; T120-P122 WeakPolarHBondContact O-CD 3.29Å
123	G	33.7	Very low	35.5	Very low	76 Å²	76	118.1 Å²	118.1	78%	0.784	73%	0.725	S	S	*	*			trans	155.1	109.6	170.9	0	0	0	0	0	113.4	T121	T121-G123 PolarHBondContact O-N 2.94Å
124	G	36.9	Very low	35.7	Very low	77 Å²	77	118.9 Å²	118.9	79%	0.794	72%	0.722	S	S	*	*			trans	143.4	93.4	173	0	0	0	0	0	111.9
125	D	35.7	Very low	35.6	Very low	155 Å²	155	121.1 Å²	121.1	83%	0.829	73%	0.729	S	S	*	*			trans	-49.2	140.7	169.9	-70.8	-63.3	0	0	0	112.9
126	R	33.9	Very low	35.4	Very low	233 Å²	233	122.1 Å²	122.1	88%	0.879	73%	0.734	S	S	*	*			trans	64.9	104.7	161.6	-54.5	-179.5	-152.8	-161.9	6.5	117.7
127	C	34	Very low	35.3	Very low	136 Å²	136	120.5 Å²	120.5	92%	0.919	74%	0.736	S	S	*	*			trans	162.3	105.5	138.3	-94.8	0	0	0	0	105.7
128	G	32.5	Very low	35.2	Very low	65 Å²	65	125.5 Å²	125.5	67%	0.67	75%	0.753	S	S	*	*				101.5	108.9	87.8	0	0	0	0	0	108.3
129	Q	33.8	Very low	35.3	Very low	190 Å²	190	127 Å²	127	89%	0.888	76%	0.763	S	S	*	*			trans	42.1	99.9	157	-63.9	172.1	6.4	0	0	117.5
130	I	36.4	Very low	35.2	Very low	176 Å²	176	129.4 Å²	129.4	90%	0.903	78%	0.776	S	S	*	*			trans	-120.9	65.7	146.6	-39.1	178.5	0	0	0	107.2
131	A	33.4	Very low	35	Very low	78 Å²	78	133.1 Å²	133.1	65%	0.645	79%	0.791	S	S	*	*			trans	-72.2	135.7	157.3	0	0	0	0	0	107.6
132	Q	33.3	Very low	34.7	Very low	178 Å²	178	138.9 Å²	138.9	83%	0.832	80%	0.801	S	S	*	*			trans	44.1	114.9	161.8	-75.1	171.8	-42.6	0	0	117.3
133	M	32.6	Very low	34.8	Very low	187 Å²	187	146.4 Å²	146.4	92%	0.921	82%	0.819	S	S	*	*			trans	-141.5	132.9	130.2	-83	-137.9	139.9	0	0	112.5
134	P	36.1	Very low	35.4	Very low	117 Å²	117	155 Å²	155	76%	0.76	84%	0.839	S	S	*	*			trans	-76.6	165.9	176.1	33.7	-33.4	0	0	0	111.7
135	S	32.3	Very low	35.3	Very low	102 Å²	102	159 Å²	159	71%	0.713	84%	0.841	S	S	*	*	S	Bend	trans	-49.4	135.3	-172.6	52.6	0	0	0	0	117.6
136	L	32.4	Very low	35.3	Very low	145 Å²	145	159.2 Å²	159.2	76%	0.759	84%	0.842	S	S	*	*			trans	68.5	114	140	-60.1	170.4	0	0	0	119
137	T	33.2	Very low	35.3	Very low	137 Å²	137	155.1 Å²	155.1	84%	0.84	84%	0.839	S	S	*	*			trans	-146.8	113.8	132.2	-38.8	0	0	0	0	108.5
138	L	33.8	Very low	35.4	Very low	172 Å²	172	156.2 Å²	156.2	90%	0.901	84%	0.835	S	S	*	*			trans	-98.1	111.8	171.2	-111.8	119.9	0	0	0	107.3
139	S	39.4	Very low	35.6	Very low	106 Å²	106	161.9 Å²	161.9	74%	0.741	85%	0.845	S	S	*	*			trans	-122.2	131	170	29.7	0	0	0	0	109.3
140	S	33.9	Very low	35.7	Very low	121 Å²	121	160 Å²	160	85%	0.846	84%	0.842	S	S	*	*			trans	-59.7	150.7	-164	-50.6	0	0	0	0	116.2
141	I	40	Very low	35.7	Very low	158 Å²	158	158.9 Å²	158.9	81%	0.81	84%	0.838	S	S	*	*			trans	-131.5	123.5	150.2	-59.5	179.7	0	0	0	109.1
142	R	35.2	Very low	35.9	Very low	223 Å²	223	165.1 Å²	165.1	84%	0.842	85%	0.853	S	S	*	*			trans	-68.9	140.4	175.7	170.4	-172.7	-92.3	171.1	-9.6	109.8
143	W	37.6	Very low	36.1	Very low	243 Å²	243	164 Å²	164	92%	0.92	86%	0.855	S	S	*	*			trans	-111.4	131	158.5	-77.5	89.7	0	0	0	107.9
144	E	46.5	Very low	36.4	Very low	257 Å²	257	161.9 Å²	161.9	100%	1.201	85%	0.849	S	S	*	*			trans	-60.7	0	176.5	-66.4	-173.8	122.4	0	0	113.1

Retrieved 144 of 144 residues in 341.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).