A0A077ZKV0_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZKV0, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 48 aa.

						>A0A077ZKV0_TRITR|A0A077ZKV0
MSAPRRRCHRPLQVAVFRAFQFAPGRYANARKTNQQDSLRITPWHSSR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	45.5	Very low	59.6	Low	249 Å²	249	163.4 Å²	163.4	100%	1.227	81%	0.805	S	S	*	*				0	100.4	0	-73.3	169	-172.9	0	0	107.9
2	S	47.2	Very low	60.6	Low	125 Å²	125	161.4 Å²	161.4	87%	0.874	80%	0.799	S	S	*	*	P	Polyproline II helix	trans	-92	130.2	-175.1	-59.4	0	0	0	0	110.6
3	A	59.4	Low	62	Low	87 Å²	87	155.8 Å²	155.8	72%	0.719	77%	0.77	S	S	*	*	P	Polyproline II helix	trans	-57.5	143.9	-172.2	0	0	0	0	0	113.3	R5	A3-R5 VanDerWaalsContact O-N 3.15Å; A3-R5 PolarHBondContact O-N 3.33Å
4	P	62.6	Low	63	Low	126 Å²	126	151.4 Å²	151.4	82%	0.818	76%	0.756	S	S	*	*	P	Polyproline II helix	trans	-59.9	120.7	-179.2	24	-32.4	0	0	0	109.9	R6	P4-R6 PolarHBondContact O-N 3.38Å
5	R	67.6	Low	64.1	Low	240 Å²	240	145.5 Å²	145.5	91%	0.906	74%	0.739	S	S	*	*			trans	-51.9	114.6	175.5	-70.2	178	176.8	-122.9	-0.1	107.9	A3 R7	A3-R5 VanDerWaalsContact O-N 3.15Å; A3-R5 PolarHBondContact O-N 3.33Å; R5-R7 PolarHBondContact O-N 2.96Å
6	R	56.4	Low	64.9	Low	214 Å²	214	141 Å²	141	81%	0.808	72%	0.721	S	S	*	*			trans	-45.7	110.3	170.4	-73.3	-174.3	174.9	-165.1	-0.7	106.7	P4 C8	P4-R6 PolarHBondContact O-N 3.38Å; R6-C8 PolarHBondContact O-N 3.01Å; R6-C8 PolarHBondContact O-SG 3.11Å
7	R	63.3	Low	65.7	Low	243 Å²	243	140.2 Å²	140.2	92%	0.917	71%	0.712	S	S	*	*			trans	-65.3	90.2	171.4	-155	177.8	-157.1	176	5.6	103.9	R5 H9	R5-R7 PolarHBondContact O-N 2.96Å; R7-H9 PolarHBondContact O-N 3.5Å
8	C	63.3	Low	66.2	Low	100 Å²	100	143.6 Å²	143.6	68%	0.676	71%	0.714	S	S	*	*			trans	-60.5	94.6	-177.4	-68.3	0	0	0	0	107.7	R6	R6-C8 PolarHBondContact O-N 3.01Å; R6-C8 PolarHBondContact O-SG 3.11Å
9	H	56.7	Low	66.9	Low	154 Å²	154	139.8 Å²	139.8	71%	0.713	71%	0.708	S	S	*	*			trans	36.8	89.2	143.6	-55.6	-85.2	0	0	0	114.3	R7 P11	R7-H9 PolarHBondContact O-N 3.5Å; H9-P11 HydrophobicContact CB-CG 4.26Å; H9-P11 VanDerWaalsContact O-CD 3.3Å; H9-P11 WeakPolarHBondContact O-CD 3.42Å
10	R	66.7	Low	67.2	Low	176 Å²	176	141.2 Å²	141.2	66%	0.664	71%	0.71	S	S	*	*			trans	-97.2	26.9	157	-65.3	-117.1	179.5	151.1	0.6	114	L12 Q13 V14	R10-L12 PolarHBondContact O-N 3.15Å; R10-Q13 PolarHBondContact O-N 3.47Å; R10-V14 PolarHBondContact O-N 3.28Å
11	P	67.2	Low	67.3	Low	83 Å²	83	141 Å²	141	54%	0.539	71%	0.707	S	S	.	*	H	α-helix	trans	-64.5	-29.5	-175.5	31	-35.4	0	0	0	111.5	H9 V14 A15	H9-P11 HydrophobicContact CB-CG 4.26Å; H9-P11 VanDerWaalsContact O-CD 3.3Å; H9-P11 WeakPolarHBondContact O-CD 3.42Å; P11-V14 PolarHBondContact O-N 3.2Å; P11-A15 WeakPolarHBondContact O-CB 3.3Å; P11-A15 PolarHBondContact O-N 3.18Å
12	L	71.5	Confident	68.3	Low	140 Å²	140	138.3 Å²	138.3	73%	0.733	69%	0.688	S	S	*	*	H	α-helix	trans	-61.7	-46.5	178.5	-166.5	109.3	0	0	0	111.9	R10 A15 V16	R10-L12 PolarHBondContact O-N 3.15Å; L12-A15 PolarHBondContact O-N 3.47Å; L12-V16 VanDerWaalsContact O-CG2 3.3Å; L12-V16 VanDerWaalsContact O-N 3.1Å; L12-V16 PolarHBondContact O-N 3.34Å; L12-V16 WeakPolarHBondContact O-CG2 3.24Å
13	Q	79	Confident	69.2	Low	88 Å²	88	135.6 Å²	135.6	41%	0.411	67%	0.673	S	S	.	*	H	α-helix	trans	-63.7	-45	177.9	-71.1	-174.8	-18.8	0	0	110.8	R10 A15 V16 F17	R10-Q13 PolarHBondContact O-N 3.47Å; Q13-A15 VanDerWaalsContact C-N 3.34Å; Q13-A15 PolarHBondContact O-N 3.4Å; Q13-V16 PolarHBondContact O-N 3.47Å; Q13-F17 HydrophobicContact CB-CD2 4.36Å; Q13-F17 HydrophobicContact CB-CE2 4.15Å; Q13-F17 WeakPolarHBondContact O-CD2 2.97Å; Q13-F17 PolarHBondContact O-N 3.3Å
14	V	75.3	Confident	69.3	Low	95 Å²	95	136.2 Å²	136.2	58%	0.576	67%	0.67	S	S	*	*	H	α-helix	trans	-60.6	-42.5	179.3	178.1	0	0	0	0	111.5	R10 P11 F17 R18	R10-V14 PolarHBondContact O-N 3.28Å; P11-V14 PolarHBondContact O-N 3.2Å; V14-F17 PolarHBondContact O-N 3.41Å; V14-R18 WeakPolarHBondContact O-CB 3.09Å; V14-R18 PolarHBondContact O-N 3.39Å
15	A	79.5	Confident	69.4	Low	62 Å²	62	132.5 Å²	132.5	51%	0.512	65%	0.654	S	S	.	*	H	α-helix	trans	-62.5	-43.6	176.9	0	0	0	0	0	112.1	P11 L12 Q13 R18 A19	P11-A15 WeakPolarHBondContact O-CB 3.3Å; P11-A15 PolarHBondContact O-N 3.18Å; L12-A15 PolarHBondContact O-N 3.47Å; Q13-A15 VanDerWaalsContact C-N 3.34Å; Q13-A15 PolarHBondContact O-N 3.4Å; A15-R18 PolarHBondContact O-N 3.43Å; A15-A19 VanDerWaalsContact O-N 3.11Å; A15-A19 PolarHBondContact O-N 2.94Å
16	V	77.3	Confident	69.2	Low	74 Å²	74	132 Å²	132	45%	0.448	65%	0.653	S	S	.	*	H	α-helix	trans	-60.6	-51.3	175.9	173.5	0	0	0	0	110.4	L12 Q13 R18 A19 F20	L12-V16 VanDerWaalsContact O-CG2 3.3Å; L12-V16 VanDerWaalsContact O-N 3.1Å; L12-V16 PolarHBondContact O-N 3.34Å; L12-V16 WeakPolarHBondContact O-CG2 3.24Å; Q13-V16 PolarHBondContact O-N 3.47Å; V16-R18 VanDerWaalsContact C-N 3.27Å; V16-R18 PolarHBondContact O-N 3.44Å; V16-A19 PolarHBondContact O-N 3.48Å; V16-F20 HydrophobicContact CG1-CD2 4.08Å; V16-F20 HydrophobicContact CG1-CE2 3.88Å; V16-F20 VanDerWaalsContact O-CD2 3.24Å; V16-F20 WeakPolarHBondContact O-CD2 3.4Å; V16-F20 PolarHBondContact O-N 3.11Å
17	F	79.1	Confident	69.4	Low	127 Å²	127	131.8 Å²	131.8	56%	0.557	65%	0.653	S	S	*	*	H	α-helix	trans	-58.3	-38.9	177.6	-74.2	-67.8	0	0	0	112.5	Q13 V14 A19 F20 Q21	Q13-F17 HydrophobicContact CB-CD2 4.36Å; Q13-F17 HydrophobicContact CB-CE2 4.15Å; Q13-F17 WeakPolarHBondContact O-CD2 2.97Å; Q13-F17 PolarHBondContact O-N 3.3Å; V14-F17 PolarHBondContact O-N 3.41Å; F17-A19 PolarHBondContact O-N 3.1Å; F17-F20 PolarHBondContact O-N 3.23Å; F17-Q21 VanDerWaalsContact O-CG 3.26Å; F17-Q21 WeakPolarHBondContact O-CG 3.26Å; F17-Q21 PolarHBondContact O-N 3.33Å
18	R	73.8	Confident	69.4	Low	201 Å²	201	123.3 Å²	123.3	76%	0.758	64%	0.635	S	S	*	*	H	α-helix	trans	-65.9	-36.2	179.9	-144.4	-176.9	-168.4	172.6	2.6	112.6	V14 A15 V16	V14-R18 WeakPolarHBondContact O-CB 3.09Å; V14-R18 PolarHBondContact O-N 3.39Å; A15-R18 PolarHBondContact O-N 3.43Å; V16-R18 VanDerWaalsContact C-N 3.27Å; V16-R18 PolarHBondContact O-N 3.44Å
19	A	79.4	Confident	69.3	Low	73 Å²	73	124.6 Å²	124.6	60%	0.603	64%	0.636	S	S	*	*	H	α-helix	trans	-66	-40.3	178.1	0	0	0	0	0	112.6	A15 V16 F17	A15-A19 VanDerWaalsContact O-N 3.11Å; A15-A19 PolarHBondContact O-N 2.94Å; V16-A19 PolarHBondContact O-N 3.48Å; F17-A19 PolarHBondContact O-N 3.1Å
20	F	72.4	Confident	69.6	Low	167 Å²	167	121.1 Å²	121.1	73%	0.732	63%	0.633	S	S	*	*	H	α-helix	trans	-78.7	-24.8	-179.7	-71.6	-79.5	0	0	0	113.7	V16 F17 F22	V16-F20 HydrophobicContact CG1-CD2 4.08Å; V16-F20 HydrophobicContact CG1-CE2 3.88Å; V16-F20 VanDerWaalsContact O-CD2 3.24Å; V16-F20 WeakPolarHBondContact O-CD2 3.4Å; V16-F20 PolarHBondContact O-N 3.11Å; F17-F20 PolarHBondContact O-N 3.23Å; F20-F22 PolarHBondContact O-N 2.96Å
21	Q	70	Confident	69.3	Low	138 Å²	138	123.4 Å²	123.4	65%	0.645	64%	0.642	S	S	*	*	H	α-helix	trans	-74.8	-17.3	-179	-77.2	177.7	33	0	0	114.9	F17 P24	F17-Q21 VanDerWaalsContact O-CG 3.26Å; F17-Q21 WeakPolarHBondContact O-CG 3.26Å; F17-Q21 PolarHBondContact O-N 3.33Å; Q21-P24 WeakPolarHBondContact O-CD 3.44Å
22	F	65.7	Low	68.8	Low	191 Å²	191	127 Å²	127	84%	0.838	65%	0.649	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84.7	-6.6	-175.2	-164.6	-102.9	0	0	0	114.6	F20	F20-F22 PolarHBondContact O-N 2.96Å
23	A	67	Low	68.3	Low	68 Å²	68	125 Å²	125	56%	0.562	64%	0.643	S	S	*	*			trans	-117	29.3	-178.7	0	0	0	0	0	117.9	G25	A23-G25 PolarHBondContact O-N 3.35Å; A23-G25 VanDerWaalsContact C-N 3.31Å
24	P	62.5	Low	67.4	Low	100 Å²	100	127.5 Å²	127.5	65%	0.649	66%	0.659	S	S	*	*	S	Bend	trans	-71.9	-22.7	179.6	29.1	-34.8	0	0	0	113.6	Q21	Q21-P24 WeakPolarHBondContact O-CD 3.44Å
25	G	64.7	Low	66.5	Low	48 Å²	48	130.5 Å²	130.5	50%	0.495	67%	0.667	S	S	.	*	H	α-helix	trans	-82.8	-22.4	-167.9	0	0	0	0	0	116.5	A23	A23-G25 PolarHBondContact O-N 3.35Å; A23-G25 VanDerWaalsContact C-N 3.31Å
26	R	61.4	Low	65.6	Low	230 Å²	230	135 Å²	135	87%	0.868	68%	0.677	S	S	*	*	H	α-helix	trans	-76.4	-27.2	-175.5	-96.5	-171	166.4	-174.9	-3.5	113.8
27	Y	62.2	Low	64.7	Low	209 Å²	209	135.6 Å²	135.6	82%	0.82	68%	0.678	S	S	*	*	H	α-helix	trans	-80.9	-23.1	-179.6	-80.7	-80.4	0	0	0	113.9	N29	Y27-N29 VanDerWaalsContact C-N 3.34Å; Y27-N29 PolarHBondContact O-N 3.41Å
28	A	63.7	Low	63.7	Low	65 Å²	65	134.1 Å²	134.1	54%	0.537	68%	0.683	S	S	.	*	H	α-helix	trans	-70.7	-29.8	-179.7	0	0	0	0	0	113
29	N	61.2	Low	63	Low	128 Å²	128	131.9 Å²	131.9	68%	0.684	69%	0.686	S	S	*	*	S	Bend	trans	-91	-13.9	-169.9	-76.8	-10.5	0	0	0	115.2	Y27 R31	Y27-N29 VanDerWaalsContact C-N 3.34Å; Y27-N29 PolarHBondContact O-N 3.41Å; N29-R31 VanDerWaalsContact C-N 3.26Å; N29-R31 PolarHBondContact O-N 3.3Å
30	A	61.1	Low	62.2	Low	80 Å²	80	138.8 Å²	138.8	66%	0.661	70%	0.696	S	S	*	*	G	3₁₀ helix	trans	-69.4	-23.1	178.7	0	0	0	0	0	113.1	K32	A30-K32 PolarHBondContact O-N 2.93Å
31	R	60.5	Low	61.7	Low	224 Å²	224	137.2 Å²	137.2	85%	0.845	69%	0.694	S	S	*	*	G	3₁₀ helix	trans	-81.1	-11	-173.9	-154.3	174.7	-173	-140.6	0.9	114.5	N29	N29-R31 VanDerWaalsContact C-N 3.26Å; N29-R31 PolarHBondContact O-N 3.3Å
32	K	58.3	Low	61.4	Low	158 Å²	158	136.7 Å²	136.7	69%	0.687	70%	0.7	S	S	*	*	G	3₁₀ helix	trans	-109.8	10	-171.3	-69.6	-166.9	-179.9	-175.3	0	115.9	A30	A30-K32 PolarHBondContact O-N 2.93Å
33	T	59.8	Low	61.4	Low	100 Å²	100	132 Å²	132	61%	0.613	69%	0.689	S	S	*	*	S	Bend	trans	-89.4	-6.4	172.5	-158.6	0	0	0	0	114
34	N	59.6	Low	61.8	Low	139 Å²	139	139.8 Å²	139.8	74%	0.743	70%	0.704	S	S	*	*	S	Bend	trans	-102.2	-5.9	-179.8	-140	3.6	0	0	0	113.4
35	Q	57.9	Low	62.2	Low	158 Å²	158	142.8 Å²	142.8	74%	0.738	71%	0.709	S	S	*	*	S	Bend	trans	-101	-13.1	173.5	-74.8	-171.2	3.4	0	0	113.3	S38	Q35-S38 PolarHBondContact O-OG 3.23Å; Q35-S38 VanDerWaalsContact O-OG 3.11Å
36	Q	60	Low	62.3	Low	156 Å²	156	145.3 Å²	145.3	73%	0.729	72%	0.719	S	S	*	*	S	Bend	trans	-89.1	-17.2	173.5	-102.2	173.3	0.3	0	0	113.2
37	D	57.8	Low	62.4	Low	87 Å²	87	139.7 Å²	139.7	47%	0.465	72%	0.715	S	S	.	*	G	3₁₀ helix	trans	-80.8	-15.1	177.3	-97.2	-41.9	0	0	0	114.4	L39 R40	D37-L39 PolarHBondContact O-N 2.71Å; D37-L39 VanDerWaalsContact O-N 3.15Å; D37-R40 PolarHBondContact O-N 3.42Å
38	S	58.1	Low	62.2	Low	97 Å²	97	145 Å²	145	68%	0.678	73%	0.734	S	S	*	*	G	3₁₀ helix	trans	-69.3	-9.9	176.9	36.8	0	0	0	0	114	Q35	Q35-S38 PolarHBondContact O-OG 3.23Å; Q35-S38 VanDerWaalsContact O-OG 3.11Å
39	L	60.7	Low	62.1	Low	154 Å²	154	149 Å²	149	81%	0.806	74%	0.743	S	S	*	*	G	3₁₀ helix	trans	-106.1	-6.5	-178.6	-73.5	165.9	0	0	0	114.7	D37	D37-L39 PolarHBondContact O-N 2.71Å; D37-L39 VanDerWaalsContact O-N 3.15Å
40	R	62.5	Low	62.1	Low	217 Å²	217	150.1 Å²	150.1	82%	0.819	75%	0.746	S	S	*	*	S	Bend	trans	-120.2	13.5	-174.3	-71.2	-172.8	-176.8	179.4	1.7	115.7	D37	D37-R40 PolarHBondContact O-N 3.42Å
41	I	60.8	Low	62.2	Low	134 Å²	134	153.9 Å²	153.9	69%	0.687	75%	0.751	S	S	*	*			trans	-101.5	64.2	170.2	-44.4	177.6	0	0	0	109.7	P43	I41-P43 VanDerWaalsContact C-CD 3.48Å; I41-P43 WeakPolarHBondContact O-CD 3.3Å
42	T	64.5	Low	62.3	Low	127 Å²	127	149.8 Å²	149.8	78%	0.779	75%	0.746	S	S	*	*			trans	-103.8	92.9	148.9	30.3	0	0	0	0	107.4	W44	T42-W44 PolarHBondContact O-N 2.75Å
43	P	64.7	Low	62.6	Low	93 Å²	93	149.3 Å²	149.3	60%	0.604	75%	0.749	S	S	*	*			trans	-70.5	96.6	168.5	28.6	-31.6	0	0	0	108.1	I41 H45	I41-P43 VanDerWaalsContact C-CD 3.48Å; I41-P43 WeakPolarHBondContact O-CD 3.3Å; P43-H45 PolarHBondContact O-N 2.88Å
44	W	75.1	Confident	62.7	Low	232 Å²	232	152.6 Å²	152.6	88%	0.879	76%	0.758	S	S	*	*			trans	-76.1	68.7	159.3	-163.2	-50.1	0	0	0	107.9	T42 S46	T42-W44 PolarHBondContact O-N 2.75Å; W44-S46 PolarHBondContact O-N 3.15Å
45	H	70.7	Confident	63	Low	163 Å²	163	153.6 Å²	153.6	76%	0.755	76%	0.759	S	S	*	*			trans	-88.9	96.8	168.1	-80.5	75.7	0	0	0	108.2	P43 S47	P43-H45 PolarHBondContact O-N 2.88Å; H45-S47 PolarHBondContact O-N 3Å
46	S	66.9	Low	63.4	Low	101 Å²	101	153.2 Å²	153.2	71%	0.706	76%	0.761	S	S	*	*			trans	-57.2	114.2	160.1	29.2	0	0	0	0	109.1	W44	W44-S46 PolarHBondContact O-N 3.15Å
47	S	65.1	Low	63.6	Low	112 Å²	112	153 Å²	153	78%	0.783	76%	0.764	S	S	*	*			trans	-122	103	164.9	-78	0	0	0	0	108.2	H45	H45-S47 PolarHBondContact O-N 3Å
48	R	56.6	Low	64.2	Low	319 Å²	319	159 Å²	159	100%	1.204	79%	0.791	S	S	*	*			trans	30.1	0	137.6	-159.5	-177.6	-60.5	-169.4	1.9	116.8

Retrieved 48 of 48 residues in 18.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).