A0A077ZKX9_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZKX9, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 66 aa.

						>A0A077ZKX9_TRITR|A0A077ZKX9
MVHSQPTLGMVAASITEFDYKAGYYKPLSSMMQHAFVYQHHKGMHPLTFCRVAVAMSALTVVNILR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	51.8	Low	59.4	Low	232 Å²	232	125.7 Å²	125.7	100%	1.143	70%	0.702	S	S	*	*				0	108	0	-142.2	168.7	-169.4	0	0	106.2	H3	M1-H3 PolarHBondContact O-N 2.98Å
2	V	40.2	Very low	59.7	Low	146 Å²	146	116.4 Å²	116.4	89%	0.885	65%	0.653	S	S	*	*			trans	-66.9	104.1	-179.3	179.8	0	0	0	0	107.1	S4	V2-S4 PolarHBondContact O-N 3.05Å; V2-S4 VanDerWaalsContact O-N 3.09Å
3	H	58.5	Low	60	Low	178 Å²	178	111.5 Å²	111.5	82%	0.824	64%	0.636	S	S	*	*			trans	-74.3	91.1	174.6	-110.2	116.2	0	0	0	107.4	M1 Q5	M1-H3 PolarHBondContact O-N 2.98Å; H3-Q5 PolarHBondContact O-N 3.09Å
4	S	66.2	Low	60.5	Low	99 Å²	99	109.9 Å²	109.9	69%	0.692	64%	0.635	S	S	*	*			trans	-69.7	101.1	166.2	50.5	0	0	0	0	107.4	V2	V2-S4 PolarHBondContact O-N 3.05Å; V2-S4 VanDerWaalsContact O-N 3.09Å
5	Q	62.7	Low	61.4	Low	168 Å²	168	107.6 Å²	107.6	79%	0.785	62%	0.619	S	S	*	*			trans	-49.4	130.1	171.2	-89.8	178	-16.8	0	0	108.6	H3 T7	H3-Q5 PolarHBondContact O-N 3.09Å; Q5-T7 PolarHBondContact O-N 2.96Å
6	P	59.2	Low	62.3	Low	85 Å²	85	106.2 Å²	106.2	55%	0.552	61%	0.612	S	S	*	*			trans	-62	110.7	171.8	27	-32.7	0	0	0	107.4	M10 V11	P6-M10 HydrophobicContact CB-CB 4.47Å; P6-V11 HydrophobicContact CB-CG2 3.84Å; P6-V11 HydrophobicContact CG-CG2 4.2Å
7	T	68.3	Low	63	Low	98 Å²	98	105.6 Å²	105.6	60%	0.601	60%	0.603	S	S	*	*			trans	-61.8	152.1	177.7	-28.4	0	0	0	0	108.8	Q5 G9 M10 V11	Q5-T7 PolarHBondContact O-N 2.96Å; T7-G9 PolarHBondContact O-N 3.03Å; T7-M10 WeakPolarHBondContact O-CA 3.4Å; T7-M10 WeakPolarHBondContact O-CB 3.41Å; T7-M10 PolarHBondContact O-N 3.43Å; T7-V11 PolarHBondContact O-N 3.35Å; T7-V11 VanDerWaalsContact O-N 3.08Å
8	L	57.6	Low	63.9	Low	149 Å²	149	103.7 Å²	103.7	78%	0.78	59%	0.587	S	S	*	*	H	α-helix	trans	-47.9	-33.3	178.3	-73.4	166.8	0	0	0	113.2	A12	L8-A12 VanDerWaalsContact O-CB 3.25Å; L8-A12 WeakPolarHBondContact O-CB 3.41Å; L8-A12 PolarHBondContact O-N 2.98Å
9	G	62.4	Low	64.7	Low	50 Å²	50	99.9 Å²	99.9	52%	0.515	57%	0.565	S	S	.	*	H	α-helix	trans	-68.3	-35.7	173.9	0	0	0	0	0	114.7	T7 A13	T7-G9 PolarHBondContact O-N 3.03Å; G9-A13 VanDerWaalsContact O-CB 3.27Å; G9-A13 WeakPolarHBondContact O-CB 3.42Å; G9-A13 PolarHBondContact O-N 3.32Å
10	M	63.2	Low	65.3	Low	120 Å²	120	105.3 Å²	105.3	59%	0.591	58%	0.577	S	S	*	*	H	α-helix	trans	-71.2	-38.3	174.3	-66	179.6	63	0	0	111.3	P6 T7 A13 S14	P6-M10 HydrophobicContact CB-CB 4.47Å; T7-M10 WeakPolarHBondContact O-CA 3.4Å; T7-M10 WeakPolarHBondContact O-CB 3.41Å; T7-M10 PolarHBondContact O-N 3.43Å; M10-A13 PolarHBondContact O-N 3.48Å; M10-S14 PolarHBondContact O-N 3.49Å
11	V	63.1	Low	65.8	Low	58 Å²	58	110 Å²	110	35%	0.352	59%	0.592	S	S	.	*	H	α-helix	trans	-68.6	-46.4	175.8	-176.3	0	0	0	0	110.6	P6 T7 A13 S14 I15	P6-V11 HydrophobicContact CB-CG2 3.84Å; P6-V11 HydrophobicContact CG-CG2 4.2Å; T7-V11 PolarHBondContact O-N 3.35Å; T7-V11 VanDerWaalsContact O-N 3.08Å; V11-A13 VanDerWaalsContact C-N 3.28Å; V11-A13 PolarHBondContact O-N 3.2Å; V11-S14 PolarHBondContact O-N 3.36Å; V11-S14 PolarHBondContact O-OG 3.1Å; V11-I15 HydrophobicContact CG1-CD1 4.13Å; V11-I15 WeakPolarHBondContact O-CG1 3.29Å; V11-I15 PolarHBondContact O-N 3.22Å
12	A	63.3	Low	67.2	Low	14 Å²	14	100.8 Å²	100.8	12%	0.116	55%	0.553	C	S	.	*	H	α-helix	trans	-65.3	-29.2	176.6	0	0	0	0	0	113.2	L8 S14 L28 S29 M32	L8-A12 VanDerWaalsContact O-CB 3.25Å; L8-A12 WeakPolarHBondContact O-CB 3.41Å; L8-A12 PolarHBondContact O-N 2.98Å; A12-S14 VanDerWaalsContact C-N 3.3Å; A12-L28 WeakPolarHBondContact O-CB 3.17Å; A12-S29 PolarHBondContact O-N 3.34Å; A12-S29 VanDerWaalsContact O-N 3.08Å; A12-M32 HydrophobicContact CB-SD 3.87Å
13	A	63.3	Low	69.5	Low	52 Å²	52	96.3 Å²	96.3	43%	0.43	54%	0.536	S	S	.	.	H	α-helix	trans	-70.1	-27.7	172	0	0	0	0	0	112.8	G9 M10 V11	G9-A13 VanDerWaalsContact O-CB 3.27Å; G9-A13 WeakPolarHBondContact O-CB 3.42Å; G9-A13 PolarHBondContact O-N 3.32Å; M10-A13 PolarHBondContact O-N 3.48Å; V11-A13 VanDerWaalsContact C-N 3.28Å; V11-A13 PolarHBondContact O-N 3.2Å
14	S	67.4	Low	70.7	Confident	89 Å²	89	94 Å²	94	62%	0.622	52%	0.521	S	S	*	.	H	α-helix	trans	-83.5	-19.6	178.3	66.9	0	0	0	0	114.8	M10 V11 A12	M10-S14 PolarHBondContact O-N 3.49Å; V11-S14 PolarHBondContact O-N 3.36Å; V11-S14 PolarHBondContact O-OG 3.1Å; A12-S14 VanDerWaalsContact C-N 3.3Å
15	I	73.6	Confident	71.4	Confident	76 Å²	76	96.9 Å²	96.9	39%	0.39	52%	0.518	S	S	.	.			trans	-84.4	126.7	177.3	-61.2	162.5	0	0	0	107.9	V11 L28	V11-I15 HydrophobicContact CG1-CD1 4.13Å; V11-I15 WeakPolarHBondContact O-CG1 3.29Å; V11-I15 PolarHBondContact O-N 3.22Å; I15-L28 HydrophobicContact CB-CB 3.91Å; I15-L28 HydrophobicContact CB-CD2 3.86Å; I15-L28 HydrophobicContact CD1-CD2 3.85Å; I15-L28 HydrophobicContact CG1-CD2 4.47Å; I15-L28 HydrophobicContact CG2-CB 4Å; I15-L28 HydrophobicContact CG2-CD2 3.83Å; I15-L28 HydrophobicContact CG2-CG 4.43Å; I15-L28 VanDerWaalsContact O-CB 3.23Å; I15-L28 WeakPolarHBondContact O-CB 3.47Å; I15-L28 PolarHBondContact O-N 3.27Å
16	T	76.6	Confident	72.1	Confident	85 Å²	85	90.6 Å²	90.6	52%	0.521	49%	0.488	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.9	138.3	170.4	53	0	0	0	0	109.9	K26	T16-K26 CarbonylContact C-O 3.56Å; T16-K26 WeakPolarHBondContact CA-O 3.21Å
17	E	72.9	Confident	72.8	Confident	97 Å²	97	89.3 Å²	89.3	45%	0.453	48%	0.48	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.5	145.3	176.3	-176.9	170.6	-163.2	0	0	109.1	D19 Y25 K26 L28 M31	E17-D19 PolarHBondContact O-N 2.76Å; E17-Y25 CarbonylContact O-C 3.58Å; E17-Y25 WeakPolarHBondContact O-CA 3.44Å; E17-K26 PolarHBondContact N-O 3.3Å; E17-K26 PolarHBondContact O-N 3.08Å; E17-L28 WeakPolarHBondContact OE2-CD1 3.49Å; E17-M31 HydrophobicContact CB-CE 3.69Å; E17-M31 HydrophobicContact CB-SD 3.8Å; E17-M31 HydrophobicContact CG-CE 4Å; E17-M31 HydrophobicContact CG-SD 3.9Å; E17-M31 WeakPolarHBondContact O-CE 3.45Å
18	F	79.1	Confident	72.8	Confident	71 Å²	71	85.9 Å²	85.9	31%	0.311	46%	0.458	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.2	115.6	178.8	-173.3	-100.8	0	0	0	109.9	Y20 Y25	F18-Y20 AromaticContact CD1-CD1 3.95Å; F18-Y20 HydrophobicContact CD1-CD1 3.95Å; F18-Y20 HydrophobicContact CD1-CD2 4.23Å; F18-Y20 HydrophobicContact CD1-CE1 4.04Å; F18-Y20 HydrophobicContact CD1-CE2 4.32Å; F18-Y20 HydrophobicContact CD1-CG 4.05Å; F18-Y20 AromaticContact CE1-CD1 3.98Å; F18-Y20 HydrophobicContact CE1-CD1 3.98Å; F18-Y20 HydrophobicContact CE1-CE1 4.29Å; F18-Y20 HydrophobicContact CE1-CG 4.33Å; F18-Y20 PolarHBondContact O-N 2.94Å; F18-Y20 VanDerWaalsContact O-N 3.16Å; F18-Y25 HydrophobicContact CB-CD1 4.03Å; F18-Y25 HydrophobicContact CB-CE1 3.84Å; F18-Y25 HydrophobicContact CD2-CD1 4.26Å; F18-Y25 AromaticContact CD2-CD2 3.93Å; F18-Y25 HydrophobicContact CD2-CD2 3.93Å; F18-Y25 HydrophobicContact CD2-CE1 4.07Å; F18-Y25 AromaticContact CD2-CE2 3.72Å; F18-Y25 HydrophobicContact CD2-CE2 3.72Å; F18-Y25 HydrophobicContact CD2-CG 4.2Å; F18-Y25 AromaticContact CD2-CZ 3.79Å; F18-Y25 HydrophobicContact CE2-CE2 4.28Å; F18-Y25 HydrophobicContact CG-CE1 4.43Å
19	D	79.3	Confident	73.3	Confident	32 Å²	32	80.7 Å²	80.7	17%	0.171	43%	0.434	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.9	99.2	174	-170.4	-33.2	0	0	0	109	E17 K21 A22 G23 Y24 K26 M31	E17-D19 PolarHBondContact O-N 2.76Å; D19-K21 PolarHBondContact O-N 3.45Å; D19-K21 WeakPolarHBondContact OD1-CA 3.43Å; D19-K21 VanDerWaalsContact OD1-CB 3.26Å; D19-K21 WeakPolarHBondContact OD1-CB 3.25Å; D19-K21 PolarHBondContact OD1-N 3Å; D19-A22 HydrophobicContact CB-CB 3.8Å; D19-A22 VanDerWaalsContact CG-CB 3.43Å; D19-A22 PolarHBondContact O-N 2.92Å; D19-A22 VanDerWaalsContact O-N 3.12Å; D19-A22 PolarHBondContact OD1-N 3.33Å; D19-G23 PolarHBondContact O-N 2.98Å; D19-Y24 WeakPolarHBondContact CB-O 3.38Å; D19-Y24 PolarHBondContact N-O 3.48Å; D19-K26 HydrophobicContact CB-CD 3.94Å; D19-K26 HydrophobicContact CB-CG 4.26Å; D19-K26 WeakPolarHBondContact OD2-CD 3.27Å; D19-K26 WeakPolarHBondContact OD2-CE 3.5Å; D19-K26 IonicContact OD2-NZ 2.67Å; D19-K26 PolarHBondContact OD2-NZ 3.45Å; D19-M31 HydrophobicContact CB-CE 3.77Å
20	Y	76.6	Confident	73.4	Confident	206 Å²	206	80 Å²	80	81%	0.808	42%	0.421	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.1	-27.2	177.2	-73	-85.4	0	0	0	113.7	F18	F18-Y20 AromaticContact CD1-CD1 3.95Å; F18-Y20 HydrophobicContact CD1-CD1 3.95Å; F18-Y20 HydrophobicContact CD1-CD2 4.23Å; F18-Y20 HydrophobicContact CD1-CE1 4.04Å; F18-Y20 HydrophobicContact CD1-CE2 4.32Å; F18-Y20 HydrophobicContact CD1-CG 4.05Å; F18-Y20 AromaticContact CE1-CD1 3.98Å; F18-Y20 HydrophobicContact CE1-CD1 3.98Å; F18-Y20 HydrophobicContact CE1-CE1 4.29Å; F18-Y20 HydrophobicContact CE1-CG 4.33Å; F18-Y20 PolarHBondContact O-N 2.94Å; F18-Y20 VanDerWaalsContact O-N 3.16Å
21	K	77.3	Confident	73.4	Confident	205 Å²	205	76 Å²	76	89%	0.891	40%	0.402	S	S	*	.	T	Hydrogen-bonded Turn	trans	-79.7	-36.3	178.3	-173.6	-179.5	-179.2	-178.9	0	111.2	D19	D19-K21 PolarHBondContact O-N 3.45Å; D19-K21 WeakPolarHBondContact OD1-CA 3.43Å; D19-K21 VanDerWaalsContact OD1-CB 3.26Å; D19-K21 WeakPolarHBondContact OD1-CB 3.25Å; D19-K21 PolarHBondContact OD1-N 3Å
22	A	81.4	Confident	73.4	Confident	39 Å²	39	78 Å²	78	32%	0.322	41%	0.408	S	S	.	.	T	Hydrogen-bonded Turn	trans	-92.6	-17.9	-176.8	0	0	0	0	0	113.3	D19 Y24	D19-A22 HydrophobicContact CB-CB 3.8Å; D19-A22 VanDerWaalsContact CG-CB 3.43Å; D19-A22 PolarHBondContact O-N 2.92Å; D19-A22 VanDerWaalsContact O-N 3.12Å; D19-A22 PolarHBondContact OD1-N 3.33Å; A22-Y24 VanDerWaalsContact C-N 3.33Å; A22-Y24 HydrophobicContact CB-CD1 3.58Å; A22-Y24 HydrophobicContact CB-CE1 3.23Å; A22-Y24 HydrophobicContact CB-CG 4.44Å; A22-Y24 WeakPolarHBondContact O-CD1 3.46Å
23	G	86.8	Confident	73.3	Confident	52 Å²	52	83.6 Å²	83.6	54%	0.536	43%	0.432	S	S	.	.	T	Hydrogen-bonded Turn	trans	75	17.8	-179.4	0	0	0	0	0	114.3	D19	D19-G23 PolarHBondContact O-N 2.98Å
24	Y	84.5	Confident	73.1	Confident	129 Å²	129	87.2 Å²	87.2	51%	0.506	44%	0.44	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-146	160.9	-179.5	64.4	-92.7	0	0	0	113	D19 A22 K26	D19-Y24 WeakPolarHBondContact CB-O 3.38Å; D19-Y24 PolarHBondContact N-O 3.48Å; A22-Y24 VanDerWaalsContact C-N 3.33Å; A22-Y24 HydrophobicContact CB-CD1 3.58Å; A22-Y24 HydrophobicContact CB-CE1 3.23Å; A22-Y24 HydrophobicContact CB-CG 4.44Å; A22-Y24 WeakPolarHBondContact O-CD1 3.46Å; Y24-K26 HydrophobicContact CD2-CG 3.76Å; Y24-K26 HydrophobicContact CE2-CD 3.94Å; Y24-K26 HydrophobicContact CE2-CG 3.37Å; Y24-K26 WeakPolarHBondContact OH-CE 3.48Å; Y24-K26 PolarHBondContact OH-NZ 3.45Å
25	Y	80.4	Confident	72.6	Confident	160 Å²	160	85.8 Å²	85.8	63%	0.627	43%	0.433	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-74.7	127.5	176.1	-67.7	-90.3	0	0	0	111	E17 F18	E17-Y25 CarbonylContact O-C 3.58Å; E17-Y25 WeakPolarHBondContact O-CA 3.44Å; F18-Y25 HydrophobicContact CB-CD1 4.03Å; F18-Y25 HydrophobicContact CB-CE1 3.84Å; F18-Y25 HydrophobicContact CD2-CD1 4.26Å; F18-Y25 AromaticContact CD2-CD2 3.93Å; F18-Y25 HydrophobicContact CD2-CD2 3.93Å; F18-Y25 HydrophobicContact CD2-CE1 4.07Å; F18-Y25 AromaticContact CD2-CE2 3.72Å; F18-Y25 HydrophobicContact CD2-CE2 3.72Å; F18-Y25 HydrophobicContact CD2-CG 4.2Å; F18-Y25 AromaticContact CD2-CZ 3.79Å; F18-Y25 HydrophobicContact CE2-CE2 4.28Å; F18-Y25 HydrophobicContact CG-CE1 4.43Å
26	K	77.1	Confident	71.9	Confident	36 Å²	36	88.7 Å²	88.7	16%	0.157	44%	0.443	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.1	148.4	172.6	-64.5	176.5	178	174.6	0	110.3	T16 E17 D19 Y24 L28 M31	T16-K26 CarbonylContact C-O 3.56Å; T16-K26 WeakPolarHBondContact CA-O 3.21Å; E17-K26 PolarHBondContact N-O 3.3Å; E17-K26 PolarHBondContact O-N 3.08Å; D19-K26 HydrophobicContact CB-CD 3.94Å; D19-K26 HydrophobicContact CB-CG 4.26Å; D19-K26 WeakPolarHBondContact OD2-CD 3.27Å; D19-K26 WeakPolarHBondContact OD2-CE 3.5Å; D19-K26 IonicContact OD2-NZ 2.67Å; D19-K26 PolarHBondContact OD2-NZ 3.45Å; Y24-K26 HydrophobicContact CD2-CG 3.76Å; Y24-K26 HydrophobicContact CE2-CD 3.94Å; Y24-K26 HydrophobicContact CE2-CG 3.37Å; Y24-K26 WeakPolarHBondContact OH-CE 3.48Å; Y24-K26 PolarHBondContact OH-NZ 3.45Å; K26-L28 PolarHBondContact O-N 3.21Å; K26-M31 HydrophobicContact CB-CE 3.68Å; K26-M31 HydrophobicContact CB-CG 4.28Å; K26-M31 HydrophobicContact CD-CE 4.39Å; K26-M31 HydrophobicContact CG-CE 4.34Å
27	P	74.8	Confident	71	Confident	57 Å²	57	88.9 Å²	88.9	37%	0.37	44%	0.444	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-55.5	134.6	167.7	-22.1	33	0	0	0	110.4	S29 S30 M31	P27-S29 PolarHBondContact O-N 3.05Å; P27-S30 WeakPolarHBondContact O-CA 3.49Å; P27-S30 VanDerWaalsContact O-CB 3.3Å; P27-S30 WeakPolarHBondContact O-CB 3.2Å; P27-S30 PolarHBondContact O-N 2.95Å; P27-M31 PolarHBondContact O-N 2.89Å
28	L	68.8	Low	70.3	Confident	27 Å²	27	90.8 Å²	90.8	14%	0.141	45%	0.448	C	S	.	.	H	α-helix	trans	-58.2	-31.4	177.4	-178.4	73	0	0	0	110.3	A12 I15 E17 K26 S30 M31 M32	A12-L28 WeakPolarHBondContact O-CB 3.17Å; I15-L28 HydrophobicContact CB-CB 3.91Å; I15-L28 HydrophobicContact CB-CD2 3.86Å; I15-L28 HydrophobicContact CD1-CD2 3.85Å; I15-L28 HydrophobicContact CG1-CD2 4.47Å; I15-L28 HydrophobicContact CG2-CB 4Å; I15-L28 HydrophobicContact CG2-CD2 3.83Å; I15-L28 HydrophobicContact CG2-CG 4.43Å; I15-L28 VanDerWaalsContact O-CB 3.23Å; I15-L28 WeakPolarHBondContact O-CB 3.47Å; I15-L28 PolarHBondContact O-N 3.27Å; E17-L28 WeakPolarHBondContact OE2-CD1 3.49Å; K26-L28 PolarHBondContact O-N 3.21Å; L28-S30 VanDerWaalsContact C-N 3.29Å; L28-S30 PolarHBondContact O-N 3.31Å; L28-M31 CarbonylContact O-C 3.59Å; L28-M31 PolarHBondContact O-N 2.92Å; L28-M32 HydrophobicContact CD1-CE 4.29Å; L28-M32 HydrophobicContact CD1-CG 4.33Å; L28-M32 HydrophobicContact CD2-CE 3.57Å; L28-M32 HydrophobicContact CD2-SD 4.07Å; L28-M32 HydrophobicContact CG-CE 3.84Å; L28-M32 HydrophobicContact CG-CG 4.01Å; L28-M32 HydrophobicContact CG-SD 3.9Å; L28-M32 WeakPolarHBondContact O-CB 3.43Å; L28-M32 VanDerWaalsContact O-CG 3.24Å; L28-M32 WeakPolarHBondContact O-CG 3.23Å; L28-M32 PolarHBondContact O-N 3.12Å
29	S	66.9	Low	69.1	Low	39 Å²	39	89 Å²	89	27%	0.273	44%	0.44	S	S	.	.	H	α-helix	trans	-56.1	-40.1	170.7	60.6	0	0	0	0	113.3	A12 P27 Q33	A12-S29 PolarHBondContact O-N 3.34Å; A12-S29 VanDerWaalsContact O-N 3.08Å; P27-S29 PolarHBondContact O-N 3.05Å; S29-Q33 WeakPolarHBondContact O-CB 3.37Å; S29-Q33 VanDerWaalsContact O-CG 3.24Å; S29-Q33 WeakPolarHBondContact O-CG 3.24Å; S29-Q33 PolarHBondContact O-N 2.66Å
30	S	66.1	Low	67.8	Low	36 Å²	36	95 Å²	95	25%	0.252	47%	0.467	S	S	.	.	H	α-helix	trans	-68.6	-45.4	175.9	-179.2	0	0	0	0	110.4	P27 L28 M32 Q33 H34	P27-S30 WeakPolarHBondContact O-CA 3.49Å; P27-S30 VanDerWaalsContact O-CB 3.3Å; P27-S30 WeakPolarHBondContact O-CB 3.2Å; P27-S30 PolarHBondContact O-N 2.95Å; L28-S30 VanDerWaalsContact C-N 3.29Å; L28-S30 PolarHBondContact O-N 3.31Å; S30-M32 PolarHBondContact O-N 3.2Å; S30-Q33 PolarHBondContact O-N 3.03Å; S30-H34 PolarHBondContact O-CD2 3Å; S30-H34 PolarHBondContact O-N 3.35Å
31	M	62.8	Low	66.8	Low	37 Å²	37	92.7 Å²	92.7	18%	0.182	46%	0.463	C	S	.	.	H	α-helix	trans	-65.7	-38.2	177.1	-61.4	-157.6	-167.8	0	0	112.8	E17 D19 K26 P27 L28 H34 A35	E17-M31 HydrophobicContact CB-CE 3.69Å; E17-M31 HydrophobicContact CB-SD 3.8Å; E17-M31 HydrophobicContact CG-CE 4Å; E17-M31 HydrophobicContact CG-SD 3.9Å; E17-M31 WeakPolarHBondContact O-CE 3.45Å; D19-M31 HydrophobicContact CB-CE 3.77Å; K26-M31 HydrophobicContact CB-CE 3.68Å; K26-M31 HydrophobicContact CB-CG 4.28Å; K26-M31 HydrophobicContact CD-CE 4.39Å; K26-M31 HydrophobicContact CG-CE 4.34Å; P27-M31 PolarHBondContact O-N 2.89Å; L28-M31 CarbonylContact O-C 3.59Å; L28-M31 PolarHBondContact O-N 2.92Å; M31-H34 CarbonylContact O-C 3.54Å; M31-H34 WeakPolarHBondContact O-CB 3.24Å; M31-H34 PolarHBondContact O-N 3.48Å; M31-A35 WeakPolarHBondContact O-CB 3.45Å; M31-A35 PolarHBondContact O-N 3.22Å
32	M	61.7	Low	65.8	Low	98 Å²	98	89.7 Å²	89.7	48%	0.483	45%	0.45	S	S	.	.	H	α-helix	trans	-67.2	-37.3	176.2	-79.1	-179.1	163.4	0	0	111.8	A12 L28 S30 H34 A35 F36	A12-M32 HydrophobicContact CB-SD 3.87Å; L28-M32 HydrophobicContact CD1-CE 4.29Å; L28-M32 HydrophobicContact CD1-CG 4.33Å; L28-M32 HydrophobicContact CD2-CE 3.57Å; L28-M32 HydrophobicContact CD2-SD 4.07Å; L28-M32 HydrophobicContact CG-CE 3.84Å; L28-M32 HydrophobicContact CG-CG 4.01Å; L28-M32 HydrophobicContact CG-SD 3.9Å; L28-M32 WeakPolarHBondContact O-CB 3.43Å; L28-M32 VanDerWaalsContact O-CG 3.24Å; L28-M32 WeakPolarHBondContact O-CG 3.23Å; L28-M32 PolarHBondContact O-N 3.12Å; S30-M32 PolarHBondContact O-N 3.2Å; M32-H34 VanDerWaalsContact C-N 3.33Å; M32-A35 PolarHBondContact O-N 3Å; M32-F36 VanDerWaalsContact O-CB 3.23Å; M32-F36 WeakPolarHBondContact O-CB 3.35Å; M32-F36 PolarHBondContact O-N 3.41Å
33	Q	62.3	Low	64.5	Low	132 Å²	132	91 Å²	91	62%	0.617	47%	0.468	S	S	*	.	H	α-helix	trans	-61.5	-44.1	170.4	-77.9	173.7	-18.8	0	0	110.8	S29 S30 F36 V37	S29-Q33 WeakPolarHBondContact O-CB 3.37Å; S29-Q33 VanDerWaalsContact O-CG 3.24Å; S29-Q33 WeakPolarHBondContact O-CG 3.24Å; S29-Q33 PolarHBondContact O-N 2.66Å; S30-Q33 PolarHBondContact O-N 3.03Å; Q33-F36 PolarHBondContact O-N 3.47Å; Q33-V37 WeakPolarHBondContact O-CB 3.38Å; Q33-V37 VanDerWaalsContact O-CG2 3.24Å; Q33-V37 WeakPolarHBondContact O-CG2 3.5Å; Q33-V37 PolarHBondContact O-N 3.22Å
34	H	59.1	Low	63.1	Low	129 Å²	129	93.7 Å²	93.7	60%	0.597	47%	0.468	S	S	*	.	H	α-helix	trans	-64.8	-40	175.3	-76.9	-72.1	0	0	0	112.5	S30 M31 M32 Y38	S30-H34 PolarHBondContact O-CD2 3Å; S30-H34 PolarHBondContact O-N 3.35Å; M31-H34 CarbonylContact O-C 3.54Å; M31-H34 WeakPolarHBondContact O-CB 3.24Å; M31-H34 PolarHBondContact O-N 3.48Å; M32-H34 VanDerWaalsContact C-N 3.33Å; H34-Y38 VanDerWaalsContact O-CB 3.26Å; H34-Y38 WeakPolarHBondContact O-CB 3.42Å; H34-Y38 PolarHBondContact O-N 3.32Å
35	A	57.4	Low	61.8	Low	58 Å²	58	93.1 Å²	93.1	48%	0.479	47%	0.469	S	S	.	.	H	α-helix	trans	-66.5	-41.2	176.3	0	0	0	0	0	111.5	M31 M32 Y38 Q39	M31-A35 WeakPolarHBondContact O-CB 3.45Å; M31-A35 PolarHBondContact O-N 3.22Å; M32-A35 PolarHBondContact O-N 3Å; A35-Y38 PolarHBondContact O-N 3.28Å; A35-Q39 VanDerWaalsContact O-CB 3.3Å; A35-Q39 WeakPolarHBondContact O-CB 3.47Å; A35-Q39 PolarHBondContact O-N 3.33Å
36	F	59	Low	60.8	Low	138 Å²	138	89.9 Å²	89.9	61%	0.605	47%	0.468	S	S	*	.	H	α-helix	trans	-64.2	-44.4	176.7	-174.3	-97.4	0	0	0	111.8	M32 Q33 Y38 Q39 H40	M32-F36 VanDerWaalsContact O-CB 3.23Å; M32-F36 WeakPolarHBondContact O-CB 3.35Å; M32-F36 PolarHBondContact O-N 3.41Å; Q33-F36 PolarHBondContact O-N 3.47Å; F36-Y38 VanDerWaalsContact C-N 3.35Å; F36-Q39 WeakPolarHBondContact O-CB 3.3Å; F36-Q39 PolarHBondContact O-N 3Å; F36-H40 PolarHBondContact O-N 3.03Å
37	V	57.9	Low	60.2	Low	88 Å²	88	93.5 Å²	93.5	53%	0.533	49%	0.489	S	S	.	.	H	α-helix	trans	-65.7	-38.5	175.4	174.1	0	0	0	0	111.2	Q33 Q39 H40 H41	Q33-V37 WeakPolarHBondContact O-CB 3.38Å; Q33-V37 VanDerWaalsContact O-CG2 3.24Å; Q33-V37 WeakPolarHBondContact O-CG2 3.5Å; Q33-V37 PolarHBondContact O-N 3.22Å; V37-Q39 VanDerWaalsContact C-N 3.33Å; V37-H40 PolarHBondContact O-N 3.45Å; V37-H41 PolarHBondContact O-N 3.35Å; V37-H41 VanDerWaalsContact O-N 3.14Å
38	Y	56.5	Low	59.8	Low	137 Å²	137	94.3 Å²	94.3	54%	0.537	49%	0.493	S	S	.	.	H	α-helix	trans	-66.9	-35.3	174.7	-165.9	-97.6	0	0	0	112.1	H34 A35 F36 H41 K42	H34-Y38 VanDerWaalsContact O-CB 3.26Å; H34-Y38 WeakPolarHBondContact O-CB 3.42Å; H34-Y38 PolarHBondContact O-N 3.32Å; A35-Y38 PolarHBondContact O-N 3.28Å; F36-Y38 VanDerWaalsContact C-N 3.35Å; Y38-H41 PolarHBondContact O-N 3.46Å; Y38-K42 HydrophobicContact CD1-CD 4.43Å; Y38-K42 HydrophobicContact CE1-CD 3.65Å; Y38-K42 HydrophobicContact CE1-CG 4.27Å; Y38-K42 HydrophobicContact CE2-CD 4.35Å; Y38-K42 VanDerWaalsContact CZ-CE 3.46Å; Y38-K42 PolarHBondContact O-N 2.9Å; Y38-K42 VanDerWaalsContact OH-CE 3.23Å; Y38-K42 WeakPolarHBondContact OH-CE 3.23Å; Y38-K42 PolarHBondContact OH-NZ 2.96Å
39	Q	53.9	Low	59.6	Low	34 Å²	34	98.8 Å²	98.8	16%	0.159	51%	0.511	C	S	.	.	H	α-helix	trans	-68.4	-37.7	176.3	-148.3	174.9	19.9	0	0	111.9	A35 F36 V37 H41 K42 G43 M44	A35-Q39 VanDerWaalsContact O-CB 3.3Å; A35-Q39 WeakPolarHBondContact O-CB 3.47Å; A35-Q39 PolarHBondContact O-N 3.33Å; F36-Q39 WeakPolarHBondContact O-CB 3.3Å; F36-Q39 PolarHBondContact O-N 3Å; V37-Q39 VanDerWaalsContact C-N 3.33Å; Q39-H41 VanDerWaalsContact C-N 3.28Å; Q39-H41 PolarHBondContact O-N 3.08Å; Q39-K42 PolarHBondContact O-N 3.28Å; Q39-G43 PolarHBondContact O-N 2.71Å; Q39-M44 HydrophobicContact CG-CB 3.41Å; Q39-M44 VanDerWaalsContact CG-CB 3.41Å; Q39-M44 HydrophobicContact CG-CE 3.94Å
40	H	52.2	Low	59.8	Low	159 Å²	159	100.3 Å²	100.3	74%	0.736	52%	0.521	S	S	*	.	H	α-helix	trans	-64.4	-32.7	172.4	-167.3	-95.2	0	0	0	112.1	F36 V37	F36-H40 PolarHBondContact O-N 3.03Å; V37-H40 PolarHBondContact O-N 3.45Å
41	H	55.9	Low	60.2	Low	157 Å²	157	108.4 Å²	108.4	73%	0.727	55%	0.546	S	S	*	.	H	α-helix	trans	-84.5	-20	179.5	-105.8	-81.7	0	0	0	115.1	V37 Y38 Q39	V37-H41 PolarHBondContact O-N 3.35Å; V37-H41 VanDerWaalsContact O-N 3.14Å; Y38-H41 PolarHBondContact O-N 3.46Å; Q39-H41 VanDerWaalsContact C-N 3.28Å; Q39-H41 PolarHBondContact O-N 3.08Å
42	K	56.7	Low	60.6	Low	141 Å²	141	111.3 Å²	111.3	61%	0.613	57%	0.565	S	S	*	*	H	α-helix	trans	-118.9	10.7	-175.8	-68.2	-155	176.4	-174.7	0	115.7	Y38 Q39 M44	Y38-K42 HydrophobicContact CD1-CD 4.43Å; Y38-K42 HydrophobicContact CE1-CD 3.65Å; Y38-K42 HydrophobicContact CE1-CG 4.27Å; Y38-K42 HydrophobicContact CE2-CD 4.35Å; Y38-K42 VanDerWaalsContact CZ-CE 3.46Å; Y38-K42 PolarHBondContact O-N 2.9Å; Y38-K42 VanDerWaalsContact OH-CE 3.23Å; Y38-K42 WeakPolarHBondContact OH-CE 3.23Å; Y38-K42 PolarHBondContact OH-NZ 2.96Å; Q39-K42 PolarHBondContact O-N 3.28Å; K42-M44 VanDerWaalsContact C-N 3.26Å; K42-M44 PolarHBondContact O-N 3.2Å
43	G	54.4	Low	61.2	Low	67 Å²	67	108.5 Å²	108.5	69%	0.691	56%	0.558	S	S	*	*	T	Hydrogen-bonded Turn	trans	61.6	31.7	170.5	0	0	0	0	0	113.9	Q39 H45	Q39-G43 PolarHBondContact O-N 2.71Å; G43-H45 PolarHBondContact O-N 3.36Å
44	M	55.9	Low	62.2	Low	109 Å²	109	107.2 Å²	107.2	54%	0.537	56%	0.559	S	S	.	*			trans	-69.8	118.7	178.6	-128.9	173.8	58.8	0	0	109.1	Q39 K42	Q39-M44 HydrophobicContact CG-CB 3.41Å; Q39-M44 VanDerWaalsContact CG-CB 3.41Å; Q39-M44 HydrophobicContact CG-CE 3.94Å; K42-M44 VanDerWaalsContact C-N 3.26Å; K42-M44 PolarHBondContact O-N 3.2Å
45	H	58.1	Low	63.2	Low	116 Å²	116	103.5 Å²	103.5	54%	0.537	55%	0.55	S	S	.	*			trans	-52.2	127.7	-169.7	-139	-98.7	0	0	0	111.5	G43 L47 T48	G43-H45 PolarHBondContact O-N 3.36Å; H45-L47 WeakPolarHBondContact ND1-CD1 3.48Å; H45-L47 WeakPolarHBondContact ND1-CG 3.24Å; H45-L47 PolarHBondContact O-N 3.4Å; H45-T48 WeakPolarHBondContact O-CB 3.41Å; H45-T48 PolarHBondContact O-N 2.89Å
46	P	59.6	Low	63.9	Low	93 Å²	93	106.5 Å²	106.5	60%	0.604	56%	0.556	S	S	*	*	H	α-helix	trans	-57.3	-24.8	-178	20.9	-32.2	0	0	0	112.7	T48 F49 C50	P46-T48 VanDerWaalsContact C-N 3.27Å; P46-T48 PolarHBondContact O-N 3.08Å; P46-F49 PolarHBondContact O-N 3.21Å; P46-C50 PolarHBondContact O-N 3.01Å; P46-C50 PolarHBondContact O-SG 3.4Å; P46-C50 VanDerWaalsContact O-SG 3.41Å
47	L	64.5	Low	64.7	Low	112 Å²	112	103.2 Å²	103.2	59%	0.586	55%	0.55	S	S	*	*	H	α-helix	trans	-57.9	-36.2	173.5	-64	178.7	0	0	0	113.1	H45 C50 R51	H45-L47 WeakPolarHBondContact ND1-CD1 3.48Å; H45-L47 WeakPolarHBondContact ND1-CG 3.24Å; H45-L47 PolarHBondContact O-N 3.4Å; L47-C50 PolarHBondContact O-N 2.91Å; L47-R51 WeakPolarHBondContact O-CG 3.48Å; L47-R51 PolarHBondContact O-N 3.24Å
48	T	66.5	Low	65.8	Low	74 Å²	74	101.6 Å²	101.6	45%	0.454	55%	0.546	S	S	.	.	H	α-helix	trans	-69.7	-40.8	178.8	-51.2	0	0	0	0	110.9	H45 P46 R51 V52	H45-T48 WeakPolarHBondContact O-CB 3.41Å; H45-T48 PolarHBondContact O-N 2.89Å; P46-T48 VanDerWaalsContact C-N 3.27Å; P46-T48 PolarHBondContact O-N 3.08Å; T48-R51 PolarHBondContact O-N 2.82Å; T48-V52 WeakPolarHBondContact O-CG2 3.48Å; T48-V52 PolarHBondContact O-N 3.4Å; T48-V52 VanDerWaalsContact O-N 3.08Å
49	F	63.5	Low	67	Low	121 Å²	121	100.5 Å²	100.5	53%	0.531	55%	0.549	S	S	.	.	H	α-helix	trans	-62.1	-46.7	174.2	-179.1	-96.9	0	0	0	111.2	P46 R51 V52 A53	P46-F49 PolarHBondContact O-N 3.21Å; F49-R51 VanDerWaalsContact C-N 3.29Å; F49-R51 PolarHBondContact O-N 3.33Å; F49-V52 PolarHBondContact O-N 2.96Å; F49-A53 WeakPolarHBondContact O-CB 3.37Å; F49-A53 PolarHBondContact O-N 2.74Å
50	C	71.3	Confident	68.2	Low	71 Å²	71	102.3 Å²	102.3	48%	0.48	56%	0.563	S	S	.	*	H	α-helix	trans	-58.3	-40	175.9	-68	0	0	0	0	112.2	P46 L47 A53 V54	P46-C50 PolarHBondContact O-N 3.01Å; P46-C50 PolarHBondContact O-SG 3.4Å; P46-C50 VanDerWaalsContact O-SG 3.41Å; L47-C50 PolarHBondContact O-N 2.91Å; C50-A53 PolarHBondContact O-N 2.96Å; C50-V54 WeakPolarHBondContact O-CB 3.04Å; C50-V54 WeakPolarHBondContact O-CG2 3.26Å; C50-V54 PolarHBondContact O-N 3.06Å
51	R	74.3	Confident	69.3	Low	205 Å²	205	98.8 Å²	98.8	77%	0.774	55%	0.552	S	S	*	*	H	α-helix	trans	-64.7	-44.7	178.1	-69.2	-120.8	175.8	145.5	-2.1	112.5	L47 T48 F49 V54 A55	L47-R51 WeakPolarHBondContact O-CG 3.48Å; L47-R51 PolarHBondContact O-N 3.24Å; T48-R51 PolarHBondContact O-N 2.82Å; F49-R51 VanDerWaalsContact C-N 3.29Å; F49-R51 PolarHBondContact O-N 3.33Å; R51-V54 PolarHBondContact O-N 3.34Å; R51-A55 WeakPolarHBondContact O-CB 3.3Å; R51-A55 PolarHBondContact O-N 2.79Å
52	V	72.5	Confident	70.4	Confident	98 Å²	98	94.7 Å²	94.7	59%	0.594	54%	0.538	S	S	*	.	H	α-helix	trans	-65.6	-42	177.6	176.7	0	0	0	0	110.5	T48 F49 A55 M56	T48-V52 WeakPolarHBondContact O-CG2 3.48Å; T48-V52 PolarHBondContact O-N 3.4Å; T48-V52 VanDerWaalsContact O-N 3.08Å; F49-V52 PolarHBondContact O-N 2.96Å; V52-A55 PolarHBondContact O-N 3.47Å; V52-M56 WeakPolarHBondContact O-CB 3.34Å; V52-M56 PolarHBondContact O-N 3.35Å
53	A	74.7	Confident	71.4	Confident	40 Å²	40	93.9 Å²	93.9	33%	0.331	54%	0.54	S	S	.	.	H	α-helix	trans	-62	-46.1	176.9	0	0	0	0	0	112.1	F49 C50 A55 M56 S57	F49-A53 WeakPolarHBondContact O-CB 3.37Å; F49-A53 PolarHBondContact O-N 2.74Å; C50-A53 PolarHBondContact O-N 2.96Å; A53-A55 PolarHBondContact O-N 3.06Å; A53-M56 PolarHBondContact O-N 2.77Å; A53-S57 PolarHBondContact O-N 3.21Å; A53-S57 PolarHBondContact O-OG 3.4Å
54	V	81.8	Confident	72.5	Confident	104 Å²	104	96.8 Å²	96.8	63%	0.63	54%	0.538	S	S	*	.	H	α-helix	trans	-61.3	-43.3	176.8	169.8	0	0	0	0	111.3	C50 R51 S57 A58	C50-V54 WeakPolarHBondContact O-CB 3.04Å; C50-V54 WeakPolarHBondContact O-CG2 3.26Å; C50-V54 PolarHBondContact O-N 3.06Å; R51-V54 PolarHBondContact O-N 3.34Å; V54-S57 PolarHBondContact O-N 2.95Å; V54-A58 WeakPolarHBondContact O-CB 3.35Å; V54-A58 PolarHBondContact O-N 2.83Å
55	A	80.2	Confident	73.4	Confident	51 Å²	51	98.5 Å²	98.5	42%	0.421	55%	0.549	S	S	.	.	H	α-helix	trans	-62.5	-43.9	177.1	0	0	0	0	0	112.1	R51 V52 A53 A58 L59	R51-A55 WeakPolarHBondContact O-CB 3.3Å; R51-A55 PolarHBondContact O-N 2.79Å; V52-A55 PolarHBondContact O-N 3.47Å; A53-A55 PolarHBondContact O-N 3.06Å; A55-A58 PolarHBondContact O-N 3.22Å; A55-L59 WeakPolarHBondContact O-CD1 3.37Å; A55-L59 PolarHBondContact O-N 3.45Å
56	M	71.8	Confident	73.5	Confident	121 Å²	121	104.8 Å²	104.8	60%	0.596	57%	0.568	S	S	*	*	H	α-helix	trans	-65.3	-42.7	178.3	-166	65.8	178.2	0	0	111.7	V52 A53 A58 L59 T60	V52-M56 WeakPolarHBondContact O-CB 3.34Å; V52-M56 PolarHBondContact O-N 3.35Å; A53-M56 PolarHBondContact O-N 2.77Å; M56-A58 VanDerWaalsContact C-N 3.34Å; M56-A58 PolarHBondContact O-N 3.19Å; M56-L59 WeakPolarHBondContact O-CB 3.18Å; M56-L59 PolarHBondContact O-N 3.06Å; M56-T60 PolarHBondContact O-N 3.24Å; M56-T60 PolarHBondContact O-OG1 2.67Å; M56-T60 VanDerWaalsContact O-OG1 3.12Å
57	S	76.9	Confident	74.2	Confident	70 Å²	70	105.4 Å²	105.4	49%	0.49	57%	0.566	S	S	.	*	H	α-helix	trans	-61.4	-40.6	174.5	-66.8	0	0	0	0	112.3	A53 V54 T60 V61	A53-S57 PolarHBondContact O-N 3.21Å; A53-S57 PolarHBondContact O-OG 3.4Å; V54-S57 PolarHBondContact O-N 2.95Å; S57-T60 PolarHBondContact O-N 2.85Å; S57-V61 WeakPolarHBondContact O-CG2 3.19Å; S57-V61 PolarHBondContact O-N 2.87Å; S57-V61 VanDerWaalsContact O-N 3.1Å
58	A	80.7	Confident	74.7	Confident	53 Å²	53	105 Å²	105	44%	0.438	57%	0.565	S	S	.	*	H	α-helix	trans	-65.4	-41.1	176.7	0	0	0	0	0	112.2	V54 A55 M56 T60 V61 V62	V54-A58 WeakPolarHBondContact O-CB 3.35Å; V54-A58 PolarHBondContact O-N 2.83Å; A55-A58 PolarHBondContact O-N 3.22Å; M56-A58 VanDerWaalsContact C-N 3.34Å; M56-A58 PolarHBondContact O-N 3.19Å; A58-T60 VanDerWaalsContact C-N 3.32Å; A58-T60 PolarHBondContact O-N 3.22Å; A58-V61 PolarHBondContact O-N 3.46Å; A58-V62 WeakPolarHBondContact O-CG2 3.23Å; A58-V62 PolarHBondContact O-N 2.88Å
59	L	81.7	Confident	75.2	Confident	114 Å²	114	106.7 Å²	106.7	60%	0.597	57%	0.571	S	S	*	*	H	α-helix	trans	-59.3	-42.1	174.1	-82.3	154.2	0	0	0	111.7	A55 M56 V62 N63	A55-L59 WeakPolarHBondContact O-CD1 3.37Å; A55-L59 PolarHBondContact O-N 3.45Å; M56-L59 WeakPolarHBondContact O-CB 3.18Å; M56-L59 PolarHBondContact O-N 3.06Å; L59-V62 PolarHBondContact O-N 3.18Å; L59-N63 WeakPolarHBondContact O-CB 2.97Å; L59-N63 PolarHBondContact O-N 3.26Å
60	T	78.4	Confident	75.9	Confident	73 Å²	73	105.9 Å²	105.9	45%	0.448	57%	0.574	S	S	.	*	H	α-helix	trans	-62.7	-44	175.9	-54.8	0	0	0	0	112.1	M56 S57 A58 V62 N63 I64	M56-T60 PolarHBondContact O-N 3.24Å; M56-T60 PolarHBondContact O-OG1 2.67Å; M56-T60 VanDerWaalsContact O-OG1 3.12Å; S57-T60 PolarHBondContact O-N 2.85Å; A58-T60 VanDerWaalsContact C-N 3.32Å; A58-T60 PolarHBondContact O-N 3.22Å; T60-V62 VanDerWaalsContact C-N 3.32Å; T60-V62 PolarHBondContact O-N 2.9Å; T60-N63 PolarHBondContact O-N 3.14Å; T60-I64 HydrophobicContact CG2-CD1 3.82Å; T60-I64 HydrophobicContact CG2-CG1 4.43Å; T60-I64 VanDerWaalsContact O-CG1 3.29Å; T60-I64 WeakPolarHBondContact O-CG1 3.26Å; T60-I64 PolarHBondContact O-N 2.91Å
61	V	75.5	Confident	76.2	Confident	84 Å²	84	108.1 Å²	108.1	51%	0.509	58%	0.58	S	S	.	*	H	α-helix	trans	-60.9	-42.6	177	174.2	0	0	0	0	111	S57 A58 N63 I64 L65	S57-V61 WeakPolarHBondContact O-CG2 3.19Å; S57-V61 PolarHBondContact O-N 2.87Å; S57-V61 VanDerWaalsContact O-N 3.1Å; A58-V61 PolarHBondContact O-N 3.46Å; V61-N63 VanDerWaalsContact C-N 3.35Å; V61-N63 PolarHBondContact O-N 3.16Å; V61-I64 PolarHBondContact O-N 3.47Å; V61-L65 HydrophobicContact CG1-CD1 4.1Å; V61-L65 WeakPolarHBondContact O-CG 3.38Å; V61-L65 PolarHBondContact O-N 2.79Å
62	V	80	Confident	76.3	Confident	71 Å²	71	101.6 Å²	101.6	43%	0.43	57%	0.567	S	S	.	*	H	α-helix	trans	-66.9	-35.7	177.6	174.4	0	0	0	0	112.1	A58 L59 T60 L65 R66	A58-V62 WeakPolarHBondContact O-CG2 3.23Å; A58-V62 PolarHBondContact O-N 2.88Å; L59-V62 PolarHBondContact O-N 3.18Å; T60-V62 VanDerWaalsContact C-N 3.32Å; T60-V62 PolarHBondContact O-N 2.9Å; V62-L65 PolarHBondContact O-N 2.75Å; V62-R66 VanDerWaalsContact CG1-NH1 3.27Å; V62-R66 PolarHBondContact O-N 3.12Å
63	N	76.9	Confident	76.6	Confident	124 Å²	124	101.9 Å²	101.9	66%	0.663	57%	0.565	S	S	*	*	H	α-helix	trans	-77.2	-20	178.6	-155.2	41.2	0	0	0	113.5	L59 T60 V61	L59-N63 WeakPolarHBondContact O-CB 2.97Å; L59-N63 PolarHBondContact O-N 3.26Å; T60-N63 PolarHBondContact O-N 3.14Å; V61-N63 VanDerWaalsContact C-N 3.35Å; V61-N63 PolarHBondContact O-N 3.16Å
64	I	77.8	Confident	76.7	Confident	128 Å²	128	106.6 Å²	106.6	66%	0.656	58%	0.583	S	S	*	*	H	α-helix	trans	-80.3	-30.4	172.2	-70.2	166.9	0	0	0	111.2	T60 V61	T60-I64 HydrophobicContact CG2-CD1 3.82Å; T60-I64 HydrophobicContact CG2-CG1 4.43Å; T60-I64 VanDerWaalsContact O-CG1 3.29Å; T60-I64 WeakPolarHBondContact O-CG1 3.26Å; T60-I64 PolarHBondContact O-N 2.91Å; V61-I64 PolarHBondContact O-N 3.47Å
65	L	74.8	Confident	76.3	Confident	146 Å²	146	106.8 Å²	106.8	76%	0.764	58%	0.579	S	S	*	*			trans	-84.9	-9.1	179.5	-69.6	172.7	0	0	0	113.8	V61 V62	V61-L65 HydrophobicContact CG1-CD1 4.1Å; V61-L65 WeakPolarHBondContact O-CG 3.38Å; V61-L65 PolarHBondContact O-N 2.79Å; V62-L65 PolarHBondContact O-N 2.75Å
66	R	61.1	Low	75.9	Confident	247 Å²	247	111.9 Å²	111.9	93%	0.932	59%	0.593	S	S	*	*			trans	-98	0	169.4	-75.1	-164.4	174.1	108.1	1.7	110.1	V62	V62-R66 VanDerWaalsContact CG1-NH1 3.27Å; V62-R66 PolarHBondContact O-N 3.12Å

Retrieved 66 of 66 residues in 18.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).