A0A077ZKZ4_TRITR Loading...

Cell division protein ZapA

Activator of cell division through the inhibition of FtsZ GTPase activity, therefore promoting FtsZ assembly into bundles of protofilaments necessary for the formation of the division Z ring. It is recruited early at mid-cell but it is not essential for cell division.

AlphaFold DB , UniProt , Accession A0A077ZKZ4, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 109 aa.

						>A0A077ZKZ4_TRITR|A0A077ZKZ4
MSAQPVDIQIFGRSLRVNCPPDQRDALNQAADDLNQRLQDLKERTRVTNTEQLVFIAALNISYELAQEKAKTRDYAASMEQRIRMLQQTIEQALLEQGRITEKTNQNFE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	61.4	Low	88.8	Confident	206 Å²	206	76.1 Å²	76.1	100%	1.015	42%	0.415	S	S	*	.				0	118	0	-63.6	-171.6	-179.4	0	0	107.1
2	S	80.9	Confident	89.1	Confident	85 Å²	85	74.7 Å²	74.7	59%	0.594	43%	0.431	S	S	*	.			trans	-75.6	126.9	-172.5	56.7	0	0	0	0	110.5	Q4	S2-Q4 PolarHBondContact O-N 2.85Å; S2-Q4 PolarHBondContact OG-NE2 3.33Å
3	A	87.8	Confident	89.4	Confident	50 Å²	50	81.3 Å²	81.3	41%	0.413	44%	0.444	S	S	.	.			trans	-56.6	134.9	171.5	0	0	0	0	0	109.9	N18 P20	A3-N18 HydrophobicContact CB-CB 4.16Å; A3-P20 HydrophobicContact CB-CG 4.5Å
4	Q	90.1	Very high	89.8	Confident	104 Å²	104	83 Å²	83	49%	0.486	47%	0.465	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.4	145.8	176.6	-64.8	-61.1	-22.6	0	0	109.5	S2 V6 N18 C19	S2-Q4 PolarHBondContact O-N 2.85Å; S2-Q4 PolarHBondContact OG-NE2 3.33Å; Q4-V6 VanDerWaalsContact O-CG2 3.25Å; Q4-V6 WeakPolarHBondContact O-CG2 3.45Å; Q4-V6 PolarHBondContact O-N 2.74Å; Q4-N18 WeakPolarHBondContact O-CA 3.35Å; Q4-C19 PolarHBondContact N-O 3.41Å; Q4-C19 PolarHBondContact O-N 3.21Å
5	P	92.7	Very high	90.1	Very high	61 Å²	61	83.4 Å²	83.4	40%	0.396	47%	0.465	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-66.4	132.7	175.6	28.4	-33.4	0	0	0	109	R16 N18	P5-R16 HydrophobicContact CB-CG 4.08Å; P5-N18 WeakPolarHBondContact CA-OD1 3.46Å
6	V	93.9	Very high	90.4	Very high	31 Å²	31	88.6 Å²	88.6	19%	0.188	48%	0.475	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.9	130.1	177	-136.9	0	0	0	0	112.1	Q4 V17 C19 R24	Q4-V6 VanDerWaalsContact O-CG2 3.25Å; Q4-V6 WeakPolarHBondContact O-CG2 3.45Å; Q4-V6 PolarHBondContact O-N 2.74Å; V6-V17 PolarHBondContact N-O 2.83Å; V6-V17 PolarHBondContact O-N 2.85Å; V6-C19 HydrophobicContact CG2-CB 3.59Å; V6-R24 VanDerWaalsContact CG1-NE 3.31Å
7	D	94.8	Very high	90.6	Very high	92 Å²	92	86.5 Å²	86.5	49%	0.492	47%	0.466	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.4	132.2	-178.1	-59.3	-41.8	0	0	0	108.8	L15 R16 R24	D7-L15 WeakPolarHBondContact CA-O 3.25Å; D7-R16 WeakPolarHBondContact OD1-CB 3.45Å; D7-R16 WeakPolarHBondContact OD1-CG 3.33Å; D7-R16 IonicContact OD1-CZ 3.69Å; D7-R16 IonicContact OD1-NE 3.7Å; D7-R16 PolarHBondContact OD1-NE 2.85Å; D7-R16 IonicContact OD1-NH2 2.85Å; D7-R16 PolarHBondContact OD1-NH2 2.86Å; D7-R16 IonicContact OD2-CZ 3.13Å; D7-R16 IonicContact OD2-NE 3.34Å; D7-R16 IonicContact OD2-NH2 3.86Å; D7-R16 PolarHBondContact OD2-NH2 3.03Å; D7-R24 PolarHBondContact O-NH2 3.44Å
8	I	94.9	Very high	90.8	Very high	17 Å²	17	88.2 Å²	88.2	9%	0.087	48%	0.475	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.8	148.5	178.6	62.3	177.9	0	0	0	109.1	I10 L15 V17 L27	I8-I10 HydrophobicContact CD1-CD1 3.76Å; I8-I10 HydrophobicContact CG1-CD1 4.35Å; I8-L15 HydrophobicContact CD1-CB 4.4Å; I8-L15 HydrophobicContact CG1-CB 3.87Å; I8-L15 PolarHBondContact N-O 2.88Å; I8-L15 PolarHBondContact O-N 2.86Å; I8-V17 HydrophobicContact CD1-CG2 3.72Å; I8-V17 HydrophobicContact CG1-CG2 4.3Å; I8-L27 HydrophobicContact CD1-CD1 4.27Å; I8-L27 HydrophobicContact CG2-CD2 4.4Å; I8-L27 HydrophobicContact CG2-CG 4.49Å
9	Q	93.5	Very high	90.9	Very high	128 Å²	128	83.9 Å²	83.9	60%	0.598	45%	0.452	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-114.6	120.7	175.8	-167.3	175.1	18	0	0	109.8	R13 N35	Q9-R13 CarbonylContact C-O 3.56Å; Q9-R13 WeakPolarHBondContact CA-O 3.49Å; Q9-N35 PolarHBondContact O-ND2 2.97Å
10	I	94.1	Very high	91.1	Very high	19 Å²	19	81.2 Å²	81.2	10%	0.097	44%	0.439	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.4	117.7	177.8	-65.2	162.4	0	0	0	107.8	I8 G12 R13 L15 A31 L34 N35 L38	I8-I10 HydrophobicContact CD1-CD1 3.76Å; I8-I10 HydrophobicContact CG1-CD1 4.35Å; I10-G12 VanDerWaalsContact C-N 3.26Å; I10-G12 PolarHBondContact O-N 3.38Å; I10-R13 PolarHBondContact N-O 2.8Å; I10-R13 WeakPolarHBondContact O-CA 3.38Å; I10-R13 WeakPolarHBondContact O-CB 3.46Å; I10-R13 PolarHBondContact O-N 3.42Å; I10-L15 HydrophobicContact CD1-CD1 3.94Å; I10-A31 HydrophobicContact CD1-CB 4.15Å; I10-A31 HydrophobicContact CG1-CB 3.96Å; I10-L34 HydrophobicContact CD1-CD2 4.07Å; I10-L34 HydrophobicContact CG2-CD2 3.77Å; I10-L34 HydrophobicContact CG2-CG 3.92Å; I10-N35 WeakPolarHBondContact CA-OD1 3.37Å; I10-L38 HydrophobicContact CG2-CD1 3.98Å
11	F	93.1	Very high	91.1	Very high	44 Å²	44	81.3 Å²	81.3	19%	0.193	45%	0.445	C	S	.	.	T	Hydrogen-bonded Turn	trans	52.5	44.6	173.1	-147.3	-111.5	0	0	0	113	R13 N35 L38 Q39 K42 T50 L53	F11-R13 PolarHBondContact O-N 2.96Å; F11-N35 PolarHBondContact N-OD1 3.35Å; F11-L38 HydrophobicContact CB-CD1 3.67Å; F11-L38 HydrophobicContact CD1-CB 4.42Å; F11-L38 HydrophobicContact CD1-CD1 4.49Å; F11-L38 HydrophobicContact CD2-CB 3.5Å; F11-L38 HydrophobicContact CD2-CD1 4.23Å; F11-L38 HydrophobicContact CE1-CB 4.49Å; F11-L38 HydrophobicContact CE2-CB 3.62Å; F11-L38 HydrophobicContact CG-CB 3.92Å; F11-L38 HydrophobicContact CG-CD1 3.91Å; F11-L38 HydrophobicContact CZ-CB 4.1Å; F11-Q39 HydrophobicContact CE2-CB 4.37Å; F11-K42 HydrophobicContact CE1-CD 4.46Å; F11-K42 HydrophobicContact CZ-CB 4.28Å; F11-K42 HydrophobicContact CZ-CD 3.82Å; F11-T50 HydrophobicContact CD1-CG2 3.85Å; F11-T50 HydrophobicContact CE1-CG2 4.4Å; F11-L53 HydrophobicContact CE1-CD1 3.89Å; F11-L53 HydrophobicContact CZ-CD1 4.14Å
12	G	91.5	Very high	92.7	Very high	59 Å²	59	76.9 Å²	76.9	61%	0.608	43%	0.425	S	S	*	.	T	Hydrogen-bonded Turn	trans	77.3	-2.4	-177.3	0	0	0	0	0	115.2	I10	I10-G12 VanDerWaalsContact C-N 3.26Å; I10-G12 PolarHBondContact O-N 3.38Å
13	R	93.4	Very high	93.3	Very high	161 Å²	161	77.7 Å²	77.7	61%	0.608	42%	0.419	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-98.2	136.2	176.3	-56.6	-57.5	-174.2	110.1	-0.6	110.7	Q9 I10 F11	Q9-R13 CarbonylContact C-O 3.56Å; Q9-R13 WeakPolarHBondContact CA-O 3.49Å; I10-R13 PolarHBondContact N-O 2.8Å; I10-R13 WeakPolarHBondContact O-CA 3.38Å; I10-R13 WeakPolarHBondContact O-CB 3.46Å; I10-R13 PolarHBondContact O-N 3.42Å; F11-R13 PolarHBondContact O-N 2.96Å
14	S	94.9	Very high	93.6	Very high	105 Å²	105	78.2 Å²	78.2	73%	0.734	41%	0.41	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-91.6	133.1	174.3	-61.1	0	0	0	0	109.9
15	L	94.2	Very high	93.8	Very high	89 Å²	89	79.3 Å²	79.3	47%	0.466	42%	0.42	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.8	141.5	178.3	-68.2	164.5	0	0	0	109	D7 I8 I10	D7-L15 WeakPolarHBondContact CA-O 3.25Å; I8-L15 HydrophobicContact CD1-CB 4.4Å; I8-L15 HydrophobicContact CG1-CB 3.87Å; I8-L15 PolarHBondContact N-O 2.88Å; I8-L15 PolarHBondContact O-N 2.86Å; I10-L15 HydrophobicContact CD1-CD1 3.94Å
16	R	95.1	Very high	94	Very high	167 Å²	167	79.6 Å²	79.6	63%	0.63	43%	0.427	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-109.2	119.9	172	177	166.8	-86.9	-171.7	-8.5	108.9	P5 D7	P5-R16 HydrophobicContact CB-CG 4.08Å; D7-R16 WeakPolarHBondContact OD1-CB 3.45Å; D7-R16 WeakPolarHBondContact OD1-CG 3.33Å; D7-R16 IonicContact OD1-CZ 3.69Å; D7-R16 IonicContact OD1-NE 3.7Å; D7-R16 PolarHBondContact OD1-NE 2.85Å; D7-R16 IonicContact OD1-NH2 2.85Å; D7-R16 PolarHBondContact OD1-NH2 2.86Å; D7-R16 IonicContact OD2-CZ 3.13Å; D7-R16 IonicContact OD2-NE 3.34Å; D7-R16 IonicContact OD2-NH2 3.86Å; D7-R16 PolarHBondContact OD2-NH2 3.03Å
17	V	94	Very high	94	Very high	53 Å²	53	79.9 Å²	79.9	32%	0.321	43%	0.427	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.1	130.8	-177.4	-177.9	0	0	0	0	109.1	V6 I8 C19 L27	V6-V17 PolarHBondContact N-O 2.83Å; V6-V17 PolarHBondContact O-N 2.85Å; I8-V17 HydrophobicContact CD1-CG2 3.72Å; I8-V17 HydrophobicContact CG1-CG2 4.3Å; V17-C19 PolarHBondContact O-N 3.32Å; V17-L27 HydrophobicContact CB-CD2 4.15Å; V17-L27 HydrophobicContact CG1-CD1 4.48Å; V17-L27 HydrophobicContact CG1-CD2 4.11Å
18	N	94.5	Very high	94	Very high	116 Å²	116	78 Å²	78	62%	0.62	42%	0.418	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-75.9	117.2	172	-70.5	-31.2	0	0	0	109.2	A3 Q4 P5	A3-N18 HydrophobicContact CB-CB 4.16Å; Q4-N18 WeakPolarHBondContact O-CA 3.35Å; P5-N18 WeakPolarHBondContact CA-OD1 3.46Å
19	C	92.8	Very high	94.1	Very high	7 Å²	7	83.3 Å²	83.3	5%	0.047	44%	0.442	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.2	129.5	-173.9	-170.4	0	0	0	0	110.4	Q4 V6 V17 Q23 L27	Q4-C19 PolarHBondContact N-O 3.41Å; Q4-C19 PolarHBondContact O-N 3.21Å; V6-C19 HydrophobicContact CG2-CB 3.59Å; V17-C19 PolarHBondContact O-N 3.32Å; C19-Q23 VanDerWaalsContact SG-C 3.51Å; C19-L27 HydrophobicContact CB-CD2 3.69Å
20	P	94.2	Very high	94.2	Very high	29 Å²	29	79.8 Å²	79.8	19%	0.188	44%	0.435	C	S	.	.			trans	-57.2	143.9	165.5	-24.7	36.1	0	0	0	111.3	A3 D22 Q23 R24	A3-P20 HydrophobicContact CB-CG 4.5Å; P20-D22 WeakPolarHBondContact CB-OD1 3.3Å; P20-D22 PolarHBondContact O-N 3.26Å; P20-Q23 HydrophobicContact CB-CB 4.48Å; P20-Q23 HydrophobicContact CB-CG 4.31Å; P20-Q23 HydrophobicContact CG-CG 4.45Å; P20-Q23 PolarHBondContact O-N 2.87Å; P20-R24 PolarHBondContact O-N 3.35Å
21	P	91.4	Very high	94.3	Very high	85 Å²	85	79.2 Å²	79.2	55%	0.552	43%	0.433	S	S	*	.	G	3₁₀ helix	trans	-55.1	-36.1	-178	-26.9	34.9	0	0	0	114.2	Q23 R24	P21-Q23 VanDerWaalsContact C-N 3.26Å; P21-Q23 PolarHBondContact O-N 3.28Å; P21-R24 WeakPolarHBondContact O-CB 3.49Å; P21-R24 PolarHBondContact O-N 3.17Å
22	D	93.9	Very high	94.4	Very high	112 Å²	112	81.8 Å²	81.8	60%	0.599	45%	0.449	S	S	*	.	G	3₁₀ helix	trans	-70.8	-17.5	178.9	59	-60.1	0	0	0	114	P20	P20-D22 WeakPolarHBondContact CB-OD1 3.3Å; P20-D22 PolarHBondContact O-N 3.26Å
23	Q	94.4	Very high	94.7	Very high	103 Å²	103	82.3 Å²	82.3	48%	0.481	44%	0.438	S	S	.	.	G	3₁₀ helix	trans	-101.9	-0.4	179.1	-63.4	-173.5	-4.9	0	0	112.8	C19 P20 P21 D25 A26 L27	C19-Q23 VanDerWaalsContact SG-C 3.51Å; P20-Q23 HydrophobicContact CB-CB 4.48Å; P20-Q23 HydrophobicContact CB-CG 4.31Å; P20-Q23 HydrophobicContact CG-CG 4.45Å; P20-Q23 PolarHBondContact O-N 2.87Å; P21-Q23 VanDerWaalsContact C-N 3.26Å; P21-Q23 PolarHBondContact O-N 3.28Å; Q23-D25 VanDerWaalsContact C-N 3.33Å; Q23-D25 PolarHBondContact O-N 3.27Å; Q23-A26 PolarHBondContact O-N 3.43Å; Q23-L27 WeakPolarHBondContact O-CB 3.42Å; Q23-L27 PolarHBondContact O-N 2.98Å
24	R	93.9	Very high	94.9	Very high	60 Å²	60	76.9 Å²	76.9	23%	0.226	42%	0.42	C	S	.	.	H	α-helix	trans	-60.8	-42.9	-174	-179.5	55.5	-177	168.2	-4.8	112.2	V6 D7 P20 P21 L27 N28	V6-R24 VanDerWaalsContact CG1-NE 3.31Å; D7-R24 PolarHBondContact O-NH2 3.44Å; P20-R24 PolarHBondContact O-N 3.35Å; P21-R24 WeakPolarHBondContact O-CB 3.49Å; P21-R24 PolarHBondContact O-N 3.17Å; R24-L27 PolarHBondContact O-N 3.4Å; R24-N28 PolarHBondContact NE-OD1 3.45Å; R24-N28 PolarHBondContact NH1-OD1 2.93Å; R24-N28 PolarHBondContact NH2-OD1 3.49Å; R24-N28 PolarHBondContact O-N 3.39Å; R24-N28 PolarHBondContact O-ND2 3.23Å
25	D	94.8	Very high	95	Very high	128 Å²	128	73.9 Å²	73.9	68%	0.684	40%	0.396	S	S	*	.	H	α-helix	trans	-66.8	-42.5	179.7	-65.3	-23.1	0	0	0	111.5	Q23 L27 N28 Q29	Q23-D25 VanDerWaalsContact C-N 3.33Å; Q23-D25 PolarHBondContact O-N 3.27Å; D25-L27 VanDerWaalsContact C-N 3.31Å; D25-L27 PolarHBondContact O-N 3.38Å; D25-N28 PolarHBondContact O-N 3.2Å; D25-Q29 WeakPolarHBondContact O-CB 3.5Å; D25-Q29 PolarHBondContact O-N 2.71Å
26	A	95.9	Very high	95.1	Very high	66 Å²	66	74.8 Å²	74.8	55%	0.545	40%	0.398	S	S	.	.	H	α-helix	trans	-62.4	-39	175.3	0	0	0	0	0	112	Q23 Q29 A30	Q23-A26 PolarHBondContact O-N 3.43Å; A26-Q29 PolarHBondContact O-N 3.29Å; A26-A30 WeakPolarHBondContact O-CB 3.48Å; A26-A30 PolarHBondContact O-N 2.93Å
27	L	95.4	Very high	95.2	Very high	37 Å²	37	70 Å²	70	19%	0.194	38%	0.38	C	S	.	.	H	α-helix	trans	-64.9	-43.1	175.2	177	61.3	0	0	0	111.9	I8 V17 C19 Q23 R24 D25 A30 A31	I8-L27 HydrophobicContact CD1-CD1 4.27Å; I8-L27 HydrophobicContact CG2-CD2 4.4Å; I8-L27 HydrophobicContact CG2-CG 4.49Å; V17-L27 HydrophobicContact CB-CD2 4.15Å; V17-L27 HydrophobicContact CG1-CD1 4.48Å; V17-L27 HydrophobicContact CG1-CD2 4.11Å; C19-L27 HydrophobicContact CB-CD2 3.69Å; Q23-L27 WeakPolarHBondContact O-CB 3.42Å; Q23-L27 PolarHBondContact O-N 2.98Å; R24-L27 PolarHBondContact O-N 3.4Å; D25-L27 VanDerWaalsContact C-N 3.31Å; D25-L27 PolarHBondContact O-N 3.38Å; L27-A30 PolarHBondContact O-N 3.26Å; L27-A31 PolarHBondContact O-N 3.49Å
28	N	94.8	Very high	95.4	Very high	54 Å²	54	67.6 Å²	67.6	29%	0.289	37%	0.365	S	S	.	.	H	α-helix	trans	-63.4	-44.7	176.3	-69.3	-31	0	0	0	110.9	R24 D25 A30 A31 D32	R24-N28 PolarHBondContact NE-OD1 3.45Å; R24-N28 PolarHBondContact NH1-OD1 2.93Å; R24-N28 PolarHBondContact NH2-OD1 3.49Å; R24-N28 PolarHBondContact O-N 3.39Å; R24-N28 PolarHBondContact O-ND2 3.23Å; D25-N28 PolarHBondContact O-N 3.2Å; N28-A30 VanDerWaalsContact C-N 3.28Å; N28-A30 PolarHBondContact O-N 3.07Å; N28-A31 WeakPolarHBondContact O-CB 3.48Å; N28-A31 PolarHBondContact O-N 3.24Å; N28-A31 VanDerWaalsContact O-N 3.07Å; N28-D32 PolarHBondContact O-N 3.44Å
29	Q	96.4	Very high	95.5	Very high	127 Å²	127	65.6 Å²	65.6	59%	0.593	35%	0.352	S	S	*	.	H	α-helix	trans	-61.1	-38.1	177.2	-174	59.4	76.8	0	0	112.3	D25 A26 D32 D33	D25-Q29 WeakPolarHBondContact O-CB 3.5Å; D25-Q29 PolarHBondContact O-N 2.71Å; A26-Q29 PolarHBondContact O-N 3.29Å; Q29-D32 PolarHBondContact O-N 3.39Å; Q29-D33 WeakPolarHBondContact O-CB 3.33Å; Q29-D33 PolarHBondContact O-N 3.36Å
30	A	95.4	Very high	95.7	Very high	55 Å²	55	68.3 Å²	68.3	46%	0.455	37%	0.366	S	S	.	.	H	α-helix	trans	-67.8	-36.1	174.6	0	0	0	0	0	112.4	A26 L27 N28 L34	A26-A30 WeakPolarHBondContact O-CB 3.48Å; A26-A30 PolarHBondContact O-N 2.93Å; L27-A30 PolarHBondContact O-N 3.26Å; N28-A30 VanDerWaalsContact C-N 3.28Å; N28-A30 PolarHBondContact O-N 3.07Å; A30-L34 WeakPolarHBondContact O-CB 3.26Å; A30-L34 PolarHBondContact O-N 2.97Å
31	A	95.9	Very high	95.8	Very high	7 Å²	7	67.6 Å²	67.6	6%	0.058	36%	0.36	C	S	.	.	H	α-helix	trans	-65.8	-41.5	174.7	0	0	0	0	0	111.5	I10 L27 N28 L34 N35	I10-A31 HydrophobicContact CD1-CB 4.15Å; I10-A31 HydrophobicContact CG1-CB 3.96Å; L27-A31 PolarHBondContact O-N 3.49Å; N28-A31 WeakPolarHBondContact O-CB 3.48Å; N28-A31 PolarHBondContact O-N 3.24Å; N28-A31 VanDerWaalsContact O-N 3.07Å; A31-L34 PolarHBondContact O-N 3.32Å; A31-N35 WeakPolarHBondContact O-CB 3.39Å; A31-N35 PolarHBondContact O-N 3.39Å; A31-N35 PolarHBondContact O-ND2 3.34Å
32	D	96.7	Very high	96	Very high	98 Å²	98	68.1 Å²	68.1	52%	0.524	35%	0.354	S	S	.	.	H	α-helix	trans	-66.4	-43.1	176.7	-69.7	-22.5	0	0	0	112.2	N28 Q29 L34 N35 Q36	N28-D32 PolarHBondContact O-N 3.44Å; Q29-D32 PolarHBondContact O-N 3.39Å; D32-L34 PolarHBondContact O-N 3.25Å; D32-N35 WeakPolarHBondContact O-CB 3.45Å; D32-N35 PolarHBondContact O-N 3.42Å; D32-Q36 PolarHBondContact O-N 2.9Å
33	D	97.2	Very high	96.2	Very high	70 Å²	70	68.9 Å²	68.9	37%	0.374	35%	0.354	S	S	.	.	H	α-helix	trans	-58.9	-47	173.3	175	70.2	0	0	0	111.4	Q29 N35 Q36 R37	Q29-D33 WeakPolarHBondContact O-CB 3.33Å; Q29-D33 PolarHBondContact O-N 3.36Å; D33-N35 VanDerWaalsContact C-N 3.34Å; D33-N35 PolarHBondContact O-N 3.45Å; D33-Q36 PolarHBondContact O-N 2.95Å; D33-R37 VanDerWaalsContact CG-NE 3.32Å; D33-R37 VanDerWaalsContact O-CG 3.3Å; D33-R37 WeakPolarHBondContact O-CG 3.27Å; D33-R37 PolarHBondContact O-N 2.98Å; D33-R37 IonicContact OD1-CZ 3.02Å; D33-R37 IonicContact OD1-NE 3.77Å; D33-R37 PolarHBondContact OD1-NE 3.33Å; D33-R37 VanDerWaalsContact OD1-NE 3.13Å; D33-R37 IonicContact OD1-NH2 3.47Å; D33-R37 WeakPolarHBondContact OD2-CD 3.23Å; D33-R37 IonicContact OD2-CZ 3.98Å; D33-R37 IonicContact OD2-NE 2.83Å; D33-R37 PolarHBondContact OD2-NE 2.9Å; D33-R37 IonicContact OD2-NH2 2.82Å
34	L	97.2	Very high	96.3	Very high	46 Å²	46	73.7 Å²	73.7	24%	0.241	37%	0.368	C	S	.	.	H	α-helix	trans	-63.6	-39.2	177.8	-178.5	57.1	0	0	0	112.1	I10 A30 A31 D32 R37 L38 A57 I61	I10-L34 HydrophobicContact CD1-CD2 4.07Å; I10-L34 HydrophobicContact CG2-CD2 3.77Å; I10-L34 HydrophobicContact CG2-CG 3.92Å; A30-L34 WeakPolarHBondContact O-CB 3.26Å; A30-L34 PolarHBondContact O-N 2.97Å; A31-L34 PolarHBondContact O-N 3.32Å; D32-L34 PolarHBondContact O-N 3.25Å; L34-R37 PolarHBondContact O-N 3.26Å; L34-L38 HydrophobicContact CD1-CD1 4.06Å; L34-L38 HydrophobicContact CD1-CG 4.07Å; L34-L38 HydrophobicContact CG-CD1 3.98Å; L34-L38 HydrophobicContact CG-CG 4.43Å; L34-L38 WeakPolarHBondContact O-CB 3.08Å; L34-L38 VanDerWaalsContact O-CG 3.25Å; L34-L38 WeakPolarHBondContact O-CG 3.44Å; L34-L38 PolarHBondContact O-N 2.95Å; L34-A57 HydrophobicContact CD1-CB 4.26Å; L34-I61 HydrophobicContact CD1-CD1 4.23Å
35	N	96.9	Very high	96.3	Very high	43 Å²	43	73.7 Å²	73.7	23%	0.23	37%	0.374	C	S	.	.	H	α-helix	trans	-58.9	-48.1	174.7	-84.1	-37.5	0	0	0	111.7	Q9 I10 F11 A31 D32 D33 L38 Q39	Q9-N35 PolarHBondContact O-ND2 2.97Å; I10-N35 WeakPolarHBondContact CA-OD1 3.37Å; F11-N35 PolarHBondContact N-OD1 3.35Å; A31-N35 WeakPolarHBondContact O-CB 3.39Å; A31-N35 PolarHBondContact O-N 3.39Å; A31-N35 PolarHBondContact O-ND2 3.34Å; D32-N35 WeakPolarHBondContact O-CB 3.45Å; D32-N35 PolarHBondContact O-N 3.42Å; D33-N35 VanDerWaalsContact C-N 3.34Å; D33-N35 PolarHBondContact O-N 3.45Å; N35-L38 PolarHBondContact O-N 3.07Å; N35-Q39 WeakPolarHBondContact O-CB 3.44Å; N35-Q39 PolarHBondContact O-N 3.43Å
36	Q	97.2	Very high	96.2	Very high	108 Å²	108	78 Å²	78	51%	0.505	38%	0.381	S	S	.	.	H	α-helix	trans	-62.3	-46.3	178.7	-172.1	60.6	50.3	0	0	111.2	D32 D33 L38 Q39 D40	D32-Q36 PolarHBondContact O-N 2.9Å; D33-Q36 PolarHBondContact O-N 2.95Å; Q36-L38 VanDerWaalsContact C-N 3.32Å; Q36-L38 PolarHBondContact O-N 2.99Å; Q36-Q39 PolarHBondContact O-N 3.41Å; Q36-D40 PolarHBondContact NE2-OD1 3.49Å; Q36-D40 VanDerWaalsContact O-CG 3.27Å; Q36-D40 PolarHBondContact O-N 3.28Å
37	R	97	Very high	96.2	Very high	67 Å²	67	76.3 Å²	76.3	25%	0.253	36%	0.364	S	S	.	.	H	α-helix	trans	-58.9	-42.5	177.8	-72	170.6	179.3	-92.7	9.2	112.2	D33 L34 L41 E64	D33-R37 VanDerWaalsContact CG-NE 3.32Å; D33-R37 VanDerWaalsContact O-CG 3.3Å; D33-R37 WeakPolarHBondContact O-CG 3.27Å; D33-R37 PolarHBondContact O-N 2.98Å; D33-R37 IonicContact OD1-CZ 3.02Å; D33-R37 IonicContact OD1-NE 3.77Å; D33-R37 PolarHBondContact OD1-NE 3.33Å; D33-R37 VanDerWaalsContact OD1-NE 3.13Å; D33-R37 IonicContact OD1-NH2 3.47Å; D33-R37 WeakPolarHBondContact OD2-CD 3.23Å; D33-R37 IonicContact OD2-CZ 3.98Å; D33-R37 IonicContact OD2-NE 2.83Å; D33-R37 PolarHBondContact OD2-NE 2.9Å; D33-R37 IonicContact OD2-NH2 2.82Å; L34-R37 PolarHBondContact O-N 3.26Å; R37-L41 VanDerWaalsContact O-CB 3.26Å; R37-L41 WeakPolarHBondContact O-CB 3.49Å; R37-L41 WeakPolarHBondContact O-CG 3.25Å; R37-L41 PolarHBondContact O-N 3.01Å; R37-E64 IonicContact CZ-OE1 3.47Å; R37-E64 IonicContact CZ-OE2 3.41Å; R37-E64 VanDerWaalsContact NH1-CD 3.32Å; R37-E64 IonicContact NH1-OE1 3.89Å; R37-E64 PolarHBondContact NH1-OE1 3.46Å; R37-E64 IonicContact NH1-OE2 2.82Å; R37-E64 PolarHBondContact NH1-OE2 2.92Å; R37-E64 IonicContact NH2-OE1 2.74Å; R37-E64 IonicContact NH2-OE2 3.76Å; R37-E64 PolarHBondContact NH2-OE2 3.43Å
38	L	97.4	Very high	96	Very high	1 Å²	1	80.6 Å²	80.6	1%	0.005	39%	0.392	C	S	.	.	H	α-helix	trans	-68.2	-38	178.2	-70.3	170.7	0	0	0	112	I10 F11 L34 N35 Q36 K42 L53 V54 A57	I10-L38 HydrophobicContact CG2-CD1 3.98Å; F11-L38 HydrophobicContact CB-CD1 3.67Å; F11-L38 HydrophobicContact CD1-CB 4.42Å; F11-L38 HydrophobicContact CD1-CD1 4.49Å; F11-L38 HydrophobicContact CD2-CB 3.5Å; F11-L38 HydrophobicContact CD2-CD1 4.23Å; F11-L38 HydrophobicContact CE1-CB 4.49Å; F11-L38 HydrophobicContact CE2-CB 3.62Å; F11-L38 HydrophobicContact CG-CB 3.92Å; F11-L38 HydrophobicContact CG-CD1 3.91Å; F11-L38 HydrophobicContact CZ-CB 4.1Å; L34-L38 HydrophobicContact CD1-CD1 4.06Å; L34-L38 HydrophobicContact CD1-CG 4.07Å; L34-L38 HydrophobicContact CG-CD1 3.98Å; L34-L38 HydrophobicContact CG-CG 4.43Å; L34-L38 WeakPolarHBondContact O-CB 3.08Å; L34-L38 VanDerWaalsContact O-CG 3.25Å; L34-L38 WeakPolarHBondContact O-CG 3.44Å; L34-L38 PolarHBondContact O-N 2.95Å; N35-L38 PolarHBondContact O-N 3.07Å; Q36-L38 VanDerWaalsContact C-N 3.32Å; Q36-L38 PolarHBondContact O-N 2.99Å; L38-K42 WeakPolarHBondContact O-CB 3.45Å; L38-K42 PolarHBondContact O-N 3Å; L38-L53 HydrophobicContact CD2-CB 3.95Å; L38-V54 HydrophobicContact CD1-CG2 4.43Å; L38-V54 HydrophobicContact CD2-CG2 4.11Å; L38-A57 HydrophobicContact CD2-CB 3.8Å
39	Q	96.6	Very high	96	Very high	74 Å²	74	81.1 Å²	81.1	35%	0.346	40%	0.395	S	S	.	.	H	α-helix	trans	-64.1	-49.5	174.9	-177	61.6	26.6	0	0	111.1	F11 N35 Q36 L41 K42 E43	F11-Q39 HydrophobicContact CE2-CB 4.37Å; N35-Q39 WeakPolarHBondContact O-CB 3.44Å; N35-Q39 PolarHBondContact O-N 3.43Å; Q36-Q39 PolarHBondContact O-N 3.41Å; Q39-L41 VanDerWaalsContact C-N 3.33Å; Q39-L41 PolarHBondContact O-N 2.96Å; Q39-K42 WeakPolarHBondContact O-CB 3.49Å; Q39-K42 PolarHBondContact O-N 2.98Å; Q39-K42 VanDerWaalsContact O-N 3.17Å; Q39-E43 PolarHBondContact NE2-OE1 3.28Å; Q39-E43 WeakPolarHBondContact O-CG 3.43Å; Q39-E43 PolarHBondContact O-N 3.18Å
40	D	96.8	Very high	95.8	Very high	64 Å²	64	77 Å²	77	34%	0.342	38%	0.378	S	S	.	.	H	α-helix	trans	-61.4	-41.8	178.1	-67.6	-12.1	0	0	0	111.6	Q36 E43 R44	Q36-D40 PolarHBondContact NE2-OD1 3.49Å; Q36-D40 VanDerWaalsContact O-CG 3.27Å; Q36-D40 PolarHBondContact O-N 3.28Å; D40-E43 PolarHBondContact O-N 3.17Å; D40-R44 VanDerWaalsContact O-CB 3.31Å; D40-R44 WeakPolarHBondContact O-CB 3.35Å; D40-R44 WeakPolarHBondContact O-CG 3.18Å; D40-R44 PolarHBondContact O-N 2.92Å
41	L	96.8	Very high	95.8	Very high	14 Å²	14	80.3 Å²	80.3	7%	0.073	38%	0.384	C	S	.	.	H	α-helix	trans	-63	-43.4	175.9	-78.7	171.9	0	0	0	111.3	R37 Q39 E43 R44 T45 L53 I56 A57	R37-L41 VanDerWaalsContact O-CB 3.26Å; R37-L41 WeakPolarHBondContact O-CB 3.49Å; R37-L41 WeakPolarHBondContact O-CG 3.25Å; R37-L41 PolarHBondContact O-N 3.01Å; Q39-L41 VanDerWaalsContact C-N 3.33Å; Q39-L41 PolarHBondContact O-N 2.96Å; L41-E43 VanDerWaalsContact C-N 3.33Å; L41-E43 PolarHBondContact O-N 2.95Å; L41-R44 PolarHBondContact O-N 3.35Å; L41-T45 HydrophobicContact CD2-CG2 4.36Å; L41-T45 VanDerWaalsContact O-CB 3.32Å; L41-T45 WeakPolarHBondContact O-CB 3.49Å; L41-T45 WeakPolarHBondContact O-CG2 3.35Å; L41-T45 PolarHBondContact O-N 2.77Å; L41-T45 PolarHBondContact O-OG1 3.4Å; L41-L53 HydrophobicContact CB-CD2 3.85Å; L41-I56 HydrophobicContact CD1-CB 4.42Å; L41-I56 HydrophobicContact CD1-CG2 4.02Å; L41-I56 HydrophobicContact CD2-CG2 3.75Å; L41-A57 HydrophobicContact CD1-CB 3.7Å
42	K	96.6	Very high	95.8	Very high	97 Å²	97	85 Å²	85	42%	0.422	41%	0.405	S	S	.	.	H	α-helix	trans	-59.5	-45	177.5	-178	176.8	172.6	-173.1	0	111.3	F11 L38 Q39 R46 L53	F11-K42 HydrophobicContact CE1-CD 4.46Å; F11-K42 HydrophobicContact CZ-CB 4.28Å; F11-K42 HydrophobicContact CZ-CD 3.82Å; L38-K42 WeakPolarHBondContact O-CB 3.45Å; L38-K42 PolarHBondContact O-N 3Å; Q39-K42 WeakPolarHBondContact O-CB 3.49Å; Q39-K42 PolarHBondContact O-N 2.98Å; Q39-K42 VanDerWaalsContact O-N 3.17Å; K42-R46 VanDerWaalsContact O-CA 3.27Å; K42-R46 WeakPolarHBondContact O-CA 3.26Å; K42-R46 PolarHBondContact O-N 3.02Å; K42-L53 HydrophobicContact CB-CD1 3.83Å; K42-L53 HydrophobicContact CB-CD2 4.3Å; K42-L53 HydrophobicContact CD-CD1 4.48Å; K42-L53 HydrophobicContact CG-CD1 4.19Å
43	E	96.6	Very high	95.8	Very high	127 Å²	127	80.4 Å²	80.4	59%	0.593	38%	0.38	S	S	*	.	H	α-helix	trans	-66.7	-45.8	179.1	-70.4	178.8	-167.9	0	0	112.3	Q39 D40 L41	Q39-E43 PolarHBondContact NE2-OE1 3.28Å; Q39-E43 WeakPolarHBondContact O-CG 3.43Å; Q39-E43 PolarHBondContact O-N 3.18Å; D40-E43 PolarHBondContact O-N 3.17Å; L41-E43 VanDerWaalsContact C-N 3.33Å; L41-E43 PolarHBondContact O-N 2.95Å
44	R	96.9	Very high	95.8	Very high	205 Å²	205	80.3 Å²	80.3	77%	0.774	38%	0.382	S	S	*	.	H	α-helix	trans	-73.9	-39.7	-175.6	-70.2	171.5	62.2	-161.1	-2	113.6	D40 L41	D40-R44 VanDerWaalsContact O-CB 3.31Å; D40-R44 WeakPolarHBondContact O-CB 3.35Å; D40-R44 WeakPolarHBondContact O-CG 3.18Å; D40-R44 PolarHBondContact O-N 2.92Å; L41-R44 PolarHBondContact O-N 3.35Å
45	T	94.6	Very high	95.8	Very high	59 Å²	59	84.7 Å²	84.7	36%	0.362	40%	0.399	S	S	.	.	H	α-helix	trans	-94.9	-16.4	-174.4	67.5	0	0	0	0	112.9	L41 V47	L41-T45 HydrophobicContact CD2-CG2 4.36Å; L41-T45 VanDerWaalsContact O-CB 3.32Å; L41-T45 WeakPolarHBondContact O-CB 3.49Å; L41-T45 WeakPolarHBondContact O-CG2 3.35Å; L41-T45 PolarHBondContact O-N 2.77Å; L41-T45 PolarHBondContact O-OG1 3.4Å; T45-V47 PolarHBondContact O-N 3.41Å; T45-V47 VanDerWaalsContact O-N 3.11Å; T45-V47 WeakPolarHBondContact OG1-CB 3.39Å; T45-V47 WeakPolarHBondContact OG1-CG2 3.32Å; T45-V47 PolarHBondContact OG1-N 3.46Å
46	R	92.9	Very high	95.8	Very high	219 Å²	219	85.3 Å²	85.3	83%	0.826	40%	0.402	S	S	*	.			trans	56.9	15.1	-170.7	-53.1	179.4	-177.7	173.4	-0.1	114	K42 T48	K42-R46 VanDerWaalsContact O-CA 3.27Å; K42-R46 WeakPolarHBondContact O-CA 3.26Å; K42-R46 PolarHBondContact O-N 3.02Å; R46-T48 PolarHBondContact O-N 3.43Å
47	V	94.2	Very high	95.8	Very high	30 Å²	30	80.2 Å²	80.2	18%	0.182	38%	0.379	C	S	.	.			trans	-68.7	121.8	175.1	173.7	0	0	0	0	108.6	T45 N49 Q52 L53	T45-V47 PolarHBondContact O-N 3.41Å; T45-V47 VanDerWaalsContact O-N 3.11Å; T45-V47 WeakPolarHBondContact OG1-CB 3.39Å; T45-V47 WeakPolarHBondContact OG1-CG2 3.32Å; T45-V47 PolarHBondContact OG1-N 3.46Å; V47-N49 HydrophobicContact CG1-CB 4.36Å; V47-Q52 HydrophobicContact CG1-CB 3.78Å; V47-L53 HydrophobicContact CB-CD2 3.87Å; V47-L53 HydrophobicContact CB-CG 4.24Å; V47-L53 HydrophobicContact CG1-CD2 4.14Å; V47-L53 HydrophobicContact CG1-CG 4Å
48	T	91.9	Very high	95.8	Very high	127 Å²	127	79.2 Å²	79.2	78%	0.779	39%	0.385	S	S	*	.			trans	-91.7	-21.9	178.9	54.9	0	0	0	0	112.6	R46 T50	R46-T48 PolarHBondContact O-N 3.43Å; T48-T50 PolarHBondContact O-N 2.89Å
49	N	94.9	Very high	95.9	Very high	66 Å²	66	85 Å²	85	35%	0.353	42%	0.415	S	S	.	.			trans	-74	111.3	178.2	-176.1	-32.2	0	0	0	110.1	V47 E51 Q52 L53	V47-N49 HydrophobicContact CG1-CB 4.36Å; N49-E51 VanDerWaalsContact C-N 3.3Å; N49-E51 PolarHBondContact O-N 3.02Å; N49-E51 WeakPolarHBondContact OD1-CA 3.27Å; N49-E51 VanDerWaalsContact OD1-CB 3.3Å; N49-E51 WeakPolarHBondContact OD1-CB 3.36Å; N49-E51 PolarHBondContact OD1-N 2.8Å; N49-Q52 HydrophobicContact CB-CB 4.15Å; N49-Q52 HydrophobicContact CB-CG 4.05Å; N49-Q52 PolarHBondContact O-N 2.96Å; N49-Q52 PolarHBondContact OD1-N 2.62Å; N49-L53 PolarHBondContact O-N 2.95Å; N49-L53 VanDerWaalsContact O-N 3.07Å
50	T	93.2	Very high	95.9	Very high	39 Å²	39	84.4 Å²	84.4	24%	0.239	41%	0.414	C	S	.	.	H	α-helix	trans	-58	-39.1	179	-53.3	0	0	0	0	113.2	F11 T48 Q52 L53 V54	F11-T50 HydrophobicContact CD1-CG2 3.85Å; F11-T50 HydrophobicContact CE1-CG2 4.4Å; T48-T50 PolarHBondContact O-N 2.89Å; T50-Q52 VanDerWaalsContact C-N 3.35Å; T50-Q52 PolarHBondContact O-N 3.43Å; T50-L53 WeakPolarHBondContact O-CB 3.36Å; T50-L53 PolarHBondContact O-N 3.46Å; T50-V54 HydrophobicContact CG2-CG2 4.37Å; T50-V54 VanDerWaalsContact O-CG2 3.26Å; T50-V54 WeakPolarHBondContact O-CG2 3.36Å; T50-V54 PolarHBondContact O-N 3.28Å
51	E	94.9	Very high	96	Very high	126 Å²	126	84.4 Å²	84.4	59%	0.589	41%	0.414	S	S	*	.	H	α-helix	trans	-64	-42.7	179.8	-178.4	177.3	-165.9	0	0	110.9	N49 L53 V54 F55	N49-E51 VanDerWaalsContact C-N 3.3Å; N49-E51 PolarHBondContact O-N 3.02Å; N49-E51 WeakPolarHBondContact OD1-CA 3.27Å; N49-E51 VanDerWaalsContact OD1-CB 3.3Å; N49-E51 WeakPolarHBondContact OD1-CB 3.36Å; N49-E51 PolarHBondContact OD1-N 2.8Å; E51-L53 PolarHBondContact O-N 2.82Å; E51-V54 PolarHBondContact O-N 2.89Å; E51-F55 HydrophobicContact CG-CD2 3.87Å; E51-F55 HydrophobicContact CG-CE2 3.59Å; E51-F55 VanDerWaalsContact O-CD2 3.23Å; E51-F55 WeakPolarHBondContact O-CD2 3.25Å; E51-F55 PolarHBondContact O-N 2.88Å
52	Q	96.2	Very high	96.1	Very high	105 Å²	105	87.2 Å²	87.2	49%	0.491	44%	0.435	S	S	.	.	H	α-helix	trans	-63.4	-41.4	174.6	-69.1	-179.1	-11.1	0	0	112	V47 N49 T50 V54 F55 I56	V47-Q52 HydrophobicContact CG1-CB 3.78Å; N49-Q52 HydrophobicContact CB-CB 4.15Å; N49-Q52 HydrophobicContact CB-CG 4.05Å; N49-Q52 PolarHBondContact O-N 2.96Å; N49-Q52 PolarHBondContact OD1-N 2.62Å; T50-Q52 VanDerWaalsContact C-N 3.35Å; T50-Q52 PolarHBondContact O-N 3.43Å; Q52-V54 VanDerWaalsContact C-N 3.32Å; Q52-V54 PolarHBondContact O-N 3.34Å; Q52-F55 PolarHBondContact O-N 2.93Å; Q52-I56 VanDerWaalsContact O-CG1 3.27Å; Q52-I56 WeakPolarHBondContact O-CG1 3.45Å; Q52-I56 PolarHBondContact O-N 3.36Å
53	L	96.6	Very high	96.2	Very high	1 Å²	1	89.6 Å²	89.6	1%	0.005	44%	0.442	C	S	.	.	H	α-helix	trans	-59.2	-43	173.9	-70.8	172.2	0	0	0	111.8	F11 L38 L41 K42 V47 N49 T50 E51 I56 A57	F11-L53 HydrophobicContact CE1-CD1 3.89Å; F11-L53 HydrophobicContact CZ-CD1 4.14Å; L38-L53 HydrophobicContact CD2-CB 3.95Å; L41-L53 HydrophobicContact CB-CD2 3.85Å; K42-L53 HydrophobicContact CB-CD1 3.83Å; K42-L53 HydrophobicContact CB-CD2 4.3Å; K42-L53 HydrophobicContact CD-CD1 4.48Å; K42-L53 HydrophobicContact CG-CD1 4.19Å; V47-L53 HydrophobicContact CB-CD2 3.87Å; V47-L53 HydrophobicContact CB-CG 4.24Å; V47-L53 HydrophobicContact CG1-CD2 4.14Å; V47-L53 HydrophobicContact CG1-CG 4Å; N49-L53 PolarHBondContact O-N 2.95Å; N49-L53 VanDerWaalsContact O-N 3.07Å; T50-L53 WeakPolarHBondContact O-CB 3.36Å; T50-L53 PolarHBondContact O-N 3.46Å; E51-L53 PolarHBondContact O-N 2.82Å; L53-I56 PolarHBondContact O-N 3.35Å; L53-A57 WeakPolarHBondContact O-CB 3.4Å; L53-A57 PolarHBondContact O-N 3.11Å
54	V	96.3	Very high	96.3	Very high	69 Å²	69	87.4 Å²	87.4	42%	0.418	43%	0.432	S	S	.	.	H	α-helix	trans	-63.8	-43.3	176.6	174.8	0	0	0	0	111.4	L38 T50 E51 Q52 I56 A57 A58	L38-V54 HydrophobicContact CD1-CG2 4.43Å; L38-V54 HydrophobicContact CD2-CG2 4.11Å; T50-V54 HydrophobicContact CG2-CG2 4.37Å; T50-V54 VanDerWaalsContact O-CG2 3.26Å; T50-V54 WeakPolarHBondContact O-CG2 3.36Å; T50-V54 PolarHBondContact O-N 3.28Å; E51-V54 PolarHBondContact O-N 2.89Å; Q52-V54 VanDerWaalsContact C-N 3.32Å; Q52-V54 PolarHBondContact O-N 3.34Å; V54-I56 PolarHBondContact O-N 3.48Å; V54-A57 PolarHBondContact O-N 2.82Å; V54-A58 VanDerWaalsContact O-CB 3.25Å; V54-A58 WeakPolarHBondContact O-CB 3.3Å; V54-A58 PolarHBondContact O-N 2.78Å
55	F	97	Very high	96.3	Very high	137 Å²	137	82 Å²	82	60%	0.601	42%	0.418	S	S	*	.	H	α-helix	trans	-61.9	-42.5	175.7	-82.4	-63.4	0	0	0	112.6	E51 Q52 A58 L59	E51-F55 HydrophobicContact CG-CD2 3.87Å; E51-F55 HydrophobicContact CG-CE2 3.59Å; E51-F55 VanDerWaalsContact O-CD2 3.23Å; E51-F55 WeakPolarHBondContact O-CD2 3.25Å; E51-F55 PolarHBondContact O-N 2.88Å; Q52-F55 PolarHBondContact O-N 2.93Å; F55-A58 PolarHBondContact O-N 3.35Å; F55-L59 WeakPolarHBondContact O-CB 3.43Å; F55-L59 PolarHBondContact O-N 2.82Å
56	I	96.9	Very high	96.5	Very high	56 Å²	56	81.9 Å²	81.9	29%	0.287	42%	0.423	S	S	.	.	H	α-helix	trans	-64.2	-45.7	176.6	-64.9	163.2	0	0	0	110.3	L41 Q52 L53 V54 L59 N60	L41-I56 HydrophobicContact CD1-CB 4.42Å; L41-I56 HydrophobicContact CD1-CG2 4.02Å; L41-I56 HydrophobicContact CD2-CG2 3.75Å; Q52-I56 VanDerWaalsContact O-CG1 3.27Å; Q52-I56 WeakPolarHBondContact O-CG1 3.45Å; Q52-I56 PolarHBondContact O-N 3.36Å; L53-I56 PolarHBondContact O-N 3.35Å; V54-I56 PolarHBondContact O-N 3.48Å; I56-L59 PolarHBondContact O-N 2.83Å; I56-N60 WeakPolarHBondContact O-CB 3.48Å; I56-N60 PolarHBondContact O-N 3.38Å; I56-N60 PolarHBondContact O-ND2 3.28Å
57	A	97.7	Very high	96.8	Very high	2 Å²	2	75.1 Å²	75.1	2%	0.017	40%	0.4	C	S	.	.	H	α-helix	trans	-60.6	-46.8	177	0	0	0	0	0	111.7	L34 L38 L41 L53 V54 L59 N60 I61	L34-A57 HydrophobicContact CD1-CB 4.26Å; L38-A57 HydrophobicContact CD2-CB 3.8Å; L41-A57 HydrophobicContact CD1-CB 3.7Å; L53-A57 WeakPolarHBondContact O-CB 3.4Å; L53-A57 PolarHBondContact O-N 3.11Å; V54-A57 PolarHBondContact O-N 2.82Å; A57-L59 VanDerWaalsContact C-N 3.33Å; A57-L59 PolarHBondContact O-N 3.02Å; A57-N60 PolarHBondContact O-N 3.13Å; A57-I61 WeakPolarHBondContact O-CB 3.37Å; A57-I61 WeakPolarHBondContact O-CD1 3.38Å; A57-I61 VanDerWaalsContact O-CG1 3.25Å; A57-I61 WeakPolarHBondContact O-CG1 3.42Å; A57-I61 PolarHBondContact O-N 2.96Å
58	A	97.7	Very high	97	Very high	46 Å²	46	78.5 Å²	78.5	38%	0.38	41%	0.414	S	S	.	.	H	α-helix	trans	-61.8	-40.4	178.7	0	0	0	0	0	112.1	V54 F55 S62	V54-A58 VanDerWaalsContact O-CB 3.25Å; V54-A58 WeakPolarHBondContact O-CB 3.3Å; V54-A58 PolarHBondContact O-N 2.78Å; F55-A58 PolarHBondContact O-N 3.35Å; A58-S62 WeakPolarHBondContact O-CB 3.25Å; A58-S62 PolarHBondContact O-N 2.88Å; A58-S62 PolarHBondContact O-OG 2.91Å
59	L	98.2	Very high	97.3	Very high	121 Å²	121	77.9 Å²	77.9	63%	0.634	40%	0.401	S	S	*	.	H	α-helix	trans	-65.2	-46.5	175.5	-179.3	61.1	0	0	0	111.4	F55 I56 A57 I61 S62 Y63	F55-L59 WeakPolarHBondContact O-CB 3.43Å; F55-L59 PolarHBondContact O-N 2.82Å; I56-L59 PolarHBondContact O-N 2.83Å; A57-L59 VanDerWaalsContact C-N 3.33Å; A57-L59 PolarHBondContact O-N 3.02Å; L59-I61 PolarHBondContact O-N 3.42Å; L59-S62 PolarHBondContact O-N 3.02Å; L59-Y63 WeakPolarHBondContact O-CB 3.46Å; L59-Y63 PolarHBondContact O-N 3.37Å
60	N	97.7	Very high	97.5	Very high	63 Å²	63	76.8 Å²	76.8	34%	0.337	40%	0.401	S	S	.	.	H	α-helix	trans	-60	-46.2	177.4	-70.7	-19.4	0	0	0	111.5	I56 A57 S62 Y63 E64	I56-N60 WeakPolarHBondContact O-CB 3.48Å; I56-N60 PolarHBondContact O-N 3.38Å; I56-N60 PolarHBondContact O-ND2 3.28Å; A57-N60 PolarHBondContact O-N 3.13Å; N60-S62 VanDerWaalsContact C-N 3.34Å; N60-S62 PolarHBondContact O-N 3.46Å; N60-Y63 WeakPolarHBondContact O-CB 3.22Å; N60-Y63 PolarHBondContact O-N 3.48Å; N60-E64 WeakPolarHBondContact O-CG 3.31Å; N60-E64 PolarHBondContact O-N 2.94Å
61	I	98.2	Very high	97.8	Very high	63 Å²	63	80.4 Å²	80.4	32%	0.323	41%	0.413	S	S	.	.	H	α-helix	trans	-62.9	-42	178	-68.8	164	0	0	0	110.8	L34 A57 L59 Y63 E64 L65	L34-I61 HydrophobicContact CD1-CD1 4.23Å; A57-I61 WeakPolarHBondContact O-CB 3.37Å; A57-I61 WeakPolarHBondContact O-CD1 3.38Å; A57-I61 VanDerWaalsContact O-CG1 3.25Å; A57-I61 WeakPolarHBondContact O-CG1 3.42Å; A57-I61 PolarHBondContact O-N 2.96Å; L59-I61 PolarHBondContact O-N 3.42Å; I61-Y63 VanDerWaalsContact C-N 3.29Å; I61-Y63 PolarHBondContact O-N 2.85Å; I61-E64 PolarHBondContact O-N 3.19Å; I61-L65 WeakPolarHBondContact O-CB 3.34Å; I61-L65 PolarHBondContact O-N 2.92Å
62	S	98.5	Very high	97.9	Very high	74 Å²	74	78.5 Å²	78.5	52%	0.517	41%	0.41	S	S	.	.	H	α-helix	trans	-62.7	-38.3	176.3	-61.2	0	0	0	0	111.9	A58 L59 N60 A66	A58-S62 WeakPolarHBondContact O-CB 3.25Å; A58-S62 PolarHBondContact O-N 2.88Å; A58-S62 PolarHBondContact O-OG 2.91Å; L59-S62 PolarHBondContact O-N 3.02Å; N60-S62 VanDerWaalsContact C-N 3.34Å; N60-S62 PolarHBondContact O-N 3.46Å; S62-A66 WeakPolarHBondContact O-CB 3.46Å; S62-A66 PolarHBondContact O-N 3.28Å
63	Y	98.5	Very high	98	Very high	146 Å²	146	82.1 Å²	82.1	57%	0.573	42%	0.419	S	S	*	.	H	α-helix	trans	-69.1	-43.5	176.1	179.3	-111.9	0	0	0	112.5	L59 N60 I61 A66 Q67	L59-Y63 WeakPolarHBondContact O-CB 3.46Å; L59-Y63 PolarHBondContact O-N 3.37Å; N60-Y63 WeakPolarHBondContact O-CB 3.22Å; N60-Y63 PolarHBondContact O-N 3.48Å; I61-Y63 VanDerWaalsContact C-N 3.29Å; I61-Y63 PolarHBondContact O-N 2.85Å; Y63-A66 PolarHBondContact O-N 3.48Å; Y63-Q67 HydrophobicContact CE1-CG 4.44Å; Y63-Q67 HydrophobicContact CE2-CG 4.37Å; Y63-Q67 WeakPolarHBondContact O-CG 3.42Å; Y63-Q67 PolarHBondContact O-N 3.02Å
64	E	98.4	Very high	98.1	Very high	82 Å²	82	87.5 Å²	87.5	38%	0.383	45%	0.448	S	S	.	.	H	α-helix	trans	-59.3	-46.7	173.4	-73.8	171.2	-152.2	0	0	111.3	R37 N60 I61 A66 Q67 E68	R37-E64 IonicContact CZ-OE1 3.47Å; R37-E64 IonicContact CZ-OE2 3.41Å; R37-E64 VanDerWaalsContact NH1-CD 3.32Å; R37-E64 IonicContact NH1-OE1 3.89Å; R37-E64 PolarHBondContact NH1-OE1 3.46Å; R37-E64 IonicContact NH1-OE2 2.82Å; R37-E64 PolarHBondContact NH1-OE2 2.92Å; R37-E64 IonicContact NH2-OE1 2.74Å; R37-E64 IonicContact NH2-OE2 3.76Å; R37-E64 PolarHBondContact NH2-OE2 3.43Å; N60-E64 WeakPolarHBondContact O-CG 3.31Å; N60-E64 PolarHBondContact O-N 2.94Å; I61-E64 PolarHBondContact O-N 3.19Å; E64-A66 VanDerWaalsContact C-N 3.33Å; E64-A66 PolarHBondContact O-N 3.26Å; E64-Q67 PolarHBondContact O-N 3.41Å; E64-E68 PolarHBondContact O-N 3.45Å
65	L	98.5	Very high	98.2	Very high	92 Å²	92	91.6 Å²	91.6	48%	0.482	46%	0.457	S	S	.	.	H	α-helix	trans	-61.5	-40.3	176.8	178.6	62.7	0	0	0	112.2	I61 E68 K69	I61-L65 WeakPolarHBondContact O-CB 3.34Å; I61-L65 PolarHBondContact O-N 2.92Å; L65-E68 PolarHBondContact O-N 2.99Å; L65-K69 HydrophobicContact CD1-CG 4.47Å; L65-K69 HydrophobicContact CG-CD 4.39Å; L65-K69 WeakPolarHBondContact O-CB 3.35Å; L65-K69 WeakPolarHBondContact O-CG 3.45Å; L65-K69 PolarHBondContact O-N 3.42Å
66	A	98.6	Very high	98.3	Very high	56 Å²	56	87.8 Å²	87.8	46%	0.463	45%	0.451	S	S	.	.	H	α-helix	trans	-64.1	-43.4	177	0	0	0	0	0	111.6	S62 Y63 E64 K69 A70	S62-A66 WeakPolarHBondContact O-CB 3.46Å; S62-A66 PolarHBondContact O-N 3.28Å; Y63-A66 PolarHBondContact O-N 3.48Å; E64-A66 VanDerWaalsContact C-N 3.33Å; E64-A66 PolarHBondContact O-N 3.26Å; A66-K69 PolarHBondContact O-N 2.91Å; A66-A70 PolarHBondContact O-N 3.01Å
67	Q	98.7	Very high	98.3	Very high	76 Å²	76	87.6 Å²	87.6	36%	0.355	46%	0.458	S	S	.	.	H	α-helix	trans	-62.7	-42.7	174.8	-75.3	-179.1	82.6	0	0	112.1	Y63 E64 K69 A70 K71	Y63-Q67 HydrophobicContact CE1-CG 4.44Å; Y63-Q67 HydrophobicContact CE2-CG 4.37Å; Y63-Q67 WeakPolarHBondContact O-CG 3.42Å; Y63-Q67 PolarHBondContact O-N 3.02Å; E64-Q67 PolarHBondContact O-N 3.41Å; Q67-K69 VanDerWaalsContact C-N 3.35Å; Q67-K69 PolarHBondContact O-N 2.84Å; Q67-A70 WeakPolarHBondContact O-CB 3.47Å; Q67-A70 PolarHBondContact O-N 3.47Å; Q67-A70 VanDerWaalsContact O-N 3.15Å; Q67-K71 WeakPolarHBondContact O-CG 3.5Å; Q67-K71 PolarHBondContact O-N 3.45Å
68	E	98.6	Very high	98.4	Very high	102 Å²	102	90.4 Å²	90.4	48%	0.477	48%	0.477	S	S	.	.	H	α-helix	trans	-67	-37.8	-179.7	-163.2	55.8	-146.8	0	0	112	E64 L65 A70 K71 T72	E64-E68 PolarHBondContact O-N 3.45Å; L65-E68 PolarHBondContact O-N 2.99Å; E68-A70 VanDerWaalsContact C-N 3.33Å; E68-A70 PolarHBondContact O-N 3.04Å; E68-K71 PolarHBondContact O-N 3.28Å; E68-K71 IonicContact OE2-NZ 2.65Å; E68-K71 PolarHBondContact OE2-NZ 3.3Å; E68-T72 WeakPolarHBondContact O-CB 3.44Å; E68-T72 PolarHBondContact O-N 2.95Å; E68-T72 PolarHBondContact O-OG1 3.43Å
69	K	98.6	Very high	98.4	Very high	114 Å²	114	91 Å²	91	50%	0.496	47%	0.473	S	S	.	.	H	α-helix	trans	-62.2	-39.1	170.6	-75.8	177	178.3	178.1	0	112.3	L65 A66 Q67 R73	L65-K69 HydrophobicContact CD1-CG 4.47Å; L65-K69 HydrophobicContact CG-CD 4.39Å; L65-K69 WeakPolarHBondContact O-CB 3.35Å; L65-K69 WeakPolarHBondContact O-CG 3.45Å; L65-K69 PolarHBondContact O-N 3.42Å; A66-K69 PolarHBondContact O-N 2.91Å; Q67-K69 VanDerWaalsContact C-N 3.35Å; Q67-K69 PolarHBondContact O-N 2.84Å; K69-R73 WeakPolarHBondContact O-CG 3.33Å; K69-R73 PolarHBondContact O-N 2.93Å; K69-R73 VanDerWaalsContact O-N 3.16Å
70	A	98.5	Very high	98.4	Very high	42 Å²	42	90.4 Å²	90.4	35%	0.347	47%	0.467	S	S	.	.	H	α-helix	trans	-64.6	-50.1	176.2	0	0	0	0	0	111.1	A66 Q67 E68 T72 R73 D74	A66-A70 PolarHBondContact O-N 3.01Å; Q67-A70 WeakPolarHBondContact O-CB 3.47Å; Q67-A70 PolarHBondContact O-N 3.47Å; Q67-A70 VanDerWaalsContact O-N 3.15Å; E68-A70 VanDerWaalsContact C-N 3.33Å; E68-A70 PolarHBondContact O-N 3.04Å; A70-T72 VanDerWaalsContact C-N 3.28Å; A70-T72 PolarHBondContact O-N 2.96Å; A70-R73 WeakPolarHBondContact O-CB 3.42Å; A70-R73 PolarHBondContact O-N 3.48Å; A70-D74 PolarHBondContact O-N 3.16Å
71	K	98.6	Very high	98.4	Very high	116 Å²	116	92.7 Å²	92.7	50%	0.504	48%	0.476	S	S	.	.	H	α-helix	trans	-55.8	-41.9	175.6	-69.7	176.1	-170.4	167.4	0	112.7	Q67 E68 R73 D74 Y75	Q67-K71 WeakPolarHBondContact O-CG 3.5Å; Q67-K71 PolarHBondContact O-N 3.45Å; E68-K71 PolarHBondContact O-N 3.28Å; E68-K71 IonicContact OE2-NZ 2.65Å; E68-K71 PolarHBondContact OE2-NZ 3.3Å; K71-R73 VanDerWaalsContact C-N 3.32Å; K71-R73 PolarHBondContact O-N 3.15Å; K71-D74 PolarHBondContact O-N 3.5Å; K71-Y75 WeakPolarHBondContact O-CB 3.43Å; K71-Y75 PolarHBondContact O-N 3.42Å
72	T	98.4	Very high	98.4	Very high	86 Å²	86	96.2 Å²	96.2	53%	0.528	49%	0.485	S	S	.	.	H	α-helix	trans	-61.6	-40.8	177.6	-58.9	0	0	0	0	111.5	E68 A70 A76	E68-T72 WeakPolarHBondContact O-CB 3.44Å; E68-T72 PolarHBondContact O-N 2.95Å; E68-T72 PolarHBondContact O-OG1 3.43Å; A70-T72 VanDerWaalsContact C-N 3.28Å; A70-T72 PolarHBondContact O-N 2.96Å; T72-A76 WeakPolarHBondContact O-CB 3.47Å; T72-A76 PolarHBondContact O-N 3.25Å
73	R	98.4	Very high	98.4	Very high	180 Å²	180	96.7 Å²	96.7	68%	0.679	48%	0.481	S	S	*	.	H	α-helix	trans	-66.7	-45	176.3	-70.5	170.8	-176.1	173.8	0.1	111.8	K69 A70 K71 Y75 A76 A77	K69-R73 WeakPolarHBondContact O-CG 3.33Å; K69-R73 PolarHBondContact O-N 2.93Å; K69-R73 VanDerWaalsContact O-N 3.16Å; A70-R73 WeakPolarHBondContact O-CB 3.42Å; A70-R73 PolarHBondContact O-N 3.48Å; K71-R73 VanDerWaalsContact C-N 3.32Å; K71-R73 PolarHBondContact O-N 3.15Å; R73-Y75 VanDerWaalsContact C-N 3.31Å; R73-Y75 PolarHBondContact O-N 2.91Å; R73-A76 PolarHBondContact O-N 3.01Å; R73-A77 WeakPolarHBondContact O-CB 3.44Å; R73-A77 PolarHBondContact O-N 3.46Å
74	D	98.4	Very high	98.3	Very high	114 Å²	114	95.1 Å²	95.1	61%	0.61	47%	0.474	S	S	*	.	H	α-helix	trans	-62.9	-41.4	178.9	-65	-18.3	0	0	0	111.1	A70 K71 A77 S78	A70-D74 PolarHBondContact O-N 3.16Å; K71-D74 PolarHBondContact O-N 3.5Å; D74-A77 PolarHBondContact O-N 2.89Å; D74-S78 WeakPolarHBondContact O-CB 3.33Å; D74-S78 PolarHBondContact O-N 2.99Å
75	Y	98.3	Very high	98.3	Very high	156 Å²	156	95.4 Å²	95.4	61%	0.612	48%	0.476	S	S	*	.	H	α-helix	trans	-61.6	-46.4	174.4	-178	-96.9	0	0	0	112	K71 R73 A77 S78 M79	K71-Y75 WeakPolarHBondContact O-CB 3.43Å; K71-Y75 PolarHBondContact O-N 3.42Å; R73-Y75 VanDerWaalsContact C-N 3.31Å; R73-Y75 PolarHBondContact O-N 2.91Å; Y75-A77 PolarHBondContact O-N 3.35Å; Y75-S78 PolarHBondContact O-N 3.36Å; Y75-M79 HydrophobicContact CE1-CE 4.14Å; Y75-M79 HydrophobicContact CE2-CE 4.41Å; Y75-M79 WeakPolarHBondContact O-CB 3.45Å; Y75-M79 PolarHBondContact O-N 3.43Å; Y75-M79 VanDerWaalsContact OH-CE 3.28Å; Y75-M79 WeakPolarHBondContact OH-CE 3.48Å
76	A	98.3	Very high	98.3	Very high	56 Å²	56	96.2 Å²	96.2	46%	0.463	48%	0.48	S	S	.	.	H	α-helix	trans	-61	-45.1	177.2	0	0	0	0	0	111.8	T72 R73 M79 E80	T72-A76 WeakPolarHBondContact O-CB 3.47Å; T72-A76 PolarHBondContact O-N 3.25Å; R73-A76 PolarHBondContact O-N 3.01Å; A76-M79 PolarHBondContact O-N 3.35Å; A76-E80 WeakPolarHBondContact O-CB 3.33Å; A76-E80 PolarHBondContact O-N 2.92Å
77	A	98.3	Very high	98.2	Very high	52 Å²	52	98.5 Å²	98.5	43%	0.43	48%	0.482	S	S	.	.	H	α-helix	trans	-63.6	-41.9	177.6	0	0	0	0	0	112.3	R73 D74 Y75 E80 Q81	R73-A77 WeakPolarHBondContact O-CB 3.44Å; R73-A77 PolarHBondContact O-N 3.46Å; D74-A77 PolarHBondContact O-N 2.89Å; Y75-A77 PolarHBondContact O-N 3.35Å; A77-E80 PolarHBondContact O-N 3.13Å; A77-Q81 PolarHBondContact O-N 2.99Å
78	S	98.3	Very high	98.1	Very high	61 Å²	61	100.2 Å²	100.2	43%	0.427	49%	0.49	S	S	.	.	H	α-helix	trans	-61.8	-43.5	174.6	-178.8	0	0	0	0	111.7	D74 Y75 Q81 R82	D74-S78 WeakPolarHBondContact O-CB 3.33Å; D74-S78 PolarHBondContact O-N 2.99Å; Y75-S78 PolarHBondContact O-N 3.36Å; S78-Q81 PolarHBondContact O-N 3.36Å; S78-R82 WeakPolarHBondContact O-CG 3.28Å; S78-R82 PolarHBondContact O-N 3.49Å
79	M	97.9	Very high	98	Very high	60 Å²	60	99.5 Å²	99.5	30%	0.296	49%	0.492	S	S	.	.	H	α-helix	trans	-63.4	-43.4	177.2	-168.9	61.8	71.4	0	0	111.4	Y75 A76 Q81 R82 I83	Y75-M79 HydrophobicContact CE1-CE 4.14Å; Y75-M79 HydrophobicContact CE2-CE 4.41Å; Y75-M79 WeakPolarHBondContact O-CB 3.45Å; Y75-M79 PolarHBondContact O-N 3.43Å; Y75-M79 VanDerWaalsContact OH-CE 3.28Å; Y75-M79 WeakPolarHBondContact OH-CE 3.48Å; A76-M79 PolarHBondContact O-N 3.35Å; M79-Q81 VanDerWaalsContact C-N 3.33Å; M79-Q81 PolarHBondContact O-N 2.9Å; M79-R82 WeakPolarHBondContact O-CB 3.46Å; M79-R82 PolarHBondContact O-N 2.99Å; M79-R82 VanDerWaalsContact O-N 3.13Å; M79-I83 HydrophobicContact CG-CD1 4.06Å; M79-I83 WeakPolarHBondContact O-CG1 3.35Å; M79-I83 PolarHBondContact O-N 3.36Å
80	E	98.3	Very high	97.9	Very high	108 Å²	108	98.9 Å²	98.9	51%	0.505	49%	0.493	S	S	.	.	H	α-helix	trans	-60.3	-42.6	176.9	-161.1	-167.1	152.4	0	0	111.8	A76 A77 R82 I83 R84	A76-E80 WeakPolarHBondContact O-CB 3.33Å; A76-E80 PolarHBondContact O-N 2.92Å; A77-E80 PolarHBondContact O-N 3.13Å; E80-R82 VanDerWaalsContact C-N 3.35Å; E80-R82 PolarHBondContact O-N 2.86Å; E80-I83 PolarHBondContact O-N 3.28Å; E80-R84 PolarHBondContact O-N 2.92Å; E80-R84 IonicContact OE1-CZ 3.91Å; E80-R84 IonicContact OE1-NH1 3.89Å; E80-R84 PolarHBondContact OE1-NH1 3.35Å
81	Q	98.2	Very high	97.8	Very high	111 Å²	111	102.7 Å²	102.7	52%	0.519	50%	0.504	S	S	.	.	H	α-helix	trans	-61.8	-42.5	173.7	-176.9	-178.2	-32.1	0	0	111.8	A77 S78 M79 R84 M85	A77-Q81 PolarHBondContact O-N 2.99Å; S78-Q81 PolarHBondContact O-N 3.36Å; M79-Q81 VanDerWaalsContact C-N 3.33Å; M79-Q81 PolarHBondContact O-N 2.9Å; Q81-R84 PolarHBondContact O-N 2.99Å; Q81-M85 HydrophobicContact CG-CE 4.29Å; Q81-M85 WeakPolarHBondContact O-CG 3.36Å; Q81-M85 PolarHBondContact O-N 3.25Å
82	R	98	Very high	97.6	Very high	136 Å²	136	103.4 Å²	103.4	51%	0.513	51%	0.509	S	S	.	.	H	α-helix	trans	-64.3	-41.4	177	-71	173.1	66.2	-167.1	-1	112.2	S78 M79 E80 R84 M85 L86	S78-R82 WeakPolarHBondContact O-CG 3.28Å; S78-R82 PolarHBondContact O-N 3.49Å; M79-R82 WeakPolarHBondContact O-CB 3.46Å; M79-R82 PolarHBondContact O-N 2.99Å; M79-R82 VanDerWaalsContact O-N 3.13Å; E80-R82 VanDerWaalsContact C-N 3.35Å; E80-R82 PolarHBondContact O-N 2.86Å; R82-R84 VanDerWaalsContact C-N 3.35Å; R82-M85 HydrophobicContact CB-CE 4.43Å; R82-M85 HydrophobicContact CG-CE 4.01Å; R82-M85 PolarHBondContact O-N 2.91Å; R82-L86 WeakPolarHBondContact O-CG 3.27Å; R82-L86 PolarHBondContact O-N 2.65Å
83	I	98.1	Very high	97.4	Very high	85 Å²	85	102 Å²	102	44%	0.436	51%	0.506	S	S	.	.	H	α-helix	trans	-60.9	-45.7	175.5	-69.5	165.9	0	0	0	110.1	M79 E80 M85 L86 Q87	M79-I83 HydrophobicContact CG-CD1 4.06Å; M79-I83 WeakPolarHBondContact O-CG1 3.35Å; M79-I83 PolarHBondContact O-N 3.36Å; E80-I83 PolarHBondContact O-N 3.28Å; I83-M85 PolarHBondContact O-N 2.96Å; I83-L86 PolarHBondContact O-N 3.45Å; I83-Q87 HydrophobicContact CG2-CG 4.47Å; I83-Q87 WeakPolarHBondContact O-CG 3.38Å; I83-Q87 PolarHBondContact O-N 3.3Å
84	R	97.8	Very high	97.1	Very high	112 Å²	112	98.5 Å²	98.5	42%	0.423	50%	0.5	S	S	.	.	H	α-helix	trans	-58.8	-44.7	175.1	-78.4	-168.9	-72.1	-91.4	-1.8	112.8	E80 Q81 R82 L86 Q87 Q88	E80-R84 PolarHBondContact O-N 2.92Å; E80-R84 IonicContact OE1-CZ 3.91Å; E80-R84 IonicContact OE1-NH1 3.89Å; E80-R84 PolarHBondContact OE1-NH1 3.35Å; Q81-R84 PolarHBondContact O-N 2.99Å; R82-R84 VanDerWaalsContact C-N 3.35Å; R84-L86 VanDerWaalsContact C-N 3.35Å; R84-L86 PolarHBondContact O-N 3.31Å; R84-Q87 PolarHBondContact O-N 3.3Å; R84-Q88 WeakPolarHBondContact O-CG 3.41Å; R84-Q88 PolarHBondContact O-N 3.49Å
85	M	97.8	Very high	96.9	Very high	88 Å²	88	99.3 Å²	99.3	43%	0.433	50%	0.504	S	S	.	.	H	α-helix	trans	-62.2	-43.2	177.4	-71.3	-174.2	-62.9	0	0	111.4	Q81 R82 I83 Q87 Q88 T89	Q81-M85 HydrophobicContact CG-CE 4.29Å; Q81-M85 WeakPolarHBondContact O-CG 3.36Å; Q81-M85 PolarHBondContact O-N 3.25Å; R82-M85 HydrophobicContact CB-CE 4.43Å; R82-M85 HydrophobicContact CG-CE 4.01Å; R82-M85 PolarHBondContact O-N 2.91Å; I83-M85 PolarHBondContact O-N 2.96Å; M85-Q87 PolarHBondContact O-N 2.96Å; M85-Q88 PolarHBondContact O-N 3.3Å; M85-T89 PolarHBondContact O-N 3.49Å; M85-T89 PolarHBondContact O-OG1 2.94Å
86	L	97.5	Very high	96.5	Very high	110 Å²	110	97.5 Å²	97.5	58%	0.576	50%	0.501	S	S	*	.	H	α-helix	trans	-62	-42.6	176	-72.1	172.2	0	0	0	111.9	R82 I83 R84 T89 I90	R82-L86 WeakPolarHBondContact O-CG 3.27Å; R82-L86 PolarHBondContact O-N 2.65Å; I83-L86 PolarHBondContact O-N 3.45Å; R84-L86 VanDerWaalsContact C-N 3.35Å; R84-L86 PolarHBondContact O-N 3.31Å; L86-T89 PolarHBondContact O-N 3.43Å; L86-I90 VanDerWaalsContact O-CG1 3.27Å; L86-I90 WeakPolarHBondContact O-CG1 3.34Å; L86-I90 PolarHBondContact O-N 2.9Å
87	Q	97.3	Very high	95.9	Very high	104 Å²	104	100.6 Å²	100.6	49%	0.486	51%	0.506	S	S	.	.	H	α-helix	trans	-58.9	-47.8	174.9	-73.6	172.3	-31.6	0	0	111.2	I83 R84 M85 T89 I90 E91	I83-Q87 HydrophobicContact CG2-CG 4.47Å; I83-Q87 WeakPolarHBondContact O-CG 3.38Å; I83-Q87 PolarHBondContact O-N 3.3Å; R84-Q87 PolarHBondContact O-N 3.3Å; M85-Q87 PolarHBondContact O-N 2.96Å; Q87-T89 PolarHBondContact O-N 3.01Å; Q87-I90 PolarHBondContact O-N 2.97Å; Q87-E91 WeakPolarHBondContact O-CG 3.37Å; Q87-E91 PolarHBondContact O-N 2.91Å
88	Q	97	Very high	95.2	Very high	112 Å²	112	99.7 Å²	99.7	52%	0.523	50%	0.502	S	S	.	.	H	α-helix	trans	-61.7	-41	176.9	-71.9	176.9	-32	0	0	112.6	R84 M85 E91 Q92	R84-Q88 WeakPolarHBondContact O-CG 3.41Å; R84-Q88 PolarHBondContact O-N 3.49Å; M85-Q88 PolarHBondContact O-N 3.3Å; Q88-E91 PolarHBondContact O-N 3.28Å; Q88-Q92 WeakPolarHBondContact O-CB 3.34Å; Q88-Q92 VanDerWaalsContact O-CG 3.26Å; Q88-Q92 WeakPolarHBondContact O-CG 3.42Å; Q88-Q92 PolarHBondContact O-N 3.24Å
89	T	96.5	Very high	94.3	Very high	86 Å²	86	103.5 Å²	103.5	53%	0.528	51%	0.507	S	S	.	.	H	α-helix	trans	-64.6	-41.2	176.5	-57.7	0	0	0	0	111.7	M85 L86 Q87 Q92 A93	M85-T89 PolarHBondContact O-N 3.49Å; M85-T89 PolarHBondContact O-OG1 2.94Å; L86-T89 PolarHBondContact O-N 3.43Å; Q87-T89 PolarHBondContact O-N 3.01Å; T89-Q92 PolarHBondContact O-N 2.99Å; T89-A93 WeakPolarHBondContact O-CB 3.31Å; T89-A93 PolarHBondContact O-N 3.44Å
90	I	96.1	Very high	93.4	Very high	102 Å²	102	105 Å²	105	52%	0.523	52%	0.515	S	S	.	.	H	α-helix	trans	-64.1	-46.4	176	-68.7	165	0	0	0	110.5	L86 Q87 Q92 A93 L94	L86-I90 VanDerWaalsContact O-CG1 3.27Å; L86-I90 WeakPolarHBondContact O-CG1 3.34Å; L86-I90 PolarHBondContact O-N 2.9Å; Q87-I90 PolarHBondContact O-N 2.97Å; I90-Q92 VanDerWaalsContact C-N 3.33Å; I90-Q92 PolarHBondContact O-N 3.46Å; I90-A93 PolarHBondContact O-N 3.41Å; I90-L94 HydrophobicContact CG2-CD1 3.97Å; I90-L94 HydrophobicContact CG2-CG 4.43Å; I90-L94 WeakPolarHBondContact O-CG 3.26Å; I90-L94 PolarHBondContact O-N 3.44Å
91	E	95.7	Very high	92.4	Very high	121 Å²	121	103.5 Å²	103.5	57%	0.565	51%	0.513	S	S	*	.	H	α-helix	trans	-58.6	-44.4	176.8	-73.8	170.1	-173.1	0	0	111.7	Q87 Q88 L94 L95	Q87-E91 WeakPolarHBondContact O-CG 3.37Å; Q87-E91 PolarHBondContact O-N 2.91Å; Q88-E91 PolarHBondContact O-N 3.28Å; E91-L94 PolarHBondContact O-N 2.93Å; E91-L95 VanDerWaalsContact O-CG 3.31Å; E91-L95 WeakPolarHBondContact O-CG 3.42Å; E91-L95 PolarHBondContact O-N 3.43Å
92	Q	95	Very high	91.3	Very high	132 Å²	132	104.5 Å²	104.5	62%	0.617	52%	0.518	S	S	*	.	H	α-helix	trans	-62.9	-44.8	176.5	-75.1	175.7	3.7	0	0	112.4	Q88 T89 I90 L94 L95 E96	Q88-Q92 WeakPolarHBondContact O-CB 3.34Å; Q88-Q92 VanDerWaalsContact O-CG 3.26Å; Q88-Q92 WeakPolarHBondContact O-CG 3.42Å; Q88-Q92 PolarHBondContact O-N 3.24Å; T89-Q92 PolarHBondContact O-N 2.99Å; I90-Q92 VanDerWaalsContact C-N 3.33Å; I90-Q92 PolarHBondContact O-N 3.46Å; Q92-L94 VanDerWaalsContact C-N 3.34Å; Q92-L94 PolarHBondContact O-N 3.41Å; Q92-L95 PolarHBondContact O-N 2.95Å; Q92-E96 WeakPolarHBondContact O-CB 3.41Å; Q92-E96 PolarHBondContact O-N 2.97Å
93	A	93.7	Very high	90.2	Very high	57 Å²	57	103 Å²	103	47%	0.471	52%	0.515	S	S	.	.	H	α-helix	trans	-63.2	-39.6	178.4	0	0	0	0	0	112.1	T89 I90 E96 Q97	T89-A93 WeakPolarHBondContact O-CB 3.31Å; T89-A93 PolarHBondContact O-N 3.44Å; I90-A93 PolarHBondContact O-N 3.41Å; A93-E96 PolarHBondContact O-N 2.97Å; A93-Q97 WeakPolarHBondContact O-CB 3.47Å; A93-Q97 PolarHBondContact O-N 3.48Å
94	L	93.3	Very high	89	Confident	105 Å²	105	101.9 Å²	101.9	55%	0.55	51%	0.512	S	S	.	.	H	α-helix	trans	-66.8	-41.8	175.9	-71.2	173	0	0	0	112.1	I90 E91 Q92 Q97 G98	I90-L94 HydrophobicContact CG2-CD1 3.97Å; I90-L94 HydrophobicContact CG2-CG 4.43Å; I90-L94 WeakPolarHBondContact O-CG 3.26Å; I90-L94 PolarHBondContact O-N 3.44Å; E91-L94 PolarHBondContact O-N 2.93Å; Q92-L94 VanDerWaalsContact C-N 3.34Å; Q92-L94 PolarHBondContact O-N 3.41Å; L94-Q97 PolarHBondContact O-N 2.91Å; L94-G98 PolarHBondContact O-N 3.03Å
95	L	92.9	Very high	87.7	Confident	132 Å²	132	101.4 Å²	101.4	69%	0.691	52%	0.518	S	S	*	.	H	α-helix	trans	-63.7	-42.1	175.2	-73.5	172.5	0	0	0	112	E91 Q92 Q97 G98 R99	E91-L95 VanDerWaalsContact O-CG 3.31Å; E91-L95 WeakPolarHBondContact O-CG 3.42Å; E91-L95 PolarHBondContact O-N 3.43Å; Q92-L95 PolarHBondContact O-N 2.95Å; L95-Q97 VanDerWaalsContact C-N 3.35Å; L95-G98 PolarHBondContact O-N 3.36Å; L95-R99 PolarHBondContact O-N 3.37Å
96	E	91	Very high	86.3	Confident	118 Å²	118	103.9 Å²	103.9	55%	0.551	53%	0.529	S	S	*	.	H	α-helix	trans	-63.3	-42.4	175.9	-176.1	168.2	-157.9	0	0	111.4	Q92 A93 R99 I100	Q92-E96 WeakPolarHBondContact O-CB 3.41Å; Q92-E96 PolarHBondContact O-N 2.97Å; A93-E96 PolarHBondContact O-N 2.97Å; E96-R99 PolarHBondContact O-N 3.44Å; E96-I100 HydrophobicContact CG-CD1 4.05Å; E96-I100 VanDerWaalsContact O-CG1 3.3Å; E96-I100 WeakPolarHBondContact O-CG1 3.48Å; E96-I100 PolarHBondContact O-N 3.11Å
97	Q	85.1	Confident	85	Confident	121 Å²	121	105.1 Å²	105.1	57%	0.565	54%	0.536	S	S	*	.	H	α-helix	trans	-62.6	-44.7	176.1	-167.8	173.9	27.8	0	0	112	A93 L94 L95 R99 I100 T101	A93-Q97 WeakPolarHBondContact O-CB 3.47Å; A93-Q97 PolarHBondContact O-N 3.48Å; L94-Q97 PolarHBondContact O-N 2.91Å; L95-Q97 VanDerWaalsContact C-N 3.35Å; Q97-R99 VanDerWaalsContact C-N 3.32Å; Q97-R99 PolarHBondContact O-N 3.03Å; Q97-I100 PolarHBondContact O-N 3.33Å; Q97-I100 VanDerWaalsContact O-N 3.17Å; Q97-T101 PolarHBondContact O-N 3.17Å; Q97-T101 PolarHBondContact O-OG1 3.2Å; Q97-T101 VanDerWaalsContact O-OG1 3.11Å
98	G	83.8	Confident	83.4	Confident	33 Å²	33	108.3 Å²	108.3	34%	0.34	55%	0.548	S	S	.	.	H	α-helix	trans	-57.2	-44.1	174.2	0	0	0	0	0	112.3	L94 L95 I100 T101 E102	L94-G98 PolarHBondContact O-N 3.03Å; L95-G98 PolarHBondContact O-N 3.36Å; G98-I100 VanDerWaalsContact C-N 3.35Å; G98-I100 PolarHBondContact O-N 2.96Å; G98-T101 PolarHBondContact O-N 3.4Å; G98-E102 WeakPolarHBondContact O-CG 3.38Å; G98-E102 PolarHBondContact O-N 3.28Å
99	R	79.8	Confident	81.4	Confident	141 Å²	141	114 Å²	114	53%	0.532	58%	0.575	S	S	.	*	H	α-helix	trans	-64.9	-36.3	176.6	-164.1	-177.2	81	159.1	-0.1	112.8	L95 E96 Q97 K103	L95-R99 PolarHBondContact O-N 3.37Å; E96-R99 PolarHBondContact O-N 3.44Å; Q97-R99 VanDerWaalsContact C-N 3.32Å; Q97-R99 PolarHBondContact O-N 3.03Å; R99-K103 WeakPolarHBondContact O-CG 3.3Å; R99-K103 PolarHBondContact O-N 3Å
100	I	79	Confident	80.7	Confident	91 Å²	91	115.5 Å²	115.5	47%	0.467	58%	0.578	S	S	.	*	H	α-helix	trans	-65.3	-46.7	175.3	-69.3	164.6	0	0	0	109.5	E96 Q97 G98 E102 K103 T104	E96-I100 HydrophobicContact CG-CD1 4.05Å; E96-I100 VanDerWaalsContact O-CG1 3.3Å; E96-I100 WeakPolarHBondContact O-CG1 3.48Å; E96-I100 PolarHBondContact O-N 3.11Å; Q97-I100 PolarHBondContact O-N 3.33Å; Q97-I100 VanDerWaalsContact O-N 3.17Å; G98-I100 VanDerWaalsContact C-N 3.35Å; G98-I100 PolarHBondContact O-N 2.96Å; I100-E102 PolarHBondContact O-N 3.08Å; I100-K103 PolarHBondContact O-N 3.27Å; I100-T104 WeakPolarHBondContact O-CB 3.47Å; I100-T104 PolarHBondContact O-N 3.32Å; I100-T104 PolarHBondContact O-OG1 2.94Å
101	T	77	Confident	79.9	Confident	76 Å²	76	116.2 Å²	116.2	47%	0.466	58%	0.58	S	S	.	*	H	α-helix	trans	-61.3	-41.6	178.9	-55.1	0	0	0	0	112.5	Q97 G98 T104 N105	Q97-T101 PolarHBondContact O-N 3.17Å; Q97-T101 PolarHBondContact O-OG1 3.2Å; Q97-T101 VanDerWaalsContact O-OG1 3.11Å; G98-T101 PolarHBondContact O-N 3.4Å; T101-T104 PolarHBondContact O-N 3.44Å; T101-N105 PolarHBondContact O-N 2.94Å
102	E	75.3	Confident	79	Confident	133 Å²	133	115.9 Å²	115.9	62%	0.621	58%	0.581	S	S	*	*	H	α-helix	trans	-61.3	-46.4	175.3	-74.2	177.1	-178.5	0	0	112.6	G98 I100 T104 N105 Q106	G98-E102 WeakPolarHBondContact O-CG 3.38Å; G98-E102 PolarHBondContact O-N 3.28Å; I100-E102 PolarHBondContact O-N 3.08Å; E102-T104 VanDerWaalsContact C-N 3.32Å; E102-T104 PolarHBondContact O-N 3.25Å; E102-N105 PolarHBondContact O-N 3.45Å; E102-Q106 WeakPolarHBondContact O-CG 3.47Å; E102-Q106 PolarHBondContact O-N 3.3Å; E102-Q106 VanDerWaalsContact O-N 3.08Å
103	K	73.7	Confident	78	Confident	104 Å²	104	114.9 Å²	114.9	45%	0.452	58%	0.579	S	S	.	*	H	α-helix	trans	-64.8	-36.7	177.3	-73.4	-179.5	178.3	-169.9	0	112.6	R99 I100 N107	R99-K103 WeakPolarHBondContact O-CG 3.3Å; R99-K103 PolarHBondContact O-N 3Å; I100-K103 PolarHBondContact O-N 3.27Å; K103-N107 PolarHBondContact O-N 3.15Å; K103-N107 PolarHBondContact O-ND2 3.26Å
104	T	73.8	Confident	77.1	Confident	61 Å²	61	118.6 Å²	118.6	37%	0.374	59%	0.586	S	S	.	*	H	α-helix	trans	-65.2	-43.4	176.4	-63.9	0	0	0	0	110.9	I100 T101 E102 N107 F108	I100-T104 WeakPolarHBondContact O-CB 3.47Å; I100-T104 PolarHBondContact O-N 3.32Å; I100-T104 PolarHBondContact O-OG1 2.94Å; T101-T104 PolarHBondContact O-N 3.44Å; E102-T104 VanDerWaalsContact C-N 3.32Å; E102-T104 PolarHBondContact O-N 3.25Å; T104-N107 PolarHBondContact O-N 3.03Å; T104-F108 HydrophobicContact CG2-CD2 4.01Å; T104-F108 HydrophobicContact CG2-CE2 3.43Å; T104-F108 VanDerWaalsContact CG2-CE2 3.43Å; T104-F108 HydrophobicContact CG2-CZ 4.46Å; T104-F108 WeakPolarHBondContact O-CD2 3.02Å
105	N	71.1	Confident	76	Confident	102 Å²	102	119.5 Å²	119.5	55%	0.545	59%	0.588	S	S	.	*	H	α-helix	trans	-64.3	-39.4	176.5	-75.4	-15.1	0	0	0	112.9	T101 E102 N107 F108	T101-N105 PolarHBondContact O-N 2.94Å; E102-N105 PolarHBondContact O-N 3.45Å; N105-N107 PolarHBondContact O-N 3.45Å; N105-F108 PolarHBondContact O-N 3.36Å; N105-F108 VanDerWaalsContact O-N 3.15Å
106	Q	68.6	Low	74.8	Confident	141 Å²	141	118.6 Å²	118.6	66%	0.659	58%	0.581	S	S	*	*	H	α-helix	trans	-64.3	-22.4	176.5	-73.8	-177.2	-22.5	0	0	114.2	E102	E102-Q106 WeakPolarHBondContact O-CG 3.47Å; E102-Q106 PolarHBondContact O-N 3.3Å; E102-Q106 VanDerWaalsContact O-N 3.08Å
107	N	68.7	Low	73.5	Confident	135 Å²	135	118.6 Å²	118.6	72%	0.722	58%	0.583	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87	-6.8	177.8	-71.6	-19.1	0	0	0	113.3	K103 T104 N105	K103-N107 PolarHBondContact O-N 3.15Å; K103-N107 PolarHBondContact O-ND2 3.26Å; T104-N107 PolarHBondContact O-N 3.03Å; N105-N107 PolarHBondContact O-N 3.45Å
108	F	63.5	Low	72.6	Confident	171 Å²	171	118.4 Å²	118.4	75%	0.75	59%	0.585	S	S	*	*			trans	-105.8	-2.6	-180	-70.8	-61.6	0	0	0	113.8	T104 N105	T104-F108 HydrophobicContact CG2-CD2 4.01Å; T104-F108 HydrophobicContact CG2-CE2 3.43Å; T104-F108 VanDerWaalsContact CG2-CE2 3.43Å; T104-F108 HydrophobicContact CG2-CZ 4.46Å; T104-F108 WeakPolarHBondContact O-CD2 3.02Å; N105-F108 PolarHBondContact O-N 3.36Å; N105-F108 VanDerWaalsContact O-N 3.15Å
109	E	56.4	Low	71.5	Confident	233 Å²	233	126.2 Å²	126.2	100%	1.089	61%	0.607	S	S	*	*			trans	-95.9	0	167.8	-65.8	-172.8	149.2	0	0	111

Retrieved 109 of 109 residues in 52.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).