A0A077ZL61_TRITR Loading...

Small ribosomal subunit protein uS17

One of the primary rRNA binding proteins, it binds specifically to the 5'-end of 16S ribosomal RNA.

AlphaFold DB , UniProt , Accession A0A077ZL61, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 84 aa.

						>A0A077ZL61_TRITR|A0A077ZL61
MTDKIRTLQGRVVSDKMEKSIVVAIERFVKHPIYGKFIKRTTKLHVHDENNECGIGDVVEIRECRPLSKTKSWTLVRVVEKAVL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	58	Low	87.2	Confident	241 Å²	241	120 Å²	120	100%	1.187	59%	0.585	S	S	*	*				0	110.4	0	-64.8	175.9	-174.2	0	0	106.3	D3	M1-D3 PolarHBondContact O-N 2.96Å
2	T	69.9	Low	88	Confident	143 Å²	143	110.2 Å²	110.2	88%	0.877	54%	0.538	S	S	*	.			trans	-70.5	112.4	176.2	-52.4	0	0	0	0	107.1	K4	T2-K4 PolarHBondContact O-N 3.42Å; T2-K4 VanDerWaalsContact O-N 3.15Å
3	D	76.2	Confident	88.7	Confident	145 Å²	145	106.6 Å²	106.6	78%	0.775	53%	0.526	S	S	*	.			trans	-60.5	121.3	178.3	-155.2	-6.1	0	0	0	108.1	M1 I5	M1-D3 PolarHBondContact O-N 2.96Å; D3-I5 VanDerWaalsContact C-N 3.33Å; D3-I5 PolarHBondContact O-N 2.92Å
4	K	85.3	Confident	89.3	Confident	197 Å²	197	100.9 Å²	100.9	86%	0.857	50%	0.502	S	S	*	.			trans	-79.4	89.3	-172.2	-172.9	177.9	-179.9	-179.8	0	108	T2 R6	T2-K4 PolarHBondContact O-N 3.42Å; T2-K4 VanDerWaalsContact O-N 3.15Å; K4-R6 PolarHBondContact O-N 3.28Å
5	I	90.9	Very high	89.6	Confident	81 Å²	81	98.3 Å²	98.3	42%	0.415	49%	0.491	S	S	.	.			trans	-60.6	128.5	177.8	-54.5	177	0	0	0	109.1	D3 T7 R62 E63	D3-I5 VanDerWaalsContact C-N 3.33Å; D3-I5 PolarHBondContact O-N 2.92Å; I5-T7 PolarHBondContact O-N 2.86Å; I5-R62 HydrophobicContact CG2-CB 3.91Å; I5-R62 HydrophobicContact CG2-CG 4.42Å; I5-E63 HydrophobicContact CG2-CB 4.43Å; I5-E63 WeakPolarHBondContact CG2-O 3.17Å
6	R	94	Very high	89.9	Confident	140 Å²	140	103.8 Å²	103.8	53%	0.528	51%	0.51	S	S	.	.			trans	-67.3	125.8	176.9	-174.5	-175	-180	-176.9	2.8	110.1	K4 R62 E63 W73	K4-R6 PolarHBondContact O-N 3.28Å; R6-R62 WeakPolarHBondContact O-CA 3.23Å; R6-E63 HydrophobicContact CB-CG 4.15Å; R6-E63 VanDerWaalsContact CD-OE1 3.26Å; R6-E63 WeakPolarHBondContact CD-OE1 3.37Å; R6-E63 IonicContact NH1-OE1 3.47Å; R6-E63 PolarHBondContact NH1-OE1 3.44Å; R6-E63 PolarHBondContact O-N 3.35Å; R6-E63 VanDerWaalsContact O-N 3.08Å; R6-W73 HydrophobicContact CG-CH2 4.29Å
7	T	96	Very high	90.2	Very high	73 Å²	73	101.8 Å²	101.8	45%	0.448	50%	0.501	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.7	147.4	171.2	58.6	0	0	0	0	110.5	I5 I61 R62	I5-T7 PolarHBondContact O-N 2.86Å; T7-I61 CarbonylContact C-O 3.51Å; T7-I61 VanDerWaalsContact CA-O 3.23Å; T7-I61 WeakPolarHBondContact CA-O 3.34Å; T7-R62 HydrophobicContact CG2-CB 4.07Å
8	L	96.7	Very high	90.4	Very high	38 Å²	38	104.7 Å²	104.7	20%	0.199	51%	0.513	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-136	154.6	173.4	-66.1	177.1	0	0	0	109	I25 L44 E60 I61 W73	L8-I25 HydrophobicContact CB-CD1 3.98Å; L8-I25 HydrophobicContact CD1-CG1 4.23Å; L8-I25 HydrophobicContact CD1-CG2 4.39Å; L8-L44 HydrophobicContact CD1-CD1 4.12Å; L8-E60 WeakPolarHBondContact O-CA 3.4Å; L8-I61 HydrophobicContact CB-CD1 4.43Å; L8-I61 HydrophobicContact CB-CG1 4.01Å; L8-I61 PolarHBondContact N-O 2.82Å; L8-I61 WeakPolarHBondContact O-CG1 3.35Å; L8-I61 PolarHBondContact O-N 2.91Å; L8-W73 HydrophobicContact CB-CH2 4.41Å; L8-W73 HydrophobicContact CB-CZ3 4.11Å; L8-W73 HydrophobicContact CD1-CH2 3.25Å; L8-W73 HydrophobicContact CD1-CZ2 3.81Å; L8-W73 HydrophobicContact CD1-CZ3 3.77Å; L8-W73 HydrophobicContact CG-CH2 3.65Å; L8-W73 HydrophobicContact CG-CZ3 3.82Å
9	Q	97.6	Very high	90.7	Very high	102 Å²	102	103.8 Å²	103.8	48%	0.477	51%	0.506	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.2	143.7	172	-67.5	179.9	5.2	0	0	109.6	I25 V59 E60	Q9-I25 WeakPolarHBondContact O-CD1 3.38Å; Q9-V59 VanDerWaalsContact CA-O 3.31Å; Q9-V59 WeakPolarHBondContact CA-O 3.32Å; Q9-E60 HydrophobicContact CG-CB 4.02Å; Q9-E60 HydrophobicContact CG-CG 3.99Å; Q9-E60 PolarHBondContact NE2-OE1 2.84Å
10	G	96.9	Very high	91	Very high	11 Å²	11	99.3 Å²	99.3	11%	0.113	49%	0.485	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-170.8	-177.9	176.4	0	0	0	0	0	112.9	A24 V58 V59	G10-A24 WeakPolarHBondContact CA-O 3.35Å; G10-V58 WeakPolarHBondContact O-CA 3.37Å; G10-V59 PolarHBondContact N-O 3.22Å; G10-V59 PolarHBondContact O-N 2.83Å
11	R	97.5	Very high	91.2	Very high	149 Å²	149	94.7 Å²	94.7	56%	0.562	46%	0.463	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-101	136.6	-173.3	-161.7	175.4	-164.1	-159.1	-1	111.6	V13 V23 A24 G56 D57	R11-V13 PolarHBondContact O-N 2.72Å; R11-V23 CarbonylContact O-C 3.58Å; R11-V23 WeakPolarHBondContact O-CA 3.45Å; R11-A24 PolarHBondContact N-O 3.3Å; R11-A24 PolarHBondContact O-N 2.8Å; R11-G56 WeakPolarHBondContact CG-O 3.39Å; R11-G56 PolarHBondContact NE-O 2.88Å; R11-G56 PolarHBondContact NH2-O 3.41Å; R11-D57 CarbonylContact C-O 3.53Å; R11-D57 VanDerWaalsContact CA-O 3.31Å; R11-D57 WeakPolarHBondContact CA-O 3.26Å
12	V	97.5	Very high	93.1	Very high	2 Å²	2	84 Å²	84	1%	0.012	41%	0.411	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-70.4	122.6	173.4	-177.2	0	0	0	0	109.3	I21 V23 C53 G54 G56 D57 V59	V12-I21 HydrophobicContact CG1-CB 4.25Å; V12-I21 HydrophobicContact CG2-CD1 4.04Å; V12-V23 HydrophobicContact CG2-CG2 4.41Å; V12-C53 HydrophobicContact CG2-CB 4.18Å; V12-G54 VanDerWaalsContact CB-O 3.26Å; V12-G54 WeakPolarHBondContact CB-O 3.46Å; V12-G54 WeakPolarHBondContact CG1-O 3.41Å; V12-G56 PolarHBondContact O-N 2.86Å; V12-D57 HydrophobicContact CG2-CB 4.08Å; V12-D57 PolarHBondContact N-O 3.01Å; V12-V59 HydrophobicContact CG2-CB 4.46Å; V12-V59 HydrophobicContact CG2-CG1 3.69Å; V12-V59 HydrophobicContact CG2-CG2 3.84Å
13	V	97.1	Very high	94.5	Very high	64 Å²	64	77.2 Å²	77.2	39%	0.388	37%	0.369	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.5	-25.6	179.3	179.8	0	0	0	0	111.6	R11 V22 A24	R11-V13 PolarHBondContact O-N 2.72Å; V13-V22 PolarHBondContact N-O 3.39Å; V13-A24 HydrophobicContact CG2-CB 3.43Å; V13-A24 VanDerWaalsContact CG2-CB 3.43Å
14	S	96.6	Very high	95.5	Very high	26 Å²	26	70.7 Å²	70.7	18%	0.182	34%	0.336	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-154.2	133.3	179.5	-179.1	0	0	0	0	110.7	I21 V22	S14-I21 CarbonylContact O-C 3.58Å; S14-I21 WeakPolarHBondContact O-CA 3.45Å; S14-V22 PolarHBondContact N-O 3.3Å; S14-V22 PolarHBondContact O-N 2.88Å
15	D	94	Very high	96.1	Very high	63 Å²	63	62.2 Å²	62.2	34%	0.337	30%	0.3	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.2	5.3	175.6	59.4	-3	0	0	0	112.5	M17 I21 I55	D15-M17 PolarHBondContact O-N 3.4Å; D15-I21 HydrophobicContact CB-CG2 4.4Å; D15-I55 HydrophobicContact CB-CG1 4.39Å; D15-I55 WeakPolarHBondContact OD1-CD1 3.4Å; D15-I55 WeakPolarHBondContact OD1-CG1 3.46Å; D15-I55 PolarHBondContact OD2-N 2.98Å
16	K	94.9	Very high	96.4	Very high	185 Å²	185	63.5 Å²	63.5	80%	0.804	30%	0.304	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-59.2	-12	-175.4	-61.2	-177.9	178.8	-176.3	0	116
17	M	93.8	Very high	96.5	Very high	71 Å²	71	63.4 Å²	63.4	35%	0.35	30%	0.304	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105	140.5	-174.2	-68.6	177.3	-63.9	0	0	109.9	D15 K19 S20 V22	D15-M17 PolarHBondContact O-N 3.4Å; M17-K19 PolarHBondContact O-N 2.88Å; M17-S20 PolarHBondContact O-N 2.84Å; M17-V22 HydrophobicContact CE-CG2 3.52Å
18	E	94.3	Very high	96.5	Very high	154 Å²	154	66.9 Å²	66.9	72%	0.72	31%	0.313	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.2	132.5	176.5	-161.3	-173.1	169.9	0	0	111.1	S20	E18-S20 PolarHBondContact O-N 2.82Å; E18-S20 PolarHBondContact O-OG 2.84Å
19	K	95.4	Very high	96.4	Very high	87 Å²	87	67.2 Å²	67.2	38%	0.378	32%	0.316	S	S	.	.	T	Hydrogen-bonded Turn	trans	52.5	27.1	-179.1	-61	-178.2	-178	-173	0	114.8	M17 H47 D48 N51 K71	M17-K19 PolarHBondContact O-N 2.88Å; K19-H47 PolarHBondContact O-ND1 2.85Å; K19-D48 CarbonylContact C-O 3.11Å; K19-D48 WeakPolarHBondContact CA-O 3.39Å; K19-D48 VanDerWaalsContact CB-O 3.28Å; K19-D48 WeakPolarHBondContact CB-O 3.37Å; K19-D48 PolarHBondContact O-N 2.83Å; K19-N51 WeakPolarHBondContact CA-OD1 3.39Å; K19-N51 PolarHBondContact N-OD1 3.4Å; K19-K71 PolarHBondContact O-NZ 3.28Å
20	S	96.7	Very high	96.4	Very high	13 Å²	13	68.8 Å²	68.8	9%	0.091	32%	0.321	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-150.5	125	-169.8	-41	0	0	0	0	111.3	M17 E18 V46 K71	M17-S20 PolarHBondContact O-N 2.84Å; E18-S20 PolarHBondContact O-N 2.82Å; E18-S20 PolarHBondContact O-OG 2.84Å; S20-V46 WeakPolarHBondContact CA-O 3.32Å; S20-K71 WeakPolarHBondContact OG-CE 3.33Å; S20-K71 PolarHBondContact OG-NZ 3.49Å
21	I	96.6	Very high	96.4	Very high	3 Å²	3	70.6 Å²	70.6	2%	0.015	33%	0.327	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.4	152.7	173.1	64.9	-179	0	0	0	110.4	V12 S14 D15 V23 V46 D48 C53	V12-I21 HydrophobicContact CG1-CB 4.25Å; V12-I21 HydrophobicContact CG2-CD1 4.04Å; S14-I21 CarbonylContact O-C 3.58Å; S14-I21 WeakPolarHBondContact O-CA 3.45Å; D15-I21 HydrophobicContact CB-CG2 4.4Å; I21-V23 HydrophobicContact CD1-CG2 3.97Å; I21-V23 HydrophobicContact CG1-CG2 3.98Å; I21-V46 HydrophobicContact CD1-CB 4.43Å; I21-V46 HydrophobicContact CD1-CG1 4.43Å; I21-V46 HydrophobicContact CG1-CB 3.78Å; I21-V46 HydrophobicContact CG1-CG1 4.24Å; I21-V46 PolarHBondContact N-O 3.37Å; I21-V46 PolarHBondContact O-N 2.85Å; I21-D48 HydrophobicContact CD1-CB 4.41Å; I21-D48 HydrophobicContact CG2-CB 4.24Å; I21-C53 HydrophobicContact CD1-CB 3.63Å; I21-C53 HydrophobicContact CG2-CB 4.06Å
22	V	98.1	Very high	96.2	Very high	17 Å²	17	69.3 Å²	69.3	10%	0.103	34%	0.338	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.8	115.3	172.2	-175.4	0	0	0	0	108.4	V13 S14 M17 K43 L44	V13-V22 PolarHBondContact N-O 3.39Å; S14-V22 PolarHBondContact N-O 3.3Å; S14-V22 PolarHBondContact O-N 2.88Å; M17-V22 HydrophobicContact CE-CG2 3.52Å; V22-K43 HydrophobicContact CG1-CB 3.91Å; V22-K43 HydrophobicContact CG1-CD 4.25Å; V22-K43 HydrophobicContact CG1-CG 4.32Å; V22-L44 WeakPolarHBondContact CA-O 3.42Å
23	V	98	Very high	96.2	Very high	0 Å²	0	75.8 Å²	75.8	0%	0	37%	0.371	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.9	128.5	-180	-177.1	0	0	0	0	109.7	R11 V12 I21 I25 K43 L44 V46 V59 I61	R11-V23 CarbonylContact O-C 3.58Å; R11-V23 WeakPolarHBondContact O-CA 3.45Å; V12-V23 HydrophobicContact CG2-CG2 4.41Å; I21-V23 HydrophobicContact CD1-CG2 3.97Å; I21-V23 HydrophobicContact CG1-CG2 3.98Å; V23-I25 HydrophobicContact CG1-CD1 3.84Å; V23-K43 CarbonylContact O-C 3.58Å; V23-K43 WeakPolarHBondContact O-CA 3.29Å; V23-L44 PolarHBondContact N-O 3.42Å; V23-L44 PolarHBondContact O-N 2.8Å; V23-V46 HydrophobicContact CB-CG2 3.99Å; V23-V46 HydrophobicContact CG2-CB 4.18Å; V23-V46 HydrophobicContact CG2-CG2 3.6Å; V23-V59 HydrophobicContact CB-CG2 4.44Å; V23-V59 HydrophobicContact CG1-CG2 3.89Å; V23-V59 HydrophobicContact CG2-CG2 3.61Å; V23-I61 HydrophobicContact CB-CD1 4.5Å; V23-I61 HydrophobicContact CG1-CD1 4.48Å; V23-I61 HydrophobicContact CG2-CG2 4.31Å
24	A	98.1	Very high	96.1	Very high	9 Å²	9	81.7 Å²	81.7	7%	0.074	39%	0.387	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.6	116.2	170.4	0	0	0	0	0	110.1	G10 R11 V13 T41	G10-A24 WeakPolarHBondContact CA-O 3.35Å; R11-A24 PolarHBondContact N-O 3.3Å; R11-A24 PolarHBondContact O-N 2.8Å; V13-A24 HydrophobicContact CG2-CB 3.43Å; V13-A24 VanDerWaalsContact CG2-CB 3.43Å; A24-T41 HydrophobicContact CB-CG2 3.63Å
25	I	97.7	Very high	96	Very high	18 Å²	18	81.7 Å²	81.7	9%	0.092	39%	0.392	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.1	116.8	170.3	-51.2	-57.2	0	0	0	108.2	L8 Q9 V23 T41 T42 L44 I61	L8-I25 HydrophobicContact CB-CD1 3.98Å; L8-I25 HydrophobicContact CD1-CG1 4.23Å; L8-I25 HydrophobicContact CD1-CG2 4.39Å; Q9-I25 WeakPolarHBondContact O-CD1 3.38Å; V23-I25 HydrophobicContact CG1-CD1 3.84Å; I25-T41 CarbonylContact O-C 3.59Å; I25-T41 WeakPolarHBondContact O-CA 3.26Å; I25-T42 PolarHBondContact N-O 3.2Å; I25-T42 PolarHBondContact O-N 3.38Å; I25-L44 HydrophobicContact CG1-CD1 3.7Å; I25-L44 HydrophobicContact CG1-CG 4.31Å; I25-I61 HydrophobicContact CD1-CD1 3.98Å
26	E	96.5	Very high	96.1	Very high	109 Å²	109	86.2 Å²	86.2	51%	0.509	41%	0.409	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.2	139.6	175.3	-56.9	-166.2	145.4	0	0	110.7	K39 R40 T41	E26-K39 HydrophobicContact CB-CD 4.49Å; E26-K39 HydrophobicContact CB-CG 4.44Å; E26-K39 HydrophobicContact CG-CD 4.44Å; E26-K39 IonicContact OE1-NZ 3.58Å; E26-K39 WeakPolarHBondContact OE2-CE 3.38Å; E26-K39 IonicContact OE2-NZ 2.72Å; E26-K39 PolarHBondContact OE2-NZ 2.76Å; E26-R40 CarbonylContact C-O 3.57Å; E26-R40 WeakPolarHBondContact CA-O 3.41Å; E26-T41 HydrophobicContact CG-CG2 4.3Å
27	R	95.9	Very high	96.2	Very high	138 Å²	138	84.1 Å²	84.1	52%	0.521	40%	0.4	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-143.1	147.8	173.6	63	-176.2	177.8	105.8	1.5	110.8	V29 R40	R27-V29 HydrophobicContact CG-CG2 4.05Å; R27-R40 HydrophobicContact CG-CB 4.2Å; R27-R40 PolarHBondContact N-O 2.87Å; R27-R40 PolarHBondContact O-N 2.85Å
28	F	96.2	Very high	96.3	Very high	146 Å²	146	83 Å²	83	64%	0.64	40%	0.395	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-88	131.2	170.1	-69.1	-80.4	0	0	0	110	F37 I38 K39	F28-F37 HydrophobicContact CB-CD1 4.24Å; F28-F37 HydrophobicContact CD1-CB 4.47Å; F28-I38 WeakPolarHBondContact CA-O 3.4Å; F28-K39 HydrophobicContact CD1-CB 4.46Å; F28-K39 HydrophobicContact CE1-CB 4.17Å
29	V	95.7	Very high	96.4	Very high	44 Å²	44	80.9 Å²	80.9	27%	0.267	38%	0.383	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.8	132.8	177.9	-172.7	0	0	0	0	107.9	R27 H31 I38 R40	R27-V29 HydrophobicContact CG-CG2 4.05Å; V29-H31 PolarHBondContact O-N 3.05Å; V29-I38 PolarHBondContact N-O 2.88Å; V29-I38 VanDerWaalsContact O-CG1 3.29Å; V29-I38 WeakPolarHBondContact O-CG1 3.45Å; V29-I38 PolarHBondContact O-N 2.8Å; V29-R40 HydrophobicContact CB-CG 4.24Å; V29-R40 HydrophobicContact CG2-CB 4.13Å; V29-R40 HydrophobicContact CG2-CG 3.8Å
30	K	97.4	Very high	96.5	Very high	135 Å²	135	83.1 Å²	83.1	59%	0.587	39%	0.389	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-68.5	125.5	173.3	-169.4	174.2	-177.7	179	0	109.2	G35 F37	K30-G35 WeakPolarHBondContact CE-O 3.31Å; K30-G35 WeakPolarHBondContact CG-O 3.45Å; K30-F37 HydrophobicContact CB-CD1 4.39Å; K30-F37 HydrophobicContact CB-CE1 4.16Å
31	H	96.5	Very high	96.5	Very high	49 Å²	49	86 Å²	86	23%	0.227	41%	0.407	C	S	.	.			trans	-63.9	130	172.8	-173.5	-72.9	0	0	0	109.2	V29 I33 Y34 G35 K36	V29-H31 PolarHBondContact O-N 3.05Å; H31-I33 PolarHBondContact ND1-N 3.49Å; H31-I33 PolarHBondContact O-N 3.04Å; H31-Y34 AromaticContact CE1-CD2 3.32Å; H31-Y34 WeakPolarHBondContact CE1-CD2 3.4Å; H31-Y34 AromaticContact CE1-CE2 3.66Å; H31-Y34 AromaticContact CG-CD2 3.92Å; H31-Y34 AromaticContact ND1-CD2 3.37Å; H31-Y34 WeakPolarHBondContact ND1-CD2 3.37Å; H31-Y34 PolarHBondContact ND1-N 2.82Å; H31-Y34 AromaticContact NE2-CD2 3.83Å; H31-G35 VanDerWaalsContact O-CA 3.32Å; H31-G35 WeakPolarHBondContact O-CA 3.49Å; H31-G35 PolarHBondContact O-N 2.86Å; H31-K36 WeakPolarHBondContact CB-O 3.4Å; H31-K36 PolarHBondContact N-O 3.09Å
32	P	94.1	Very high	96.5	Very high	123 Å²	123	89 Å²	89	80%	0.799	43%	0.425	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.2	-40.9	-169.1	21.7	-33.6	0	0	0	113.3
33	I	96.2	Very high	96.5	Very high	138 Å²	138	94.7 Å²	94.7	71%	0.708	45%	0.448	S	S	*	.	T	Hydrogen-bonded Turn	trans	-85.2	-59.5	-178.3	-62	164.1	0	0	0	111.3	H31 G35	H31-I33 PolarHBondContact ND1-N 3.49Å; H31-I33 PolarHBondContact O-N 3.04Å; I33-G35 PolarHBondContact O-N 2.91Å
34	Y	95.4	Very high	96.4	Very high	187 Å²	187	96.2 Å²	96.2	73%	0.733	46%	0.456	S	S	*	.	T	Hydrogen-bonded Turn	trans	-78.6	-12.2	-173.1	-54.7	-62.9	0	0	0	115.6	H31 K36	H31-Y34 AromaticContact CE1-CD2 3.32Å; H31-Y34 WeakPolarHBondContact CE1-CD2 3.4Å; H31-Y34 AromaticContact CE1-CE2 3.66Å; H31-Y34 AromaticContact CG-CD2 3.92Å; H31-Y34 AromaticContact ND1-CD2 3.37Å; H31-Y34 WeakPolarHBondContact ND1-CD2 3.37Å; H31-Y34 PolarHBondContact ND1-N 2.82Å; H31-Y34 AromaticContact NE2-CD2 3.83Å; Y34-K36 PolarHBondContact O-N 2.82Å
35	G	94.6	Very high	96.4	Very high	27 Å²	27	98.7 Å²	98.7	28%	0.278	47%	0.466	S	S	.	.			trans	67	-1.6	-178.3	0	0	0	0	0	116.3	K30 H31 I33	K30-G35 WeakPolarHBondContact CE-O 3.31Å; K30-G35 WeakPolarHBondContact CG-O 3.45Å; H31-G35 VanDerWaalsContact O-CA 3.32Å; H31-G35 WeakPolarHBondContact O-CA 3.49Å; H31-G35 PolarHBondContact O-N 2.86Å; I33-G35 PolarHBondContact O-N 2.91Å
36	K	97	Very high	96.4	Very high	158 Å²	158	97.9 Å²	97.9	69%	0.687	46%	0.462	S	S	*	.			trans	-69.2	136.5	174.9	-173.5	173.3	-178.1	175.9	0	110.7	H31 Y34 I38	H31-K36 WeakPolarHBondContact CB-O 3.4Å; H31-K36 PolarHBondContact N-O 3.09Å; Y34-K36 PolarHBondContact O-N 2.82Å; K36-I38 PolarHBondContact O-N 2.68Å
37	F	96.6	Very high	96.5	Very high	141 Å²	141	94.6 Å²	94.6	62%	0.618	45%	0.446	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-72.9	124.3	170.7	-72.8	-82.7	0	0	0	110.3	F28 K30	F28-F37 HydrophobicContact CB-CD1 4.24Å; F28-F37 HydrophobicContact CD1-CB 4.47Å; K30-F37 HydrophobicContact CB-CD1 4.39Å; K30-F37 HydrophobicContact CB-CE1 4.16Å
38	I	96	Very high	96.5	Very high	47 Å²	47	88.1 Å²	88.1	24%	0.241	42%	0.422	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.6	142.6	175.8	59.9	170.2	0	0	0	109.8	F28 V29 K36	F28-I38 WeakPolarHBondContact CA-O 3.4Å; V29-I38 PolarHBondContact N-O 2.88Å; V29-I38 VanDerWaalsContact O-CG1 3.29Å; V29-I38 WeakPolarHBondContact O-CG1 3.45Å; V29-I38 PolarHBondContact O-N 2.8Å; K36-I38 PolarHBondContact O-N 2.68Å
39	K	96.4	Very high	96.4	Very high	109 Å²	109	87.2 Å²	87.2	47%	0.474	42%	0.42	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.3	131.8	173.8	-173.4	-177.5	-77.3	-157	0	109.4	E26 F28	E26-K39 HydrophobicContact CB-CD 4.49Å; E26-K39 HydrophobicContact CB-CG 4.44Å; E26-K39 HydrophobicContact CG-CD 4.44Å; E26-K39 IonicContact OE1-NZ 3.58Å; E26-K39 WeakPolarHBondContact OE2-CE 3.38Å; E26-K39 IonicContact OE2-NZ 2.72Å; E26-K39 PolarHBondContact OE2-NZ 2.76Å; F28-K39 HydrophobicContact CD1-CB 4.46Å; F28-K39 HydrophobicContact CE1-CB 4.17Å
40	R	96.7	Very high	96.3	Very high	135 Å²	135	90.3 Å²	90.3	51%	0.509	44%	0.435	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.8	139.4	171.4	-67.3	-62.9	-171.5	176.8	-0.1	108.8	E26 R27 V29	E26-R40 CarbonylContact C-O 3.57Å; E26-R40 WeakPolarHBondContact CA-O 3.41Å; R27-R40 HydrophobicContact CG-CB 4.2Å; R27-R40 PolarHBondContact N-O 2.87Å; R27-R40 PolarHBondContact O-N 2.85Å; V29-R40 HydrophobicContact CB-CG 4.24Å; V29-R40 HydrophobicContact CG2-CB 4.13Å; V29-R40 HydrophobicContact CG2-CG 3.8Å
41	T	96.7	Very high	96.1	Very high	74 Å²	74	87.9 Å²	87.9	45%	0.454	43%	0.428	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120	127	-178.6	-52	0	0	0	0	109.1	A24 I25 E26	A24-T41 HydrophobicContact CB-CG2 3.63Å; I25-T41 CarbonylContact O-C 3.59Å; I25-T41 WeakPolarHBondContact O-CA 3.26Å; E26-T41 HydrophobicContact CG-CG2 4.3Å
42	T	96.6	Very high	95.8	Very high	64 Å²	64	90.6 Å²	90.6	39%	0.393	44%	0.441	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.8	130.6	171.7	-61.3	0	0	0	0	108.4	I25 L44	I25-T42 PolarHBondContact N-O 3.2Å; I25-T42 PolarHBondContact O-N 3.38Å; T42-L44 HydrophobicContact CG2-CD2 4.03Å; T42-L44 HydrophobicContact CG2-CG 4.38Å
43	K	97.6	Very high	95.7	Very high	138 Å²	138	85.1 Å²	85.1	60%	0.6	41%	0.405	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-93.3	131.1	174.1	-64.4	-176.8	-177.4	-179.5	0	109.5	V22 V23	V22-K43 HydrophobicContact CG1-CB 3.91Å; V22-K43 HydrophobicContact CG1-CD 4.25Å; V22-K43 HydrophobicContact CG1-CG 4.32Å; V23-K43 CarbonylContact O-C 3.58Å; V23-K43 WeakPolarHBondContact O-CA 3.29Å
44	L	97.6	Very high	95.6	Very high	31 Å²	31	79.6 Å²	79.6	16%	0.162	38%	0.383	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.4	139.3	178.2	-62.5	177.2	0	0	0	109.9	L8 V22 V23 I25 T42 V46 I61 W73	L8-L44 HydrophobicContact CD1-CD1 4.12Å; V22-L44 WeakPolarHBondContact CA-O 3.42Å; V23-L44 PolarHBondContact N-O 3.42Å; V23-L44 PolarHBondContact O-N 2.8Å; I25-L44 HydrophobicContact CG1-CD1 3.7Å; I25-L44 HydrophobicContact CG1-CG 4.31Å; T42-L44 HydrophobicContact CG2-CD2 4.03Å; T42-L44 HydrophobicContact CG2-CG 4.38Å; L44-V46 HydrophobicContact CB-CG2 4.39Å; L44-I61 HydrophobicContact CD1-CD1 3.88Å; L44-W73 HydrophobicContact CD1-CD2 4Å; L44-W73 HydrophobicContact CD1-CG 4.3Å; L44-W73 HydrophobicContact CD1-CZ2 4.05Å
45	H	98	Very high	95.6	Very high	62 Å²	62	75 Å²	75	29%	0.287	37%	0.37	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.4	121.8	170.6	-64.8	-89.7	0	0	0	108.9	T70 K71	H45-T70 PolarHBondContact CD2-OG1 2.82Å; H45-K71 HydrophobicContact CB-CB 4.14Å; H45-K71 HydrophobicContact CB-CG 4.4Å
46	V	98.1	Very high	95.6	Very high	0 Å²	0	74.2 Å²	74.2	0%	0	36%	0.362	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.9	136.4	-172	-178	0	0	0	0	108.7	S20 I21 V23 L44 I61 W73 L75	S20-V46 WeakPolarHBondContact CA-O 3.32Å; I21-V46 HydrophobicContact CD1-CB 4.43Å; I21-V46 HydrophobicContact CD1-CG1 4.43Å; I21-V46 HydrophobicContact CG1-CB 3.78Å; I21-V46 HydrophobicContact CG1-CG1 4.24Å; I21-V46 PolarHBondContact N-O 3.37Å; I21-V46 PolarHBondContact O-N 2.85Å; V23-V46 HydrophobicContact CB-CG2 3.99Å; V23-V46 HydrophobicContact CG2-CB 4.18Å; V23-V46 HydrophobicContact CG2-CG2 3.6Å; L44-V46 HydrophobicContact CB-CG2 4.39Å; V46-I61 HydrophobicContact CB-CG2 4.42Å; V46-I61 HydrophobicContact CG1-CB 4.2Å; V46-I61 HydrophobicContact CG1-CG2 3.64Å; V46-I61 HydrophobicContact CG2-CB 4.39Å; V46-I61 HydrophobicContact CG2-CD1 3.77Å; V46-I61 HydrophobicContact CG2-CG2 3.97Å; V46-W73 CarbonylContact C-O 3.55Å; V46-W73 WeakPolarHBondContact CA-O 3.32Å; V46-W73 HydrophobicContact CB-CB 4.42Å; V46-W73 HydrophobicContact CG1-CB 4.45Å; V46-W73 HydrophobicContact CG2-CB 3.92Å; V46-L75 HydrophobicContact CG1-CB 4.41Å
47	H	98.1	Very high	95.6	Very high	41 Å²	41	67 Å²	67	19%	0.19	33%	0.331	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-76.9	123.4	170.7	-163.8	35.1	0	0	0	110.3	K19 L67 K71 W73 T74 L75	K19-H47 PolarHBondContact O-ND1 2.85Å; H47-L67 HydrophobicContact CB-CD1 3.48Å; H47-L67 VanDerWaalsContact CB-CD1 3.48Å; H47-K71 HydrophobicContact CB-CD 3.82Å; H47-W73 PolarHBondContact N-O 2.93Å; H47-T74 PolarHBondContact O-OG1 2.83Å; H47-L75 WeakPolarHBondContact O-CB 3.32Å; H47-L75 PolarHBondContact O-N 3.08Å
48	D	96.2	Very high	95.6	Very high	2 Å²	2	62.1 Å²	62.1	1%	0.011	31%	0.313	C	S	.	.			trans	-119.5	114.3	165.2	177.1	-5.4	0	0	0	105.1	K19 I21 N50 N51 E52 C53 L75	K19-D48 CarbonylContact C-O 3.11Å; K19-D48 WeakPolarHBondContact CA-O 3.39Å; K19-D48 VanDerWaalsContact CB-O 3.28Å; K19-D48 WeakPolarHBondContact CB-O 3.37Å; K19-D48 PolarHBondContact O-N 2.83Å; I21-D48 HydrophobicContact CD1-CB 4.41Å; I21-D48 HydrophobicContact CG2-CB 4.24Å; D48-N50 PolarHBondContact OD1-N 2.94Å; D48-N51 PolarHBondContact OD1-N 2.86Å; D48-N51 VanDerWaalsContact OD2-C 3.3Å; D48-N51 VanDerWaalsContact OD2-CA 3.3Å; D48-N51 WeakPolarHBondContact OD2-CA 3.31Å; D48-E52 PolarHBondContact OD1-N 3.47Å; D48-E52 PolarHBondContact OD2-N 2.91Å; D48-C53 WeakPolarHBondContact OD2-CB 3.46Å; D48-C53 PolarHBondContact OD2-N 2.64Å; D48-L75 HydrophobicContact CB-CD2 4.32Å
49	E	93.2	Very high	95.7	Very high	127 Å²	127	59.9 Å²	59.9	59%	0.593	30%	0.301	S	S	*	.	S	Bend	trans	-73.8	-33.6	-174.1	-176.1	167.6	-166.7	0	0	112.3
50	N	94.1	Very high	95.7	Very high	109 Å²	109	55.7 Å²	55.7	58%	0.583	28%	0.283	S	S	*	.	S	Bend	trans	-102.4	-2.1	-171.4	-66.4	-27.3	0	0	0	113	D48 E52	D48-N50 PolarHBondContact OD1-N 2.94Å; N50-E52 HydrophobicContact CB-CG 3.66Å; N50-E52 VanDerWaalsContact CB-OE1 3.27Å; N50-E52 WeakPolarHBondContact CB-OE1 3.4Å; N50-E52 PolarHBondContact ND2-OE1 3.39Å; N50-E52 PolarHBondContact O-N 3.18Å
51	N	91.9	Very high	95.7	Very high	83 Å²	83	49.2 Å²	49.2	44%	0.444	26%	0.259	S	S	.	.			trans	54	40.8	-172.9	-53.8	-54.3	0	0	0	111.9	K19 D48 C53	K19-N51 WeakPolarHBondContact CA-OD1 3.39Å; K19-N51 PolarHBondContact N-OD1 3.4Å; D48-N51 PolarHBondContact OD1-N 2.86Å; D48-N51 VanDerWaalsContact OD2-C 3.3Å; D48-N51 VanDerWaalsContact OD2-CA 3.3Å; D48-N51 WeakPolarHBondContact OD2-CA 3.31Å; N51-C53 VanDerWaalsContact C-N 3.31Å
52	E	90.3	Very high	95.7	Very high	107 Å²	107	50.6 Å²	50.6	50%	0.5	26%	0.256	S	S	.	.			trans	-74.3	-23.1	-178.4	-75.6	169	-158.7	0	0	112.7	D48 N50 K81	D48-E52 PolarHBondContact OD1-N 3.47Å; D48-E52 PolarHBondContact OD2-N 2.91Å; N50-E52 HydrophobicContact CB-CG 3.66Å; N50-E52 VanDerWaalsContact CB-OE1 3.27Å; N50-E52 WeakPolarHBondContact CB-OE1 3.4Å; N50-E52 PolarHBondContact ND2-OE1 3.39Å; N50-E52 PolarHBondContact O-N 3.18Å; E52-K81 PolarHBondContact O-NZ 2.93Å
53	C	93.1	Very high	95.7	Very high	7 Å²	7	51.3 Å²	51.3	5%	0.047	25%	0.254	C	S	.	.	P	Polyproline II helix	trans	-89.4	130.3	-174.2	-67.1	0	0	0	0	113.1	V12 I21 D48 N51 V59 L75	V12-C53 HydrophobicContact CG2-CB 4.18Å; I21-C53 HydrophobicContact CD1-CB 3.63Å; I21-C53 HydrophobicContact CG2-CB 4.06Å; D48-C53 WeakPolarHBondContact OD2-CB 3.46Å; D48-C53 PolarHBondContact OD2-N 2.64Å; N51-C53 VanDerWaalsContact C-N 3.31Å; C53-V59 HydrophobicContact CB-CG1 4.45Å; C53-V59 VanDerWaalsContact SG-CG1 3.58Å; C53-L75 VanDerWaalsContact SG-CD1 3.58Å; C53-L75 WeakPolarHBondContact SG-CD2 3.47Å
54	G	93.1	Very high	95.6	Very high	23 Å²	23	46.5 Å²	46.5	24%	0.237	24%	0.238	C	C	.	.	P	Polyproline II helix	trans	-103.1	163.6	172.4	0	0	0	0	0	112.6	V12 G56 D57	V12-G54 VanDerWaalsContact CB-O 3.26Å; V12-G54 WeakPolarHBondContact CB-O 3.46Å; V12-G54 WeakPolarHBondContact CG1-O 3.41Å; G54-G56 PolarHBondContact O-N 3.32Å; G54-D57 PolarHBondContact N-OD2 3.22Å; G54-D57 WeakPolarHBondContact O-CB 3.35Å; G54-D57 PolarHBondContact O-N 3.37Å
55	I	95.7	Very high	95.4	Very high	91 Å²	91	53.8 Å²	53.8	47%	0.467	26%	0.263	S	S	.	.	T	Hydrogen-bonded Turn	trans	-56.9	132.4	172.7	-63.3	170.9	0	0	0	110.3	D15	D15-I55 HydrophobicContact CB-CG1 4.39Å; D15-I55 WeakPolarHBondContact OD1-CD1 3.4Å; D15-I55 WeakPolarHBondContact OD1-CG1 3.46Å; D15-I55 PolarHBondContact OD2-N 2.98Å
56	G	95.1	Very high	95.4	Very high	10 Å²	10	55.6 Å²	55.6	10%	0.103	28%	0.28	C	S	.	.	T	Hydrogen-bonded Turn	trans	94.2	-13.3	177.4	0	0	0	0	0	114.5	R11 V12 G54	R11-G56 WeakPolarHBondContact CG-O 3.39Å; R11-G56 PolarHBondContact NE-O 2.88Å; R11-G56 PolarHBondContact NH2-O 3.41Å; V12-G56 PolarHBondContact O-N 2.86Å; G54-G56 PolarHBondContact O-N 3.32Å
57	D	96.2	Very high	95.2	Very high	6 Å²	6	58.6 Å²	58.6	3%	0.032	30%	0.296	C	S	.	.			trans	-62.6	144.1	175.5	-70.8	-8.6	0	0	0	111.2	R11 V12 G54 V59 V78 E80 K81 A82	R11-D57 CarbonylContact C-O 3.53Å; R11-D57 VanDerWaalsContact CA-O 3.31Å; R11-D57 WeakPolarHBondContact CA-O 3.26Å; V12-D57 HydrophobicContact CG2-CB 4.08Å; V12-D57 PolarHBondContact N-O 3.01Å; G54-D57 PolarHBondContact N-OD2 3.22Å; G54-D57 WeakPolarHBondContact O-CB 3.35Å; G54-D57 PolarHBondContact O-N 3.37Å; D57-V59 HydrophobicContact CB-CG1 4.18Å; D57-V78 HydrophobicContact CB-CG1 4.23Å; D57-E80 CarbonylContact C-O 3.57Å; D57-E80 WeakPolarHBondContact CA-O 3.4Å; D57-K81 WeakPolarHBondContact OD1-CA 3.28Å; D57-K81 WeakPolarHBondContact OD2-CD 3.36Å; D57-K81 IonicContact OD2-NZ 2.8Å; D57-K81 PolarHBondContact OD2-NZ 3.15Å; D57-A82 PolarHBondContact OD1-N 2.94Å
58	V	97.1	Very high	95.1	Very high	39 Å²	39	59.4 Å²	59.4	24%	0.236	31%	0.307	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.4	123.2	166.5	-175.4	0	0	0	0	108	G10 V79 E80	G10-V58 WeakPolarHBondContact O-CA 3.37Å; V58-V79 HydrophobicContact CB-CB 4.42Å; V58-V79 HydrophobicContact CG1-CB 4.17Å; V58-V79 WeakPolarHBondContact O-CA 3.27Å; V58-V79 WeakPolarHBondContact O-CB 3.3Å; V58-V79 PolarHBondContact O-N 3.31Å; V58-E80 HydrophobicContact CB-CB 3.9Å; V58-E80 HydrophobicContact CG2-CB 4.06Å; V58-E80 PolarHBondContact N-O 2.8Å; V58-E80 PolarHBondContact O-N 3.12Å; V58-E80 VanDerWaalsContact O-N 3.09Å
59	V	97.3	Very high	95	Very high	0 Å²	0	69.4 Å²	69.4	0%	0	35%	0.35	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.4	145.6	-173.8	-63.1	0	0	0	0	111.1	Q9 G10 V12 V23 C53 D57 I61 L75 V78	Q9-V59 VanDerWaalsContact CA-O 3.31Å; Q9-V59 WeakPolarHBondContact CA-O 3.32Å; G10-V59 PolarHBondContact N-O 3.22Å; G10-V59 PolarHBondContact O-N 2.83Å; V12-V59 HydrophobicContact CG2-CB 4.46Å; V12-V59 HydrophobicContact CG2-CG1 3.69Å; V12-V59 HydrophobicContact CG2-CG2 3.84Å; V23-V59 HydrophobicContact CB-CG2 4.44Å; V23-V59 HydrophobicContact CG1-CG2 3.89Å; V23-V59 HydrophobicContact CG2-CG2 3.61Å; C53-V59 HydrophobicContact CB-CG1 4.45Å; C53-V59 VanDerWaalsContact SG-CG1 3.58Å; D57-V59 HydrophobicContact CB-CG1 4.18Å; V59-I61 HydrophobicContact CG2-CG2 3.99Å; V59-L75 HydrophobicContact CB-CD1 3.79Å; V59-L75 HydrophobicContact CG1-CD1 4Å; V59-V78 HydrophobicContact CG1-CG1 4.4Å; V59-V78 HydrophobicContact CG1-CG2 4.25Å
60	E	97.4	Very high	95.1	Very high	20 Å²	20	67.1 Å²	67.1	9%	0.093	35%	0.345	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-96	130.9	167.1	-171.5	174.2	-109.5	0	0	109.4	L8 Q9 V76 R77 V79	L8-E60 WeakPolarHBondContact O-CA 3.4Å; Q9-E60 HydrophobicContact CG-CB 4.02Å; Q9-E60 HydrophobicContact CG-CG 3.99Å; Q9-E60 PolarHBondContact NE2-OE1 2.84Å; E60-V76 HydrophobicContact CB-CB 4.36Å; E60-V76 HydrophobicContact CG-CB 4.31Å; E60-V76 WeakPolarHBondContact O-CB 3.24Å; E60-V76 PolarHBondContact O-N 3.33Å; E60-R77 HydrophobicContact CB-CG 4.16Å; E60-R77 VanDerWaalsContact CD-NH2 3.3Å; E60-R77 PolarHBondContact N-O 2.71Å; E60-R77 PolarHBondContact O-N 2.66Å; E60-R77 IonicContact OE1-CZ 3.97Å; E60-R77 IonicContact OE1-NH2 3.18Å; E60-R77 PolarHBondContact OE1-NH2 3.37Å; E60-R77 IonicContact OE2-CZ 2.91Å; E60-R77 IonicContact OE2-NE 3.83Å; E60-R77 IonicContact OE2-NH1 2.64Å; E60-R77 PolarHBondContact OE2-NH1 2.81Å; E60-R77 IonicContact OE2-NH2 2.91Å; E60-R77 PolarHBondContact OE2-NH2 3.06Å; E60-V79 HydrophobicContact CB-CG2 3.98Å
61	I	97.3	Very high	95.2	Very high	0 Å²	0	63.1 Å²	63.1	0%	0	32%	0.322	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.4	152.1	-176.5	65.4	169.8	0	0	0	109.8	T7 L8 V23 I25 L44 V46 V59 W73 T74	T7-I61 CarbonylContact C-O 3.51Å; T7-I61 VanDerWaalsContact CA-O 3.23Å; T7-I61 WeakPolarHBondContact CA-O 3.34Å; L8-I61 HydrophobicContact CB-CD1 4.43Å; L8-I61 HydrophobicContact CB-CG1 4.01Å; L8-I61 PolarHBondContact N-O 2.82Å; L8-I61 WeakPolarHBondContact O-CG1 3.35Å; L8-I61 PolarHBondContact O-N 2.91Å; V23-I61 HydrophobicContact CB-CD1 4.5Å; V23-I61 HydrophobicContact CG1-CD1 4.48Å; V23-I61 HydrophobicContact CG2-CG2 4.31Å; I25-I61 HydrophobicContact CD1-CD1 3.98Å; L44-I61 HydrophobicContact CD1-CD1 3.88Å; V46-I61 HydrophobicContact CB-CG2 4.42Å; V46-I61 HydrophobicContact CG1-CB 4.2Å; V46-I61 HydrophobicContact CG1-CG2 3.64Å; V46-I61 HydrophobicContact CG2-CB 4.39Å; V46-I61 HydrophobicContact CG2-CD1 3.77Å; V46-I61 HydrophobicContact CG2-CG2 3.97Å; V59-I61 HydrophobicContact CG2-CG2 3.99Å; I61-W73 HydrophobicContact CB-CE3 4.21Å; I61-W73 HydrophobicContact CD1-CB 4.38Å; I61-W73 HydrophobicContact CD1-CD2 4Å; I61-W73 HydrophobicContact CD1-CE3 3.62Å; I61-W73 HydrophobicContact CD1-CG 4.32Å; I61-W73 HydrophobicContact CD1-CZ3 4.27Å; I61-W73 HydrophobicContact CG1-CE3 3.66Å; I61-W73 HydrophobicContact CG1-CZ3 4.1Å; I61-T74 WeakPolarHBondContact CA-O 3.31Å
62	R	96.5	Very high	95.4	Very high	103 Å²	103	61.4 Å²	61.4	39%	0.389	32%	0.317	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.7	153	177	69.2	-177.9	174.2	114.7	-1.9	111.7	I5 R6 T7 W73 T74 V76	I5-R62 HydrophobicContact CG2-CB 3.91Å; I5-R62 HydrophobicContact CG2-CG 4.42Å; R6-R62 WeakPolarHBondContact O-CA 3.23Å; T7-R62 HydrophobicContact CG2-CB 4.07Å; R62-W73 CarbonylContact O-C 3.58Å; R62-W73 VanDerWaalsContact O-CA 3.31Å; R62-W73 WeakPolarHBondContact O-CA 2.94Å; R62-T74 HydrophobicContact CG-CG2 3.47Å; R62-T74 VanDerWaalsContact CG-CG2 3.47Å; R62-T74 PolarHBondContact N-O 2.9Å; R62-T74 PolarHBondContact O-N 2.8Å; R62-V76 HydrophobicContact CB-CG2 3.63Å; R62-V76 HydrophobicContact CG-CG2 3.54Å
63	E	96.7	Very high	95.8	Very high	78 Å²	78	57 Å²	57	36%	0.364	30%	0.296	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-63.5	140.6	171.4	-69.3	-179	172.2	0	0	110.2	I5 R6 W73	I5-E63 HydrophobicContact CG2-CB 4.43Å; I5-E63 WeakPolarHBondContact CG2-O 3.17Å; R6-E63 HydrophobicContact CB-CG 4.15Å; R6-E63 VanDerWaalsContact CD-OE1 3.26Å; R6-E63 WeakPolarHBondContact CD-OE1 3.37Å; R6-E63 IonicContact NH1-OE1 3.47Å; R6-E63 PolarHBondContact NH1-OE1 3.44Å; R6-E63 PolarHBondContact O-N 3.35Å; R6-E63 VanDerWaalsContact O-N 3.08Å; E63-W73 HydrophobicContact CG-CD2 4.09Å; E63-W73 HydrophobicContact CG-CE3 4.03Å; E63-W73 HydrophobicContact CG-CH2 3.3Å; E63-W73 HydrophobicContact CG-CZ2 3.36Å; E63-W73 HydrophobicContact CG-CZ3 3.66Å; E63-W73 WeakPolarHBondContact OE1-CZ2 3.38Å
64	C	94.6	Very high	96	Very high	38 Å²	38	57.7 Å²	57.7	26%	0.257	30%	0.3	S	S	.	.			trans	-139.4	177.1	174.5	69.1	0	0	0	0	110.1	S72 W73 T74	C64-S72 PolarHBondContact N-O 2.8Å; C64-S72 VanDerWaalsContact SG-C 3.54Å; C64-W73 VanDerWaalsContact SG-C 3.56Å; C64-T74 HydrophobicContact CB-CG2 4.01Å
65	R	94.4	Very high	96.2	Very high	183 Å²	183	57.9 Å²	57.9	69%	0.691	30%	0.295	S	S	*	.	S	Bend	trans	-55	148.7	170.2	67.5	-179	178.2	87.5	-1.8	110.4	L67	R65-L67 HydrophobicContact CG-CD2 4.36Å; R65-L67 PolarHBondContact O-N 3.38Å; R65-L67 VanDerWaalsContact O-N 3.16Å
66	P	96.6	Very high	96.2	Very high	100 Å²	100	56.4 Å²	56.4	65%	0.649	29%	0.29	S	S	*	.			trans	-55.8	123	170.9	-23.3	33.6	0	0	0	110.4
67	L	94.6	Very high	96.2	Very high	63 Å²	63	62 Å²	62	33%	0.33	31%	0.308	S	S	.	.	S	Bend	trans	-98.7	-25	173.9	-64.7	173.3	0	0	0	111.1	H47 R65 K71	H47-L67 HydrophobicContact CB-CD1 3.48Å; H47-L67 VanDerWaalsContact CB-CD1 3.48Å; R65-L67 HydrophobicContact CG-CD2 4.36Å; R65-L67 PolarHBondContact O-N 3.38Å; R65-L67 VanDerWaalsContact O-N 3.16Å; L67-K71 HydrophobicContact CB-CB 4.36Å; L67-K71 HydrophobicContact CB-CD 3.97Å; L67-K71 HydrophobicContact CB-CG 4.26Å; L67-K71 HydrophobicContact CD1-CD 3.86Å; L67-K71 HydrophobicContact CD1-CG 4.33Å; L67-K71 PolarHBondContact N-O 2.89Å
68	S	94.8	Very high	96.2	Very high	59 Å²	59	63.6 Å²	63.6	41%	0.413	32%	0.318	S	S	.	.	S	Bend	trans	-151	-176.8	172	80.9	0	0	0	0	110	T70 K71	S68-T70 PolarHBondContact O-N 3.35Å; S68-T70 VanDerWaalsContact O-N 3.12Å; S68-T70 PolarHBondContact OG-N 3.04Å; S68-K71 PolarHBondContact N-O 3.36Å; S68-K71 VanDerWaalsContact OG-CB 3.24Å; S68-K71 WeakPolarHBondContact OG-CB 3.34Å; S68-K71 PolarHBondContact OG-N 3.01Å
69	K	95.3	Very high	96.1	Very high	211 Å²	211	65.1 Å²	65.1	92%	0.917	33%	0.327	S	S	*	.	S	Bend	trans	-51.9	-32.5	174.4	-174.3	176.9	-179.3	178.8	0	113.5
70	T	95.8	Very high	96	Very high	79 Å²	79	70.9 Å²	70.9	49%	0.485	35%	0.354	S	S	.	.	S	Bend	trans	-123.7	-13.5	-174.9	58.4	0	0	0	0	114.2	H45 S68	H45-T70 PolarHBondContact CD2-OG1 2.82Å; S68-T70 PolarHBondContact O-N 3.35Å; S68-T70 VanDerWaalsContact O-N 3.12Å; S68-T70 PolarHBondContact OG-N 3.04Å
71	K	95.6	Very high	95.8	Very high	25 Å²	25	75.2 Å²	75.2	11%	0.109	37%	0.373	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.9	101.4	-177.9	-169.2	-170.4	-64.7	-175	0	110.2	K19 S20 H45 H47 L67 S68	K19-K71 PolarHBondContact O-NZ 3.28Å; S20-K71 WeakPolarHBondContact OG-CE 3.33Å; S20-K71 PolarHBondContact OG-NZ 3.49Å; H45-K71 HydrophobicContact CB-CB 4.14Å; H45-K71 HydrophobicContact CB-CG 4.4Å; H47-K71 HydrophobicContact CB-CD 3.82Å; L67-K71 HydrophobicContact CB-CB 4.36Å; L67-K71 HydrophobicContact CB-CD 3.97Å; L67-K71 HydrophobicContact CB-CG 4.26Å; L67-K71 HydrophobicContact CD1-CD 3.86Å; L67-K71 HydrophobicContact CD1-CG 4.33Å; L67-K71 PolarHBondContact N-O 2.89Å; S68-K71 PolarHBondContact N-O 3.36Å; S68-K71 VanDerWaalsContact OG-CB 3.24Å; S68-K71 WeakPolarHBondContact OG-CB 3.34Å; S68-K71 PolarHBondContact OG-N 3.01Å
72	S	96.8	Very high	95.4	Very high	48 Å²	48	77.2 Å²	77.2	34%	0.336	39%	0.39	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.9	17.3	176.3	58	0	0	0	0	112.8	C64	C64-S72 PolarHBondContact N-O 2.8Å; C64-S72 VanDerWaalsContact SG-C 3.54Å
73	W	98.1	Very high	94.8	Very high	14 Å²	14	78.8 Å²	78.8	5%	0.053	41%	0.41	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.8	149.5	-179.8	-67.5	79.6	0	0	0	109.8	R6 L8 L44 V46 H47 I61 R62 E63 C64	R6-W73 HydrophobicContact CG-CH2 4.29Å; L8-W73 HydrophobicContact CB-CH2 4.41Å; L8-W73 HydrophobicContact CB-CZ3 4.11Å; L8-W73 HydrophobicContact CD1-CH2 3.25Å; L8-W73 HydrophobicContact CD1-CZ2 3.81Å; L8-W73 HydrophobicContact CD1-CZ3 3.77Å; L8-W73 HydrophobicContact CG-CH2 3.65Å; L8-W73 HydrophobicContact CG-CZ3 3.82Å; L44-W73 HydrophobicContact CD1-CD2 4Å; L44-W73 HydrophobicContact CD1-CG 4.3Å; L44-W73 HydrophobicContact CD1-CZ2 4.05Å; V46-W73 CarbonylContact C-O 3.55Å; V46-W73 WeakPolarHBondContact CA-O 3.32Å; V46-W73 HydrophobicContact CB-CB 4.42Å; V46-W73 HydrophobicContact CG1-CB 4.45Å; V46-W73 HydrophobicContact CG2-CB 3.92Å; H47-W73 PolarHBondContact N-O 2.93Å; I61-W73 HydrophobicContact CB-CE3 4.21Å; I61-W73 HydrophobicContact CD1-CB 4.38Å; I61-W73 HydrophobicContact CD1-CD2 4Å; I61-W73 HydrophobicContact CD1-CE3 3.62Å; I61-W73 HydrophobicContact CD1-CG 4.32Å; I61-W73 HydrophobicContact CD1-CZ3 4.27Å; I61-W73 HydrophobicContact CG1-CE3 3.66Å; I61-W73 HydrophobicContact CG1-CZ3 4.1Å; R62-W73 CarbonylContact O-C 3.58Å; R62-W73 VanDerWaalsContact O-CA 3.31Å; R62-W73 WeakPolarHBondContact O-CA 2.94Å; E63-W73 HydrophobicContact CG-CD2 4.09Å; E63-W73 HydrophobicContact CG-CE3 4.03Å; E63-W73 HydrophobicContact CG-CH2 3.3Å; E63-W73 HydrophobicContact CG-CZ2 3.36Å; E63-W73 HydrophobicContact CG-CZ3 3.66Å; E63-W73 WeakPolarHBondContact OE1-CZ2 3.38Å; C64-W73 VanDerWaalsContact SG-C 3.56Å
74	T	96.7	Very high	93.2	Very high	22 Å²	22	86.3 Å²	86.3	14%	0.135	45%	0.451	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.9	148.3	175.2	-167.3	0	0	0	0	110.6	H47 I61 R62 C64	H47-T74 PolarHBondContact O-OG1 2.83Å; I61-T74 WeakPolarHBondContact CA-O 3.31Å; R62-T74 HydrophobicContact CG-CG2 3.47Å; R62-T74 VanDerWaalsContact CG-CG2 3.47Å; R62-T74 PolarHBondContact N-O 2.9Å; R62-T74 PolarHBondContact O-N 2.8Å; C64-T74 HydrophobicContact CB-CG2 4.01Å
75	L	97.1	Very high	93.1	Very high	26 Å²	26	88.7 Å²	88.7	14%	0.136	46%	0.461	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-61.4	137.8	172.8	-175.4	66.8	0	0	0	109.9	V46 H47 D48 C53 V59	V46-L75 HydrophobicContact CG1-CB 4.41Å; H47-L75 WeakPolarHBondContact O-CB 3.32Å; H47-L75 PolarHBondContact O-N 3.08Å; D48-L75 HydrophobicContact CB-CD2 4.32Å; C53-L75 VanDerWaalsContact SG-CD1 3.58Å; C53-L75 WeakPolarHBondContact SG-CD2 3.47Å; V59-L75 HydrophobicContact CB-CD1 3.79Å; V59-L75 HydrophobicContact CG1-CD1 4Å
76	V	95.8	Very high	93	Very high	60 Å²	60	83.7 Å²	83.7	36%	0.364	45%	0.449	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104	-55.5	170.6	-179.4	0	0	0	0	109.6	E60 R62	E60-V76 HydrophobicContact CB-CB 4.36Å; E60-V76 HydrophobicContact CG-CB 4.31Å; E60-V76 WeakPolarHBondContact O-CB 3.24Å; E60-V76 PolarHBondContact O-N 3.33Å; R62-V76 HydrophobicContact CB-CG2 3.63Å; R62-V76 HydrophobicContact CG-CG2 3.54Å
77	R	95.4	Very high	92.8	Very high	128 Å²	128	82.8 Å²	82.8	48%	0.483	44%	0.438	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-160.7	156.8	176.5	61.7	176.4	-179.1	-78.7	-14.4	111.2	E60	E60-R77 HydrophobicContact CB-CG 4.16Å; E60-R77 VanDerWaalsContact CD-NH2 3.3Å; E60-R77 PolarHBondContact N-O 2.71Å; E60-R77 PolarHBondContact O-N 2.66Å; E60-R77 IonicContact OE1-CZ 3.97Å; E60-R77 IonicContact OE1-NH2 3.18Å; E60-R77 PolarHBondContact OE1-NH2 3.37Å; E60-R77 IonicContact OE2-CZ 2.91Å; E60-R77 IonicContact OE2-NE 3.83Å; E60-R77 IonicContact OE2-NH1 2.64Å; E60-R77 PolarHBondContact OE2-NH1 2.81Å; E60-R77 IonicContact OE2-NH2 2.91Å; E60-R77 PolarHBondContact OE2-NH2 3.06Å
78	V	95.6	Very high	92.7	Very high	39 Å²	39	84 Å²	84	24%	0.236	44%	0.444	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.6	125	164	-172.5	0	0	0	0	108.2	D57 V59 K81	D57-V78 HydrophobicContact CB-CG1 4.23Å; V59-V78 HydrophobicContact CG1-CG1 4.4Å; V59-V78 HydrophobicContact CG1-CG2 4.25Å; V78-K81 HydrophobicContact CG1-CD 3.99Å; V78-K81 HydrophobicContact CG1-CG 4.08Å
79	V	95.3	Very high	92.6	Very high	71 Å²	71	85.6 Å²	85.6	43%	0.43	45%	0.446	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.8	-46	179.4	179.9	0	0	0	0	110.3	V58 E60	V58-V79 HydrophobicContact CB-CB 4.42Å; V58-V79 HydrophobicContact CG1-CB 4.17Å; V58-V79 WeakPolarHBondContact O-CA 3.27Å; V58-V79 WeakPolarHBondContact O-CB 3.3Å; V58-V79 PolarHBondContact O-N 3.31Å; E60-V79 HydrophobicContact CB-CG2 3.98Å
80	E	95.4	Very high	92.4	Very high	121 Å²	121	77.2 Å²	77.2	57%	0.565	42%	0.415	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-140.9	129.6	179.5	-169.2	-178.9	159.7	0	0	109	D57 V58	D57-E80 CarbonylContact C-O 3.57Å; D57-E80 WeakPolarHBondContact CA-O 3.4Å; V58-E80 HydrophobicContact CB-CB 3.9Å; V58-E80 HydrophobicContact CG2-CB 4.06Å; V58-E80 PolarHBondContact N-O 2.8Å; V58-E80 PolarHBondContact O-N 3.12Å; V58-E80 VanDerWaalsContact O-N 3.09Å
81	K	93.4	Very high	92.2	Very high	111 Å²	111	77.1 Å²	77.1	48%	0.483	41%	0.41	S	S	.	.			trans	-84.9	139.3	174.3	-79.1	-73.7	-179.7	-174.4	0	109.6	E52 D57 V78 V83	E52-K81 PolarHBondContact O-NZ 2.93Å; D57-K81 WeakPolarHBondContact OD1-CA 3.28Å; D57-K81 WeakPolarHBondContact OD2-CD 3.36Å; D57-K81 IonicContact OD2-NZ 2.8Å; D57-K81 PolarHBondContact OD2-NZ 3.15Å; V78-K81 HydrophobicContact CG1-CD 3.99Å; V78-K81 HydrophobicContact CG1-CG 4.08Å; K81-V83 PolarHBondContact O-N 3.16Å
82	A	89.4	Confident	91.9	Very high	43 Å²	43	81.1 Å²	81.1	36%	0.355	43%	0.433	S	S	.	.			trans	-59.1	128.4	174.3	0	0	0	0	0	110.4	D57 L84	D57-A82 PolarHBondContact OD1-N 2.94Å; A82-L84 PolarHBondContact O-N 3.17Å
83	V	83	Confident	91.5	Very high	135 Å²	135	83.8 Å²	83.8	82%	0.818	44%	0.441	S	S	*	.			trans	-76.2	114.3	169.2	-173.8	0	0	0	0	106.9	K81	K81-V83 PolarHBondContact O-N 3.16Å
84	L	62.7	Low	90.9	Very high	236 Å²	236	90.2 Å²	90.2	100%	1.236	48%	0.477	S	S	*	.			trans	-74	0	164	-87	160.8	0	0	0	110	A82	A82-L84 PolarHBondContact O-N 3.17Å

Retrieved 84 of 84 residues in 75.8 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).