A0A077ZL70_TRITR Loading...

LSM domain containing protein

AlphaFold DB , UniProt , Accession A0A077ZL70, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 103 aa.

						>A0A077ZL70_TRITR|A0A077ZL70
MQNREKKKKESVIDLTNLIDKPIVVKFQGGREVSGILKGFDQLLNLVLDNTTETMHDADESAQANPATRNLGLIVARGNTILVIAPADGMEQIVNPFVQPDMA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	51.6	Low	62.1	Low	244 Å²	244	184.5 Å²	184.5	100%	1.202	85%	0.849	S	S	*	*				0	116.4	0	-75.6	172.1	172.9	0	0	107.5	N3	M1-N3 PolarHBondContact O-N 2.93Å
2	Q	55	Low	63.5	Low	197 Å²	197	181.8 Å²	181.8	92%	0.921	86%	0.855	S	S	*	*			trans	-65.7	117.7	-177	-76.1	172.1	-4.3	0	0	109.9	R4	Q2-R4 PolarHBondContact O-N 3.05Å
3	N	61.7	Low	65	Low	154 Å²	154	174.5 Å²	174.5	82%	0.824	82%	0.824	S	S	*	*			trans	-70.2	98.5	176.2	-141.2	12	0	0	0	107.5	M1 E5	M1-N3 PolarHBondContact O-N 2.93Å; N3-E5 VanDerWaalsContact C-N 3.27Å; N3-E5 PolarHBondContact O-N 3.24Å
4	R	61.4	Low	66.8	Low	233 Å²	233	169.3 Å²	169.3	88%	0.879	80%	0.803	S	S	*	*			trans	-69	92.3	168.6	-82.9	-176.7	170.7	-179	-2.6	107.1	Q2 K6	Q2-R4 PolarHBondContact O-N 3.05Å; R4-K6 PolarHBondContact O-N 3.26Å
5	E	62.2	Low	68.6	Low	176 Å²	176	158.3 Å²	158.3	82%	0.822	75%	0.751	S	S	*	*			trans	-55.7	108.5	166.3	-70.9	-166.2	145.1	0	0	108	N3 K7	N3-E5 VanDerWaalsContact C-N 3.27Å; N3-E5 PolarHBondContact O-N 3.24Å; E5-K7 PolarHBondContact O-N 3.03Å
6	K	65.1	Low	70.3	Confident	197 Å²	197	153.5 Å²	153.5	86%	0.857	74%	0.736	S	S	*	*			trans	-62.3	106.9	171.1	-70.5	179.8	179.3	176.2	0	106.1	R4 K8	R4-K6 PolarHBondContact O-N 3.26Å; K6-K8 PolarHBondContact O-N 2.98Å
7	K	62.8	Low	71.7	Confident	203 Å²	203	151.5 Å²	151.5	88%	0.883	73%	0.73	S	S	*	*			trans	-47.1	117.8	168.5	-78.1	-172.7	174.5	-173.1	0	107.6	E5 K9	E5-K7 PolarHBondContact O-N 3.03Å; K7-K9 PolarHBondContact O-N 2.96Å
8	K	62.6	Low	73.1	Confident	177 Å²	177	144.7 Å²	144.7	77%	0.77	70%	0.698	S	S	*	*			trans	-56.3	127.8	174.3	-76.3	-178.8	177.9	177.2	0	106.9	K6 E10	K6-K8 PolarHBondContact O-N 2.98Å; K8-E10 PolarHBondContact O-N 3.01Å
9	K	64.4	Low	74.4	Confident	201 Å²	201	140 Å²	140	87%	0.874	68%	0.676	S	S	*	*			trans	-67.1	103.8	169.9	-73.7	-174.9	176.9	-176.2	0	106.1	K7 S11	K7-K9 PolarHBondContact O-N 2.96Å; K9-S11 PolarHBondContact O-N 2.91Å
10	E	65.4	Low	75.6	Confident	182 Å²	182	138.1 Å²	138.1	85%	0.85	67%	0.67	S	S	*	*			trans	-60.7	134.7	171.2	-70.2	174.4	176.9	0	0	108.3	K8	K8-E10 PolarHBondContact O-N 3.01Å
11	S	70.8	Confident	76.6	Confident	65 Å²	65	136.6 Å²	136.6	46%	0.455	66%	0.66	S	S	.	*			trans	-62.9	137.4	171	172.3	0	0	0	0	108.2	K9 I13	K9-S11 PolarHBondContact O-N 2.91Å; S11-I13 PolarHBondContact O-N 2.59Å; S11-I13 PolarHBondContact OG-N 3.15Å; S11-I13 VanDerWaalsContact OG-N 3.15Å; S11-I13 PolarHBondContact OG-O 3.24Å
12	V	79.3	Confident	78.8	Confident	153 Å²	153	128.3 Å²	128.3	93%	0.927	62%	0.624	S	S	*	*	S	Bend	trans	-63.6	-23.1	173.6	-179.3	0	0	0	0	110.9
13	I	83	Confident	80.9	Confident	87 Å²	87	118.9 Å²	118.9	45%	0.446	58%	0.58	S	S	.	*			trans	-106.1	114.6	-177.8	-55.2	174.2	0	0	0	108.3	S11 L15 L44	S11-I13 PolarHBondContact O-N 2.59Å; S11-I13 PolarHBondContact OG-N 3.15Å; S11-I13 VanDerWaalsContact OG-N 3.15Å; S11-I13 PolarHBondContact OG-O 3.24Å; I13-L15 HydrophobicContact CG2-CD2 3.66Å; I13-L15 HydrophobicContact CG2-CG 4.09Å; I13-L44 HydrophobicContact CD1-CD1 4.41Å
14	D	89.3	Confident	82.6	Confident	101 Å²	101	112.3 Å²	112.3	54%	0.54	55%	0.545	S	S	.	.			trans	-102.2	112	170.2	-178.4	15.4	0	0	0	110.1	T16	D14-T16 WeakPolarHBondContact OD1-CB 3.48Å; D14-T16 PolarHBondContact OD1-N 2.88Å; D14-T16 PolarHBondContact OD1-OG1 3.49Å
15	L	94.8	Very high	84.3	Confident	4 Å²	4	101.2 Å²	101.2	2%	0.021	50%	0.503	C	S	.	.			trans	-92.1	3.2	179	-56.8	176.5	0	0	0	112.5	I13 N17 L18 I19 L37 F40 L44 L46 I84	I13-L15 HydrophobicContact CG2-CD2 3.66Å; I13-L15 HydrophobicContact CG2-CG 4.09Å; L15-N17 PolarHBondContact O-N 2.9Å; L15-L18 HydrophobicContact CD2-CD1 3.94Å; L15-L18 WeakPolarHBondContact O-CA 3.44Å; L15-L18 WeakPolarHBondContact O-CB 3.15Å; L15-L18 PolarHBondContact O-N 3.2Å; L15-I19 PolarHBondContact O-N 2.83Å; L15-L37 HydrophobicContact CB-CD2 4.07Å; L15-F40 HydrophobicContact CB-CD1 3.72Å; L15-F40 HydrophobicContact CB-CD2 4.15Å; L15-F40 HydrophobicContact CB-CE1 3.62Å; L15-F40 HydrophobicContact CB-CE2 4.05Å; L15-F40 HydrophobicContact CB-CG 4Å; L15-F40 HydrophobicContact CB-CZ 3.79Å; L15-F40 HydrophobicContact CD1-CB 4.06Å; L15-F40 HydrophobicContact CD1-CD1 4.39Å; L15-F40 HydrophobicContact CD1-CD2 4.07Å; L15-F40 HydrophobicContact CD1-CG 3.92Å; L15-F40 HydrophobicContact CG-CD2 4.42Å; L15-F40 HydrophobicContact CG-CG 4.48Å; L15-L44 HydrophobicContact CD1-CD2 4.08Å; L15-L46 HydrophobicContact CD1-CD2 3.64Å; L15-I84 HydrophobicContact CD1-CD1 3.92Å; L15-I84 HydrophobicContact CD2-CD1 4.15Å; L15-I84 HydrophobicContact CD2-CG2 4.09Å
16	T	95.3	Very high	86	Confident	82 Å²	82	97.2 Å²	97.2	50%	0.503	48%	0.483	S	S	.	.	G	3₁₀ helix	trans	-56.2	-38.3	-177.8	-56.4	0	0	0	0	111.7	D14 L18 I19	D14-T16 WeakPolarHBondContact OD1-CB 3.48Å; D14-T16 PolarHBondContact OD1-N 2.88Å; D14-T16 PolarHBondContact OD1-OG1 3.49Å; T16-L18 PolarHBondContact O-N 3.27Å; T16-I19 WeakPolarHBondContact O-CG1 3.44Å; T16-I19 PolarHBondContact O-N 3.2Å
17	N	94.5	Very high	87.5	Confident	119 Å²	119	88.8 Å²	88.8	64%	0.636	45%	0.447	S	S	*	.	G	3₁₀ helix	trans	-70.3	-10	178.2	-68.3	-34.9	0	0	0	114.5	L15 K21	L15-N17 PolarHBondContact O-N 2.9Å; N17-K21 WeakPolarHBondContact O-CD 3.42Å; N17-K21 VanDerWaalsContact O-CE 3.3Å; N17-K21 WeakPolarHBondContact O-CE 3.42Å; N17-K21 PolarHBondContact O-NZ 3.49Å
18	L	96.5	Very high	89.1	Confident	30 Å²	30	85.5 Å²	85.5	16%	0.157	44%	0.435	C	S	.	.	G	3₁₀ helix	trans	-103.2	-4.4	179.1	-58.3	-177.9	0	0	0	112.7	L15 T16 D20 K21 I23 L37 I84 P86	L15-L18 HydrophobicContact CD2-CD1 3.94Å; L15-L18 WeakPolarHBondContact O-CA 3.44Å; L15-L18 WeakPolarHBondContact O-CB 3.15Å; L15-L18 PolarHBondContact O-N 3.2Å; T16-L18 PolarHBondContact O-N 3.27Å; L18-D20 PolarHBondContact O-N 3.24Å; L18-K21 WeakPolarHBondContact O-CB 3.3Å; L18-K21 PolarHBondContact O-N 3.44Å; L18-K21 VanDerWaalsContact O-N 3.12Å; L18-I23 HydrophobicContact CB-CG2 4.13Å; L18-I23 HydrophobicContact CD1-CG2 4.24Å; L18-L37 HydrophobicContact CB-CD2 3.83Å; L18-L37 WeakPolarHBondContact O-CB 3.36Å; L18-I84 HydrophobicContact CD1-CG2 4.21Å; L18-P86 HydrophobicContact CD2-CB 4.04Å
19	I	97.5	Very high	90.4	Very high	55 Å²	55	80.9 Å²	80.9	28%	0.282	44%	0.437	S	S	.	.	T	Hydrogen-bonded Turn	trans	-58.1	137.4	174.9	-64.8	-67.8	0	0	0	110.2	L15 T16 K21 L37 F40	L15-I19 PolarHBondContact O-N 2.83Å; T16-I19 WeakPolarHBondContact O-CG1 3.44Å; T16-I19 PolarHBondContact O-N 3.2Å; I19-K21 PolarHBondContact O-N 3.47Å; I19-K21 VanDerWaalsContact O-N 3.15Å; I19-L37 HydrophobicContact CD1-CD2 4.11Å; I19-L37 HydrophobicContact CD1-CG 4.12Å; I19-F40 HydrophobicContact CD1-CD1 3.89Å; I19-F40 HydrophobicContact CD1-CE1 3.95Å; I19-F40 HydrophobicContact CG1-CE1 4.3Å
20	D	97.9	Very high	91.7	Very high	102 Å²	102	74 Å²	74	55%	0.545	42%	0.424	S	S	.	.	T	Hydrogen-bonded Turn	trans	58.1	17.3	-175.9	-68.8	-51.6	0	0	0	115	L18 L37 K38	L18-D20 PolarHBondContact O-N 3.24Å; D20-L37 PolarHBondContact N-O 3.09Å; D20-K38 IonicContact OD1-NZ 2.77Å; D20-K38 PolarHBondContact OD1-NZ 2.86Å
21	K	97.9	Very high	93.1	Very high	107 Å²	107	71.1 Å²	71.1	47%	0.465	41%	0.405	S	S	.	.	S	Bend	trans	-107.8	150.2	173.8	-63.1	-177.1	-175.1	167	0	111.6	N17 L18 I19 I23 I36 L37	N17-K21 WeakPolarHBondContact O-CD 3.42Å; N17-K21 VanDerWaalsContact O-CE 3.3Å; N17-K21 WeakPolarHBondContact O-CE 3.42Å; N17-K21 PolarHBondContact O-NZ 3.49Å; L18-K21 WeakPolarHBondContact O-CB 3.3Å; L18-K21 PolarHBondContact O-N 3.44Å; L18-K21 VanDerWaalsContact O-N 3.12Å; I19-K21 PolarHBondContact O-N 3.47Å; I19-K21 VanDerWaalsContact O-N 3.15Å; K21-I23 PolarHBondContact O-N 3.15Å; K21-I36 WeakPolarHBondContact O-CA 3.41Å; K21-L37 PolarHBondContact O-N 3.36Å; K21-L37 VanDerWaalsContact O-N 3.09Å
22	P	97.8	Very high	94.3	Very high	69 Å²	69	69.8 Å²	69.8	45%	0.448	39%	0.392	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-68	130.8	170.7	30	-34.3	0	0	0	109.8	G35 A87	P22-G35 WeakPolarHBondContact CA-O 3.18Å; P22-A87 HydrophobicContact CB-CB 3.83Å; P22-A87 HydrophobicContact CG-CB 4.09Å; P22-A87 WeakPolarHBondContact O-CB 3.4Å; P22-A87 PolarHBondContact O-N 2.9Å
23	I	98	Very high	95.1	Very high	0 Å²	0	62.6 Å²	62.6	0%	0	35%	0.348	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.3	152.5	176.7	62.4	165	0	0	0	110.1	L18 K21 V25 S34 G35 L37 L46 L48 I84 A85	L18-I23 HydrophobicContact CB-CG2 4.13Å; L18-I23 HydrophobicContact CD1-CG2 4.24Å; K21-I23 PolarHBondContact O-N 3.15Å; I23-V25 HydrophobicContact CD1-CG2 3.75Å; I23-V25 HydrophobicContact CG1-CG2 4.19Å; I23-S34 WeakPolarHBondContact O-CA 3.48Å; I23-G35 PolarHBondContact N-O 3.22Å; I23-G35 PolarHBondContact O-N 3.36Å; I23-L37 HydrophobicContact CD1-CB 3.93Å; I23-L37 HydrophobicContact CD1-CD1 4.14Å; I23-L37 HydrophobicContact CD1-CG 4.41Å; I23-L37 HydrophobicContact CG1-CB 4.26Å; I23-L46 HydrophobicContact CD1-CD1 4.23Å; I23-L48 HydrophobicContact CD1-CD2 3.74Å; I23-L48 HydrophobicContact CG1-CD2 4.1Å; I23-I84 HydrophobicContact CD1-CG2 3.98Å; I23-A85 CarbonylContact C-O 3.56Å; I23-A85 VanDerWaalsContact CA-O 3.3Å; I23-A85 WeakPolarHBondContact CA-O 2.87Å; I23-A85 WeakPolarHBondContact CB-O 3.39Å
24	V	97.5	Very high	95.8	Very high	15 Å²	15	60.6 Å²	60.6	9%	0.091	34%	0.341	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105	133.2	168.4	-173.9	0	0	0	0	108.2	E32 V33 A85 A87 M90	V24-E32 HydrophobicContact CG1-CG 3.75Å; V24-E32 WeakPolarHBondContact CG1-OE1 3.42Å; V24-V33 CarbonylContact C-O 3.52Å; V24-V33 WeakPolarHBondContact CA-O 3.48Å; V24-A85 PolarHBondContact N-O 3.5Å; V24-A85 PolarHBondContact O-N 3Å; V24-A87 HydrophobicContact CG2-CB 4.25Å; V24-M90 HydrophobicContact CB-CE 3.73Å; V24-M90 HydrophobicContact CB-SD 4.42Å; V24-M90 HydrophobicContact CG2-CE 3.6Å; V24-M90 HydrophobicContact CG2-SD 4.13Å
25	V	97.7	Very high	96.2	Very high	0 Å²	0	56 Å²	56	0%	0	32%	0.319	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.7	123.9	179.7	-175.8	0	0	0	0	109.1	I23 F27 V33 L46 L48 I81 V83	I23-V25 HydrophobicContact CD1-CG2 3.75Å; I23-V25 HydrophobicContact CG1-CG2 4.19Å; V25-F27 HydrophobicContact CB-CE2 4.42Å; V25-F27 HydrophobicContact CB-CZ 4.4Å; V25-F27 HydrophobicContact CG1-CE1 4.04Å; V25-F27 HydrophobicContact CG1-CE2 4.05Å; V25-F27 HydrophobicContact CG1-CZ 3.74Å; V25-V33 HydrophobicContact CB-CG2 3.91Å; V25-V33 PolarHBondContact N-O 3.11Å; V25-V33 PolarHBondContact O-N 3.05Å; V25-L46 HydrophobicContact CG1-CD1 4.42Å; V25-L46 HydrophobicContact CG2-CD1 3.87Å; V25-L48 HydrophobicContact CG2-CD1 4.09Å; V25-I81 HydrophobicContact CG1-CD1 4.2Å; V25-I81 HydrophobicContact CG1-CG1 4.01Å; V25-I81 HydrophobicContact CG1-CG2 3.91Å; V25-V83 WeakPolarHBondContact CA-O 3.27Å
26	K	96.9	Very high	96.4	Very high	92 Å²	92	58 Å²	58	40%	0.4	33%	0.329	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104	134.2	173.7	-55.1	-169.1	-171.2	-120.9	0	110	E32 L82 V83	K26-E32 VanDerWaalsContact CE-OE2 3.28Å; K26-E32 WeakPolarHBondContact CE-OE2 3.41Å; K26-E32 HydrophobicContact CG-CG 4.28Å; K26-E32 IonicContact NZ-OE2 2.68Å; K26-E32 PolarHBondContact NZ-OE2 2.86Å; K26-L82 PolarHBondContact O-N 3.12Å; K26-V83 HydrophobicContact CB-CB 4.08Å; K26-V83 HydrophobicContact CB-CG2 4.41Å; K26-V83 HydrophobicContact CG-CB 4.28Å; K26-V83 PolarHBondContact N-O 2.65Å; K26-V83 PolarHBondContact O-N 2.72Å
27	F	97.3	Very high	96.6	Very high	20 Å²	20	54.1 Å²	54.1	9%	0.088	31%	0.305	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.2	158.9	-179.4	-60	-85.4	0	0	0	112.2	V25 G29 G30 R31 V33 A76 T80 I81	V25-F27 HydrophobicContact CB-CE2 4.42Å; V25-F27 HydrophobicContact CB-CZ 4.4Å; V25-F27 HydrophobicContact CG1-CE1 4.04Å; V25-F27 HydrophobicContact CG1-CE2 4.05Å; V25-F27 HydrophobicContact CG1-CZ 3.74Å; F27-G29 PolarHBondContact O-N 3.48Å; F27-G30 PolarHBondContact O-N 2.78Å; F27-R31 HydrophobicContact CB-CB 4.28Å; F27-R31 HydrophobicContact CD2-CB 4.14Å; F27-R31 PolarHBondContact N-O 3.01Å; F27-V33 HydrophobicContact CE2-CB 4.33Å; F27-V33 HydrophobicContact CE2-CG1 3.89Å; F27-V33 HydrophobicContact CE2-CG2 3.58Å; F27-V33 HydrophobicContact CZ-CG2 4.08Å; F27-A76 HydrophobicContact CE1-CB 3.9Å; F27-A76 HydrophobicContact CZ-CB 3.77Å; F27-T80 CarbonylContact C-O 3.6Å; F27-T80 WeakPolarHBondContact CA-O 3.47Å; F27-I81 HydrophobicContact CD1-CG1 3.91Å; F27-I81 HydrophobicContact CE1-CD1 4.39Å; F27-I81 HydrophobicContact CE1-CG1 3.63Å
28	Q	95.7	Very high	96.8	Very high	135 Å²	135	52.6 Å²	52.6	63%	0.631	29%	0.293	S	S	*	.	T	Hydrogen-bonded Turn	trans	-54.6	133.2	162.6	-171.8	178.8	6	0	0	109.6	T80 L82	Q28-T80 PolarHBondContact N-O 2.84Å; Q28-L82 HydrophobicContact CB-CD1 4.47Å; Q28-L82 HydrophobicContact CB-CG 4.45Å
29	G	91.6	Very high	96.8	Very high	79 Å²	79	52 Å²	52	81%	0.814	29%	0.294	S	S	*	.	T	Hydrogen-bonded Turn	trans	92	6.3	-175.3	0	0	0	0	0	114.8	F27	F27-G29 PolarHBondContact O-N 3.48Å
30	G	91.4	Very high	96.8	Very high	58 Å²	58	53 Å²	53	60%	0.598	30%	0.296	S	S	*	.	S	Bend	trans	85.8	4.8	169.4	0	0	0	0	0	115.3	F27	F27-G30 PolarHBondContact O-N 2.78Å
31	R	93.8	Very high	96.7	Very high	121 Å²	121	51.2 Å²	51.2	46%	0.457	29%	0.287	S	S	.	.			trans	-72.3	138.1	174.4	-60.7	177.6	68.4	-167.2	-1.5	110.1	F27 E53	F27-R31 HydrophobicContact CB-CB 4.28Å; F27-R31 HydrophobicContact CD2-CB 4.14Å; F27-R31 PolarHBondContact N-O 3.01Å; R31-E53 IonicContact CZ-OE1 3.24Å; R31-E53 VanDerWaalsContact CZ-OE1 3.24Å; R31-E53 IonicContact NE-OE1 2.73Å; R31-E53 PolarHBondContact NE-OE1 2.83Å; R31-E53 VanDerWaalsContact NH2-CD 3.3Å; R31-E53 IonicContact NH2-OE1 2.9Å; R31-E53 PolarHBondContact NH2-OE1 3.02Å; R31-E53 IonicContact NH2-OE2 3Å; R31-E53 PolarHBondContact NH2-OE2 2.96Å
32	E	95.8	Very high	96.4	Very high	37 Å²	37	53.8 Å²	53.8	17%	0.173	30%	0.301	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.3	132.6	177.8	-177.3	166.5	145.2	0	0	109.6	V24 K26 E53 T54	V24-E32 HydrophobicContact CG1-CG 3.75Å; V24-E32 WeakPolarHBondContact CG1-OE1 3.42Å; K26-E32 VanDerWaalsContact CE-OE2 3.28Å; K26-E32 WeakPolarHBondContact CE-OE2 3.41Å; K26-E32 HydrophobicContact CG-CG 4.28Å; K26-E32 IonicContact NZ-OE2 2.68Å; K26-E32 PolarHBondContact NZ-OE2 2.86Å; E32-E53 WeakPolarHBondContact O-CA 3.33Å; E32-T54 PolarHBondContact O-N 2.78Å
33	V	97.4	Very high	96.1	Very high	2 Å²	2	56.6 Å²	56.6	1%	0.012	31%	0.311	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.4	148.1	175.2	-54.2	0	0	0	0	110.7	V24 V25 F27 L48 T51 T52 E53	V24-V33 CarbonylContact C-O 3.52Å; V24-V33 WeakPolarHBondContact CA-O 3.48Å; V25-V33 HydrophobicContact CB-CG2 3.91Å; V25-V33 PolarHBondContact N-O 3.11Å; V25-V33 PolarHBondContact O-N 3.05Å; F27-V33 HydrophobicContact CE2-CB 4.33Å; F27-V33 HydrophobicContact CE2-CG1 3.89Å; F27-V33 HydrophobicContact CE2-CG2 3.58Å; F27-V33 HydrophobicContact CZ-CG2 4.08Å; V33-L48 HydrophobicContact CG2-CD1 3.96Å; V33-T51 HydrophobicContact CB-CG2 3.79Å; V33-T51 HydrophobicContact CG1-CG2 4.34Å; V33-T51 HydrophobicContact CG2-CG2 4.14Å; V33-T52 CarbonylContact C-O 3.54Å; V33-T52 VanDerWaalsContact CA-O 3.27Å; V33-T52 WeakPolarHBondContact CA-O 3.09Å; V33-E53 HydrophobicContact CG1-CB 3.93Å; V33-E53 HydrophobicContact CG1-CG 4.13Å
34	S	97.4	Very high	95.9	Very high	44 Å²	44	58.6 Å²	58.6	31%	0.308	32%	0.321	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.4	134.6	170.3	-62.2	0	0	0	0	109.3	I23 T51 T52	I23-S34 WeakPolarHBondContact O-CA 3.48Å; S34-T51 CarbonylContact O-C 3.59Å; S34-T51 VanDerWaalsContact O-CA 3.28Å; S34-T51 WeakPolarHBondContact O-CA 3.28Å; S34-T52 PolarHBondContact N-O 3.27Å; S34-T52 PolarHBondContact O-N 3.17Å
35	G	98.1	Very high	95.9	Very high	6 Å²	6	59.2 Å²	59.2	6%	0.062	32%	0.324	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-168.3	172.8	-179.8	0	0	0	0	0	112.5	P22 I23	P22-G35 WeakPolarHBondContact CA-O 3.18Å; I23-G35 PolarHBondContact N-O 3.22Å; I23-G35 PolarHBondContact O-N 3.36Å
36	I	98.5	Very high	95.9	Very high	46 Å²	46	59.2 Å²	59.2	24%	0.236	32%	0.324	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.1	123.1	178.7	-58.4	174.4	0	0	0	109	K21 K38 L48 D49	K21-I36 WeakPolarHBondContact O-CA 3.41Å; I36-K38 HydrophobicContact CG2-CD 4.38Å; I36-K38 PolarHBondContact O-N 3.16Å; I36-L48 WeakPolarHBondContact O-CA 3.26Å; I36-D49 PolarHBondContact N-O 3.48Å; I36-D49 PolarHBondContact O-N 2.93Å
37	L	98.6	Very high	96	Very high	0 Å²	0	57.5 Å²	57.5	0%	0	32%	0.321	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-71.1	114.9	178.4	-177.7	66.4	0	0	0	110.9	L15 L18 I19 D20 K21 I23 G39 F40 L46 L48	L15-L37 HydrophobicContact CB-CD2 4.07Å; L18-L37 HydrophobicContact CB-CD2 3.83Å; L18-L37 WeakPolarHBondContact O-CB 3.36Å; I19-L37 HydrophobicContact CD1-CD2 4.11Å; I19-L37 HydrophobicContact CD1-CG 4.12Å; D20-L37 PolarHBondContact N-O 3.09Å; K21-L37 PolarHBondContact O-N 3.36Å; K21-L37 VanDerWaalsContact O-N 3.09Å; I23-L37 HydrophobicContact CD1-CB 3.93Å; I23-L37 HydrophobicContact CD1-CD1 4.14Å; I23-L37 HydrophobicContact CD1-CG 4.41Å; I23-L37 HydrophobicContact CG1-CB 4.26Å; L37-G39 WeakPolarHBondContact CD1-O 3.49Å; L37-F40 HydrophobicContact CD2-CD1 4.34Å; L37-L46 HydrophobicContact CD1-CB 4.02Å; L37-L46 HydrophobicContact CD1-CD2 4.14Å; L37-L46 HydrophobicContact CD1-CG 4.49Å; L37-L48 HydrophobicContact CB-CD2 4.37Å; L37-L48 HydrophobicContact CD1-CD2 3.85Å
38	K	98.5	Very high	96.1	Very high	87 Å²	87	56.5 Å²	56.5	38%	0.378	32%	0.317	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.3	-23	177.3	-64.9	-58.3	-178.8	-179.2	0	113.9	D20 I36 V47 D49	D20-K38 IonicContact OD1-NZ 2.77Å; D20-K38 PolarHBondContact OD1-NZ 2.86Å; I36-K38 HydrophobicContact CG2-CD 4.38Å; I36-K38 PolarHBondContact O-N 3.16Å; K38-V47 HydrophobicContact CB-CB 4.3Å; K38-V47 HydrophobicContact CB-CG1 4.05Å; K38-V47 PolarHBondContact N-O 2.91Å; K38-D49 HydrophobicContact CD-CB 4.24Å; K38-D49 HydrophobicContact CG-CB 3.61Å
39	G	98	Very high	96.2	Very high	18 Å²	18	52.4 Å²	52.4	19%	0.186	30%	0.299	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-179.9	163.5	179.5	0	0	0	0	0	111.8	L37 V47	L37-G39 WeakPolarHBondContact CD1-O 3.49Å; G39-V47 PolarHBondContact O-N 2.92Å
40	F	97.4	Very high	96.5	Very high	74 Å²	74	53.5 Å²	53.5	33%	0.325	29%	0.287	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-150.4	165.7	177.3	64.4	-82.5	0	0	0	111.1	L15 I19 L37 N45 L46	L15-F40 HydrophobicContact CB-CD1 3.72Å; L15-F40 HydrophobicContact CB-CD2 4.15Å; L15-F40 HydrophobicContact CB-CE1 3.62Å; L15-F40 HydrophobicContact CB-CE2 4.05Å; L15-F40 HydrophobicContact CB-CG 4Å; L15-F40 HydrophobicContact CB-CZ 3.79Å; L15-F40 HydrophobicContact CD1-CB 4.06Å; L15-F40 HydrophobicContact CD1-CD1 4.39Å; L15-F40 HydrophobicContact CD1-CD2 4.07Å; L15-F40 HydrophobicContact CD1-CG 3.92Å; L15-F40 HydrophobicContact CG-CD2 4.42Å; L15-F40 HydrophobicContact CG-CG 4.48Å; I19-F40 HydrophobicContact CD1-CD1 3.89Å; I19-F40 HydrophobicContact CD1-CE1 3.95Å; I19-F40 HydrophobicContact CG1-CE1 4.3Å; L37-F40 HydrophobicContact CD2-CD1 4.34Å; F40-N45 WeakPolarHBondContact CA-O 3.35Å; F40-L46 HydrophobicContact CB-CD2 3.74Å
41	D	94.8	Very high	96.8	Very high	66 Å²	66	50.8 Å²	50.8	35%	0.353	26%	0.258	S	S	.	.			trans	-123	-179.8	172.9	72.6	16	0	0	0	112.6	L43 L44 N45	D41-L43 PolarHBondContact O-N 3.17Å; D41-L43 WeakPolarHBondContact OD1-CA 3.45Å; D41-L43 WeakPolarHBondContact OD1-CB 3.26Å; D41-L43 PolarHBondContact OD1-N 3.31Å; D41-L44 PolarHBondContact O-N 2.78Å; D41-L44 VanDerWaalsContact O-N 3.09Å; D41-L44 PolarHBondContact OD1-N 2.99Å; D41-L44 VanDerWaalsContact OD1-N 3.17Å; D41-N45 PolarHBondContact N-O 3.31Å; D41-N45 VanDerWaalsContact N-O 3.17Å; D41-N45 PolarHBondContact OD1-N 2.94Å; D41-N45 PolarHBondContact OD1-ND2 2.77Å; D41-N45 WeakPolarHBondContact OD2-CB 3.3Å; D41-N45 PolarHBondContact OD2-ND2 3.3Å
42	Q	91.3	Very high	97	Very high	161 Å²	161	47.3 Å²	47.3	75%	0.752	25%	0.251	S	S	*	.	T	Hydrogen-bonded Turn	trans	-68.5	-14.3	-179.3	-68.5	172.1	39.3	0	0	113.9	L44	Q42-L44 VanDerWaalsContact C-N 3.31Å
43	L	92	Very high	97.1	Very high	128 Å²	128	46 Å²	46	67%	0.67	24%	0.244	S	C	*	.	T	Hydrogen-bonded Turn	trans	-94.4	7.3	175.6	-59.5	-179.7	0	0	0	111.7	D41 N45 G78	D41-L43 PolarHBondContact O-N 3.17Å; D41-L43 WeakPolarHBondContact OD1-CA 3.45Å; D41-L43 WeakPolarHBondContact OD1-CB 3.26Å; D41-L43 PolarHBondContact OD1-N 3.31Å; L43-N45 PolarHBondContact O-N 3.21Å; L43-G78 WeakPolarHBondContact O-CA 3.27Å
44	L	94.8	Very high	96.9	Very high	41 Å²	41	46.9 Å²	46.9	22%	0.215	25%	0.25	C	S	.	.			trans	59.9	28.4	-174	-56	174.4	0	0	0	112.9	I13 L15 D41 Q42 G78 I81	I13-L44 HydrophobicContact CD1-CD1 4.41Å; L15-L44 HydrophobicContact CD1-CD2 4.08Å; D41-L44 PolarHBondContact O-N 2.78Å; D41-L44 VanDerWaalsContact O-N 3.09Å; D41-L44 PolarHBondContact OD1-N 2.99Å; D41-L44 VanDerWaalsContact OD1-N 3.17Å; Q42-L44 VanDerWaalsContact C-N 3.31Å; L44-G78 WeakPolarHBondContact O-CA 3.27Å; L44-I81 VanDerWaalsContact O-CD1 3.28Å; L44-I81 WeakPolarHBondContact O-CD1 3.41Å
45	N	97.1	Very high	96.4	Very high	29 Å²	29	47.7 Å²	47.7	16%	0.155	25%	0.25	C	C	.	.			trans	-69.8	133.6	162.8	-57.8	-57.3	0	0	0	108.1	F40 D41 L43 A76 G78	F40-N45 WeakPolarHBondContact CA-O 3.35Å; D41-N45 PolarHBondContact N-O 3.31Å; D41-N45 VanDerWaalsContact N-O 3.17Å; D41-N45 PolarHBondContact OD1-N 2.94Å; D41-N45 PolarHBondContact OD1-ND2 2.77Å; D41-N45 WeakPolarHBondContact OD2-CB 3.3Å; D41-N45 PolarHBondContact OD2-ND2 3.3Å; L43-N45 PolarHBondContact O-N 3.21Å; N45-A76 CarbonylContact C-O 3.5Å; N45-A76 VanDerWaalsContact CA-O 3.26Å; N45-A76 WeakPolarHBondContact CA-O 3.42Å; N45-G78 PolarHBondContact OD1-N 3.42Å
46	L	98.3	Very high	95.4	Very high	0 Å²	0	52.1 Å²	52.1	0%	0	27%	0.269	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116	141	-176.4	-44.1	177.5	0	0	0	110	L15 I23 V25 L37 F40 L48 V75 A76 I81 I84	L15-L46 HydrophobicContact CD1-CD2 3.64Å; I23-L46 HydrophobicContact CD1-CD1 4.23Å; V25-L46 HydrophobicContact CG1-CD1 4.42Å; V25-L46 HydrophobicContact CG2-CD1 3.87Å; L37-L46 HydrophobicContact CD1-CB 4.02Å; L37-L46 HydrophobicContact CD1-CD2 4.14Å; L37-L46 HydrophobicContact CD1-CG 4.49Å; F40-L46 HydrophobicContact CB-CD2 3.74Å; L46-L48 HydrophobicContact CB-CD2 3.99Å; L46-L48 HydrophobicContact CB-CG 4.23Å; L46-L48 HydrophobicContact CD1-CD2 4.41Å; L46-V75 CarbonylContact O-C 3.6Å; L46-V75 VanDerWaalsContact O-CA 3.31Å; L46-V75 WeakPolarHBondContact O-CA 3.47Å; L46-A76 HydrophobicContact CB-CB 4.08Å; L46-A76 HydrophobicContact CG-CB 4.47Å; L46-A76 PolarHBondContact N-O 3.49Å; L46-A76 PolarHBondContact O-N 2.91Å; L46-I81 HydrophobicContact CD1-CD1 3.71Å; L46-I81 HydrophobicContact CG-CD1 3.78Å; L46-I84 HydrophobicContact CD1-CD1 4Å; L46-I84 HydrophobicContact CD1-CG1 4.29Å; L46-I84 HydrophobicContact CD2-CD1 4.28Å
47	V	98.6	Very high	94	Very high	55 Å²	55	54.7 Å²	54.7	33%	0.333	28%	0.283	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.5	115.6	164.9	-176.5	0	0	0	0	106.9	K38 G39 L73	K38-V47 HydrophobicContact CB-CB 4.3Å; K38-V47 HydrophobicContact CB-CG1 4.05Å; K38-V47 PolarHBondContact N-O 2.91Å; G39-V47 PolarHBondContact O-N 2.92Å; V47-L73 HydrophobicContact CG1-CD1 3.79Å
48	L	98.7	Very high	92.3	Very high	0 Å²	0	59.8 Å²	59.8	0%	0	33%	0.325	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116	130.7	-179.6	-54.4	-177.4	0	0	0	109.9	I23 V25 V33 I36 L37 L46 T51 L73 I74	I23-L48 HydrophobicContact CD1-CD2 3.74Å; I23-L48 HydrophobicContact CG1-CD2 4.1Å; V25-L48 HydrophobicContact CG2-CD1 4.09Å; V33-L48 HydrophobicContact CG2-CD1 3.96Å; I36-L48 WeakPolarHBondContact O-CA 3.26Å; L37-L48 HydrophobicContact CB-CD2 4.37Å; L37-L48 HydrophobicContact CD1-CD2 3.85Å; L46-L48 HydrophobicContact CB-CD2 3.99Å; L46-L48 HydrophobicContact CB-CG 4.23Å; L46-L48 HydrophobicContact CD1-CD2 4.41Å; L48-T51 VanDerWaalsContact CB-OG1 3.23Å; L48-T51 WeakPolarHBondContact CB-OG1 3.41Å; L48-T51 PolarHBondContact O-OG1 3.23Å; L48-L73 CarbonylContact O-C 3.57Å; L48-L73 WeakPolarHBondContact O-CA 3.28Å; L48-I74 HydrophobicContact CB-CG1 3.94Å; L48-I74 HydrophobicContact CD1-CD1 4.37Å; L48-I74 PolarHBondContact N-O 2.84Å; L48-I74 PolarHBondContact O-N 2.89Å
49	D	98.5	Very high	90.5	Very high	49 Å²	49	61 Å²	61	26%	0.262	34%	0.336	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.4	156.4	175.9	-165.5	14.4	0	0	0	110.9	I36 K38 T51 L73	I36-D49 PolarHBondContact N-O 3.48Å; I36-D49 PolarHBondContact O-N 2.93Å; K38-D49 HydrophobicContact CD-CB 4.24Å; K38-D49 HydrophobicContact CG-CB 3.61Å; D49-T51 PolarHBondContact O-N 3.09Å; D49-L73 HydrophobicContact CB-CD1 4.14Å
50	N	98.1	Very high	88.6	Confident	102 Å²	102	68.2 Å²	68.2	55%	0.545	37%	0.365	S	S	.	.	E	Extended strand (participates in β ladder)	trans	49.5	42	-174.5	-62.7	-39.6	0	0	0	113.3	G72	N50-G72 PolarHBondContact N-O 2.91Å
51	T	98.4	Very high	86.5	Confident	0 Å²	0	69.7 Å²	69.7	0%	0	38%	0.384	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.1	129.9	-171.3	-53.6	0	0	0	0	111.8	V33 S34 L48 D49 N70 L71 G72 I74	V33-T51 HydrophobicContact CB-CG2 3.79Å; V33-T51 HydrophobicContact CG1-CG2 4.34Å; V33-T51 HydrophobicContact CG2-CG2 4.14Å; S34-T51 CarbonylContact O-C 3.59Å; S34-T51 VanDerWaalsContact O-CA 3.28Å; S34-T51 WeakPolarHBondContact O-CA 3.28Å; L48-T51 VanDerWaalsContact CB-OG1 3.23Å; L48-T51 WeakPolarHBondContact CB-OG1 3.41Å; L48-T51 PolarHBondContact O-OG1 3.23Å; D49-T51 PolarHBondContact O-N 3.09Å; T51-N70 PolarHBondContact O-OD1 2.8Å; T51-N70 VanDerWaalsContact O-OD1 3.08Å; T51-L71 HydrophobicContact CG2-CD1 4.48Å; T51-L71 PolarHBondContact O-N 2.82Å; T51-G72 VanDerWaalsContact CB-O 3.27Å; T51-G72 WeakPolarHBondContact CB-O 3.46Å; T51-G72 PolarHBondContact N-O 2.87Å; T51-G72 PolarHBondContact O-N 3.23Å; T51-G72 PolarHBondContact OG1-O 2.82Å; T51-G72 VanDerWaalsContact OG1-O 3.11Å; T51-I74 HydrophobicContact CG2-CD1 3.74Å; T51-I74 HydrophobicContact CG2-CG1 4.04Å
52	T	97.7	Very high	84.7	Confident	49 Å²	49	67.5 Å²	67.5	30%	0.301	38%	0.375	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.6	129.7	170.8	-60	0	0	0	0	109.5	V33 S34 T68 R69	V33-T52 CarbonylContact C-O 3.54Å; V33-T52 VanDerWaalsContact CA-O 3.27Å; V33-T52 WeakPolarHBondContact CA-O 3.09Å; S34-T52 PolarHBondContact N-O 3.27Å; S34-T52 PolarHBondContact O-N 3.17Å; T52-T68 HydrophobicContact CG2-CG2 4.18Å; T52-R69 CarbonylContact C-O 3.22Å; T52-R69 WeakPolarHBondContact CA-O 3.33Å
53	E	96.8	Very high	83.2	Confident	8 Å²	8	66.7 Å²	66.7	4%	0.037	37%	0.371	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.2	132.2	172.4	177.6	172.1	-164.6	0	0	110.7	R31 E32 V33 M55 T68 R69 L71	R31-E53 IonicContact CZ-OE1 3.24Å; R31-E53 VanDerWaalsContact CZ-OE1 3.24Å; R31-E53 IonicContact NE-OE1 2.73Å; R31-E53 PolarHBondContact NE-OE1 2.83Å; R31-E53 VanDerWaalsContact NH2-CD 3.3Å; R31-E53 IonicContact NH2-OE1 2.9Å; R31-E53 PolarHBondContact NH2-OE1 3.02Å; R31-E53 IonicContact NH2-OE2 3Å; R31-E53 PolarHBondContact NH2-OE2 2.96Å; E32-E53 WeakPolarHBondContact O-CA 3.33Å; V33-E53 HydrophobicContact CG1-CB 3.93Å; V33-E53 HydrophobicContact CG1-CG 4.13Å; E53-M55 HydrophobicContact CG-CG 4.41Å; E53-T68 CarbonylContact O-C 3.51Å; E53-T68 VanDerWaalsContact O-CA 3.26Å; E53-T68 WeakPolarHBondContact O-CA 3.31Å; E53-R69 HydrophobicContact CB-CG 3.91Å; E53-R69 PolarHBondContact N-O 3.02Å; E53-R69 PolarHBondContact O-N 3Å; E53-R69 IonicContact OE1-NH2 3.5Å; E53-R69 PolarHBondContact OE1-NH2 2.83Å; E53-R69 IonicContact OE2-CZ 3.08Å; E53-R69 IonicContact OE2-NE 2.72Å; E53-R69 PolarHBondContact OE2-NE 2.81Å; E53-R69 IonicContact OE2-NH2 2.65Å; E53-R69 PolarHBondContact OE2-NH2 2.99Å; E53-L71 HydrophobicContact CB-CD1 3.94Å; E53-L71 HydrophobicContact CB-CG 4.39Å
54	T	93.5	Very high	81.9	Confident	22 Å²	22	64.5 Å²	64.5	14%	0.135	37%	0.372	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.9	117.1	171.1	-51.6	0	0	0	0	108.3	E32 P66	E32-T54 PolarHBondContact O-N 2.78Å; T54-P66 HydrophobicContact CG2-CB 3.51Å; T54-P66 HydrophobicContact CG2-CG 3.64Å
55	M	87.2	Confident	80.6	Confident	61 Å²	61	69.5 Å²	69.5	30%	0.3	40%	0.398	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.2	118.6	178.1	-58.3	-178.8	-65.9	0	0	108.6	E53 A67 R69	E53-M55 HydrophobicContact CG-CG 4.41Å; M55-A67 WeakPolarHBondContact CA-O 3.49Å; M55-A67 HydrophobicContact CB-CB 4.47Å; M55-A67 VanDerWaalsContact CB-O 3.3Å; M55-A67 WeakPolarHBondContact CB-O 3.28Å; M55-A67 HydrophobicContact CE-CB 3.65Å; M55-A67 PolarHBondContact N-O 2.68Å; M55-A67 PolarHBondContact O-N 2.83Å; M55-R69 HydrophobicContact CE-CB 4.36Å; M55-R69 HydrophobicContact SD-CG 4.22Å
56	H	76	Confident	79.6	Confident	99 Å²	99	70.3 Å²	70.3	46%	0.458	41%	0.405	S	S	.	.			trans	-95.4	101.6	172.4	-61.8	-72.5	0	0	0	107.7
57	D	69.1	Low	79	Confident	99 Å²	99	72.3 Å²	72.3	53%	0.529	42%	0.422	S	S	.	.			trans	-67.5	149.5	167.9	-68.3	-38.1	0	0	0	109.1	D59 A62	D57-D59 PolarHBondContact O-N 3.39Å; D57-A62 HydrophobicContact CB-CB 3.76Å
58	A	63.7	Low	78.7	Confident	107 Å²	107	74.2 Å²	74.2	88%	0.884	43%	0.434	S	S	*	.	S	Bend	trans	-67.5	-15.7	-178.6	0	0	0	0	0	113.1
59	D	61.8	Low	78.6	Confident	114 Å²	114	79.6 Å²	79.6	61%	0.61	45%	0.454	S	S	*	.	S	Bend	trans	-78.2	121.8	178.7	-68.4	-30.2	0	0	0	109.9	D57 S61 A62	D57-D59 PolarHBondContact O-N 3.39Å; D59-S61 PolarHBondContact O-N 2.98Å; D59-A62 WeakPolarHBondContact O-CB 3.2Å; D59-A62 PolarHBondContact O-N 3.16Å
60	E	57.7	Low	78.5	Confident	169 Å²	169	83.2 Å²	83.2	79%	0.79	47%	0.474	S	S	*	.	G	3₁₀ helix	trans	-53.8	-23.4	178.9	-67	-176.7	161.5	0	0	113.1	A62 Q63	E60-A62 VanDerWaalsContact C-N 3.25Å; E60-A62 PolarHBondContact O-N 3.18Å; E60-Q63 PolarHBondContact O-N 3.1Å
61	S	53.3	Low	78.5	Confident	104 Å²	104	81.4 Å²	81.4	73%	0.727	46%	0.463	S	S	*	.	G	3₁₀ helix	trans	-66.5	-25.5	175.2	64.4	0	0	0	0	113.4	D59 Q63	D59-S61 PolarHBondContact O-N 2.98Å; S61-Q63 VanDerWaalsContact C-N 3.34Å
62	A	57.1	Low	78.5	Confident	20 Å²	20	82.4 Å²	82.4	17%	0.165	47%	0.474	C	S	.	.	G	3₁₀ helix	trans	-81.2	-12.6	179.2	0	0	0	0	0	113.2	D57 D59 E60 A64 N65	D57-A62 HydrophobicContact CB-CB 3.76Å; D59-A62 WeakPolarHBondContact O-CB 3.2Å; D59-A62 PolarHBondContact O-N 3.16Å; E60-A62 VanDerWaalsContact C-N 3.25Å; E60-A62 PolarHBondContact O-N 3.18Å; A62-A64 PolarHBondContact O-N 3.37Å; A62-N65 CarbonylContact O-C 3.46Å; A62-N65 PolarHBondContact O-N 3.18Å
63	Q	59.4	Low	78.5	Confident	145 Å²	145	85.8 Å²	85.8	68%	0.678	49%	0.49	S	S	*	.	G	3₁₀ helix	trans	-65.7	-24.8	178.2	-99.5	160.8	-5.5	0	0	113.3	E60 S61	E60-Q63 PolarHBondContact O-N 3.1Å; S61-Q63 VanDerWaalsContact C-N 3.34Å
64	A	63.5	Low	78.6	Confident	82 Å²	82	87.1 Å²	87.1	68%	0.678	50%	0.496	S	S	*	.	G	3₁₀ helix	trans	-72.2	-31.6	177.1	0	0	0	0	0	112.7	A62	A62-A64 PolarHBondContact O-N 3.37Å
65	N	68.6	Low	78.8	Confident	145 Å²	145	90.9 Å²	90.9	78%	0.775	52%	0.519	S	S	*	.	S	Bend	trans	-145	78.1	-178.1	-76	-42.3	0	0	0	109.3	A62 A67	A62-N65 CarbonylContact O-C 3.46Å; A62-N65 PolarHBondContact O-N 3.18Å; N65-A67 PolarHBondContact O-N 3.25Å
66	P	76	Confident	79.3	Confident	47 Å²	47	88.1 Å²	88.1	31%	0.305	51%	0.506	S	S	.	.			trans	-63.6	133.7	-179	27.8	-34.5	0	0	0	109.5	T54 T68	T54-P66 HydrophobicContact CG2-CB 3.51Å; T54-P66 HydrophobicContact CG2-CG 3.64Å; P66-T68 PolarHBondContact O-N 3.43Å
67	A	86.4	Confident	80.4	Confident	42 Å²	42	90.8 Å²	90.8	35%	0.347	51%	0.512	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-67.2	130.6	-179.9	0	0	0	0	0	109.8	M55 N65	M55-A67 WeakPolarHBondContact CA-O 3.49Å; M55-A67 HydrophobicContact CB-CB 4.47Å; M55-A67 VanDerWaalsContact CB-O 3.3Å; M55-A67 WeakPolarHBondContact CB-O 3.28Å; M55-A67 HydrophobicContact CE-CB 3.65Å; M55-A67 PolarHBondContact N-O 2.68Å; M55-A67 PolarHBondContact O-N 2.83Å; N65-A67 PolarHBondContact O-N 3.25Å
68	T	92.2	Very high	81.6	Confident	95 Å²	95	86.6 Å²	86.6	58%	0.583	49%	0.492	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-105.8	144.7	178.3	60	0	0	0	0	111.6	T52 E53 P66	T52-T68 HydrophobicContact CG2-CG2 4.18Å; E53-T68 CarbonylContact O-C 3.51Å; E53-T68 VanDerWaalsContact O-CA 3.26Å; E53-T68 WeakPolarHBondContact O-CA 3.31Å; P66-T68 PolarHBondContact O-N 3.43Å
69	R	94.9	Very high	83.2	Confident	113 Å²	113	86.6 Å²	86.6	43%	0.426	48%	0.478	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.5	139.7	168.9	67.4	177.2	-176.8	-170.6	-3.3	112.2	T52 E53 M55 L71	T52-R69 CarbonylContact C-O 3.22Å; T52-R69 WeakPolarHBondContact CA-O 3.33Å; E53-R69 HydrophobicContact CB-CG 3.91Å; E53-R69 PolarHBondContact N-O 3.02Å; E53-R69 PolarHBondContact O-N 3Å; E53-R69 IonicContact OE1-NH2 3.5Å; E53-R69 PolarHBondContact OE1-NH2 2.83Å; E53-R69 IonicContact OE2-CZ 3.08Å; E53-R69 IonicContact OE2-NE 2.72Å; E53-R69 PolarHBondContact OE2-NE 2.81Å; E53-R69 IonicContact OE2-NH2 2.65Å; E53-R69 PolarHBondContact OE2-NH2 2.99Å; M55-R69 HydrophobicContact CE-CB 4.36Å; M55-R69 HydrophobicContact SD-CG 4.22Å; R69-L71 HydrophobicContact CG-CD2 4.27Å
70	N	97.3	Very high	84.9	Confident	125 Å²	125	83.2 Å²	83.2	67%	0.668	46%	0.461	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-81.8	132.9	175.6	-171.1	7.3	0	0	0	110.4	T51 G72	T51-N70 PolarHBondContact O-OD1 2.8Å; T51-N70 VanDerWaalsContact O-OD1 3.08Å; N70-G72 PolarHBondContact OD1-N 2.87Å
71	L	97.9	Very high	86.8	Confident	63 Å²	63	76.5 Å²	76.5	33%	0.33	43%	0.43	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.2	-13	178	-58.7	180	0	0	0	112.7	T51 E53 R69 L73 I74	T51-L71 HydrophobicContact CG2-CD1 4.48Å; T51-L71 PolarHBondContact O-N 2.82Å; E53-L71 HydrophobicContact CB-CD1 3.94Å; E53-L71 HydrophobicContact CB-CG 4.39Å; R69-L71 HydrophobicContact CG-CD2 4.27Å; L71-L73 PolarHBondContact O-N 3.11Å; L71-I74 HydrophobicContact CB-CG2 3.63Å; L71-I74 HydrophobicContact CD1-CG2 4.37Å
72	G	98.1	Very high	88.8	Confident	22 Å²	22	77.2 Å²	77.2	23%	0.227	43%	0.425	C	S	.	.	E	Extended strand (participates in β ladder)	trans	66.8	-128.6	-177.6	0	0	0	0	0	112.7	N50 T51 N70	N50-G72 PolarHBondContact N-O 2.91Å; T51-G72 VanDerWaalsContact CB-O 3.27Å; T51-G72 WeakPolarHBondContact CB-O 3.46Å; T51-G72 PolarHBondContact N-O 2.87Å; T51-G72 PolarHBondContact O-N 3.23Å; T51-G72 PolarHBondContact OG1-O 2.82Å; T51-G72 VanDerWaalsContact OG1-O 3.11Å; N70-G72 PolarHBondContact OD1-N 2.87Å
73	L	98.5	Very high	90.7	Very high	120 Å²	120	79.5 Å²	79.5	63%	0.628	44%	0.437	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-85.1	118.8	178.9	-178.1	67.5	0	0	0	110.4	V47 L48 D49 L71	V47-L73 HydrophobicContact CG1-CD1 3.79Å; L48-L73 CarbonylContact O-C 3.57Å; L48-L73 WeakPolarHBondContact O-CA 3.28Å; D49-L73 HydrophobicContact CB-CD1 4.14Å; L71-L73 PolarHBondContact O-N 3.11Å
74	I	98.4	Very high	92.4	Very high	35 Å²	35	74.5 Å²	74.5	18%	0.179	42%	0.415	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.6	160.7	179.3	73	159.4	0	0	0	112.5	L48 T51 L71	L48-I74 HydrophobicContact CB-CG1 3.94Å; L48-I74 HydrophobicContact CD1-CD1 4.37Å; L48-I74 PolarHBondContact N-O 2.84Å; L48-I74 PolarHBondContact O-N 2.89Å; T51-I74 HydrophobicContact CG2-CD1 3.74Å; T51-I74 HydrophobicContact CG2-CG1 4.04Å; L71-I74 HydrophobicContact CB-CG2 3.63Å; L71-I74 HydrophobicContact CD1-CG2 4.37Å
75	V	98.3	Very high	94	Very high	102 Å²	102	71.8 Å²	71.8	62%	0.618	39%	0.392	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-109.3	114.4	162.9	-179.1	0	0	0	0	108.7	L46	L46-V75 CarbonylContact O-C 3.6Å; L46-V75 VanDerWaalsContact O-CA 3.31Å; L46-V75 WeakPolarHBondContact O-CA 3.47Å
76	A	97.9	Very high	95.3	Very high	3 Å²	3	67.7 Å²	67.7	3%	0.025	37%	0.373	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.5	133	172.9	0	0	0	0	0	110.1	F27 N45 L46 I81	F27-A76 HydrophobicContact CE1-CB 3.9Å; F27-A76 HydrophobicContact CZ-CB 3.77Å; N45-A76 CarbonylContact C-O 3.5Å; N45-A76 VanDerWaalsContact CA-O 3.26Å; N45-A76 WeakPolarHBondContact CA-O 3.42Å; L46-A76 HydrophobicContact CB-CB 4.08Å; L46-A76 HydrophobicContact CG-CB 4.47Å; L46-A76 PolarHBondContact N-O 3.49Å; L46-A76 PolarHBondContact O-N 2.91Å; A76-I81 HydrophobicContact CB-CD1 4.26Å
77	R	97.6	Very high	96.2	Very high	154 Å²	154	67 Å²	67	58%	0.581	37%	0.372	S	S	*	.			trans	-84.4	116.9	-178.1	-74.9	-72.5	-59.9	-165.7	-1.9	110.8	N79 T80 I81	R77-N79 PolarHBondContact NE-OD1 3.5Å; R77-N79 PolarHBondContact NH2-OD1 2.79Å; R77-N79 PolarHBondContact O-N 2.83Å; R77-N79 VanDerWaalsContact O-N 3.16Å; R77-T80 PolarHBondContact O-N 2.88Å; R77-T80 VanDerWaalsContact O-N 3.1Å; R77-T80 PolarHBondContact O-OG1 3.08Å; R77-I81 WeakPolarHBondContact O-CG1 3.23Å
78	G	96.2	Very high	96.5	Very high	11 Å²	11	71.9 Å²	71.9	11%	0.113	39%	0.392	C	S	.	.	G	3₁₀ helix	trans	-61	-28.5	-174.2	0	0	0	0	0	114.8	L43 L44 N45 T80 I81	L43-G78 WeakPolarHBondContact O-CA 3.27Å; L44-G78 WeakPolarHBondContact O-CA 3.27Å; N45-G78 PolarHBondContact OD1-N 3.42Å; G78-T80 PolarHBondContact O-N 3.02Å; G78-T80 VanDerWaalsContact O-N 3.16Å; G78-I81 PolarHBondContact O-N 3.4Å
79	N	96.7	Very high	96.4	Very high	108 Å²	108	70.8 Å²	70.8	58%	0.578	40%	0.399	S	S	*	.	G	3₁₀ helix	trans	-67.6	-13.5	178.7	70.5	-77.5	0	0	0	114.5	R77	R77-N79 PolarHBondContact NE-OD1 3.5Å; R77-N79 PolarHBondContact NH2-OD1 2.79Å; R77-N79 PolarHBondContact O-N 2.83Å; R77-N79 VanDerWaalsContact O-N 3.16Å
80	T	96.9	Very high	96.2	Very high	42 Å²	42	69.8 Å²	69.8	26%	0.258	40%	0.401	S	S	.	.	G	3₁₀ helix	trans	-111.6	-0.6	177.8	56.7	0	0	0	0	112.8	F27 Q28 R77 G78	F27-T80 CarbonylContact C-O 3.6Å; F27-T80 WeakPolarHBondContact CA-O 3.47Å; Q28-T80 PolarHBondContact N-O 2.84Å; R77-T80 PolarHBondContact O-N 2.88Å; R77-T80 VanDerWaalsContact O-N 3.1Å; R77-T80 PolarHBondContact O-OG1 3.08Å; G78-T80 PolarHBondContact O-N 3.02Å; G78-T80 VanDerWaalsContact O-N 3.16Å
81	I	97	Very high	95.8	Very high	28 Å²	28	71.5 Å²	71.5	14%	0.144	41%	0.405	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.5	130.2	-177.7	-65.4	175.3	0	0	0	109.3	V25 F27 L44 L46 A76 R77 G78 I84	V25-I81 HydrophobicContact CG1-CD1 4.2Å; V25-I81 HydrophobicContact CG1-CG1 4.01Å; V25-I81 HydrophobicContact CG1-CG2 3.91Å; F27-I81 HydrophobicContact CD1-CG1 3.91Å; F27-I81 HydrophobicContact CE1-CD1 4.39Å; F27-I81 HydrophobicContact CE1-CG1 3.63Å; L44-I81 VanDerWaalsContact O-CD1 3.28Å; L44-I81 WeakPolarHBondContact O-CD1 3.41Å; L46-I81 HydrophobicContact CD1-CD1 3.71Å; L46-I81 HydrophobicContact CG-CD1 3.78Å; A76-I81 HydrophobicContact CB-CD1 4.26Å; R77-I81 WeakPolarHBondContact O-CG1 3.23Å; G78-I81 PolarHBondContact O-N 3.4Å; I81-I84 HydrophobicContact CG2-CD1 4.08Å; I81-I84 HydrophobicContact CG2-CG1 3.66Å
82	L	96.7	Very high	95.3	Very high	120 Å²	120	78 Å²	78	63%	0.628	43%	0.433	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-104.3	-41.6	175.6	-63.2	179.9	0	0	0	111.9	K26 Q28	K26-L82 PolarHBondContact O-N 3.12Å; Q28-L82 HydrophobicContact CB-CD1 4.47Å; Q28-L82 HydrophobicContact CB-CG 4.45Å
83	V	96	Very high	94.9	Very high	68 Å²	68	81.9 Å²	81.9	41%	0.412	45%	0.448	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-137	138.2	-175.8	-177.3	0	0	0	0	109.6	V25 K26 A85	V25-V83 WeakPolarHBondContact CA-O 3.27Å; K26-V83 HydrophobicContact CB-CB 4.08Å; K26-V83 HydrophobicContact CB-CG2 4.41Å; K26-V83 HydrophobicContact CG-CB 4.28Å; K26-V83 PolarHBondContact N-O 2.65Å; K26-V83 PolarHBondContact O-N 2.72Å; V83-A85 HydrophobicContact CG1-CB 4.31Å
84	I	96.3	Very high	94.5	Very high	40 Å²	40	82.3 Å²	82.3	21%	0.205	46%	0.455	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.4	122.2	166.5	-56.7	171.5	0	0	0	106.2	L15 L18 I23 L46 I81	L15-I84 HydrophobicContact CD1-CD1 3.92Å; L15-I84 HydrophobicContact CD2-CD1 4.15Å; L15-I84 HydrophobicContact CD2-CG2 4.09Å; L18-I84 HydrophobicContact CD1-CG2 4.21Å; I23-I84 HydrophobicContact CD1-CG2 3.98Å; L46-I84 HydrophobicContact CD1-CD1 4Å; L46-I84 HydrophobicContact CD1-CG1 4.29Å; L46-I84 HydrophobicContact CD2-CD1 4.28Å; I81-I84 HydrophobicContact CG2-CD1 4.08Å; I81-I84 HydrophobicContact CG2-CG1 3.66Å
85	A	95.9	Very high	94.1	Very high	24 Å²	24	85.2 Å²	85.2	20%	0.198	47%	0.471	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.2	145.3	179.8	0	0	0	0	0	111.6	I23 V24 V83 A87 M90	I23-A85 CarbonylContact C-O 3.56Å; I23-A85 VanDerWaalsContact CA-O 3.3Å; I23-A85 WeakPolarHBondContact CA-O 2.87Å; I23-A85 WeakPolarHBondContact CB-O 3.39Å; V24-A85 PolarHBondContact N-O 3.5Å; V24-A85 PolarHBondContact O-N 3Å; V83-A85 HydrophobicContact CG1-CB 4.31Å; A85-A87 PolarHBondContact O-N 2.73Å; A85-M90 HydrophobicContact CB-CE 3.27Å; A85-M90 HydrophobicContact CB-SD 4.3Å; A85-M90 VanDerWaalsContact O-CE 3.27Å; A85-M90 WeakPolarHBondContact O-CE 3.3Å
86	P	96.6	Very high	93.7	Very high	59 Å²	59	84.6 Å²	84.6	38%	0.383	47%	0.469	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-67.1	130.2	177.6	28.1	-33.6	0	0	0	110.4	L18 D88 M90	L18-P86 HydrophobicContact CD2-CB 4.04Å; P86-D88 PolarHBondContact O-N 3.23Å; P86-M90 WeakPolarHBondContact O-CE 3.43Å; P86-M90 WeakPolarHBondContact O-CG 3.26Å
87	A	95	Very high	93.3	Very high	33 Å²	33	93.1 Å²	93.1	27%	0.273	51%	0.506	S	S	.	.	S	Bend	trans	-65.5	-26.7	177.7	0	0	0	0	0	112.4	P22 V24 A85 G89 M90	P22-A87 HydrophobicContact CB-CB 3.83Å; P22-A87 HydrophobicContact CG-CB 4.09Å; P22-A87 WeakPolarHBondContact O-CB 3.4Å; P22-A87 PolarHBondContact O-N 2.9Å; V24-A87 HydrophobicContact CG2-CB 4.25Å; A85-A87 PolarHBondContact O-N 2.73Å; A87-G89 PolarHBondContact O-N 3.32Å; A87-M90 PolarHBondContact O-N 3.35Å
88	D	92.2	Very high	92.8	Very high	144 Å²	144	89.2 Å²	89.2	77%	0.77	50%	0.499	S	S	*	.	T	Hydrogen-bonded Turn	trans	-66.1	127.7	174.1	-170.6	23.1	0	0	0	111	P86 M90	P86-D88 PolarHBondContact O-N 3.23Å; D88-M90 VanDerWaalsContact C-N 3.3Å; D88-M90 PolarHBondContact O-N 3.28Å
89	G	90.4	Very high	92.1	Very high	72 Å²	72	94.2 Å²	94.2	74%	0.742	52%	0.52	S	S	*	.	T	Hydrogen-bonded Turn	trans	78.5	1.9	-174.5	0	0	0	0	0	115.6	A87	A87-G89 PolarHBondContact O-N 3.32Å
90	M	90.2	Very high	90.9	Very high	92 Å²	92	94.8 Å²	94.8	45%	0.453	53%	0.529	S	S	.	.			trans	-84.1	121.9	168.7	-77.8	-160.5	-115.8	0	0	110.7	V24 A85 P86 A87 D88	V24-M90 HydrophobicContact CB-CE 3.73Å; V24-M90 HydrophobicContact CB-SD 4.42Å; V24-M90 HydrophobicContact CG2-CE 3.6Å; V24-M90 HydrophobicContact CG2-SD 4.13Å; A85-M90 HydrophobicContact CB-CE 3.27Å; A85-M90 HydrophobicContact CB-SD 4.3Å; A85-M90 VanDerWaalsContact O-CE 3.27Å; A85-M90 WeakPolarHBondContact O-CE 3.3Å; P86-M90 WeakPolarHBondContact O-CE 3.43Å; P86-M90 WeakPolarHBondContact O-CG 3.26Å; A87-M90 PolarHBondContact O-N 3.35Å; D88-M90 VanDerWaalsContact C-N 3.3Å; D88-M90 PolarHBondContact O-N 3.28Å
91	E	89.9	Confident	89.8	Confident	161 Å²	161	100 Å²	100	75%	0.752	56%	0.555	S	S	*	*			trans	-136.2	146.2	173.6	61.7	177.9	-173.8	0	0	111.1	I93	E91-I93 HydrophobicContact CG-CG2 3.88Å; E91-I93 PolarHBondContact O-N 3.44Å
92	Q	87.7	Confident	88.2	Confident	199 Å²	199	105.6 Å²	105.6	93%	0.93	58%	0.583	S	S	*	*			trans	-76.4	118.9	169.7	-177.5	176.8	-2.5	0	0	108.5
93	I	89.5	Confident	86.2	Confident	105 Å²	105	106.9 Å²	106.9	54%	0.538	61%	0.611	S	S	.	*			trans	-106.4	154.4	176.9	63.2	171.8	0	0	0	110.8	E91 P96	E91-I93 HydrophobicContact CG-CG2 3.88Å; E91-I93 PolarHBondContact O-N 3.44Å; I93-P96 HydrophobicContact CD1-CG 4.31Å
94	V	88.8	Confident	85.7	Confident	129 Å²	129	108.8 Å²	108.8	78%	0.782	62%	0.62	S	S	*	*			trans	-64.6	159.6	162.7	-63.4	0	0	0	0	109.8	P96	V94-P96 VanDerWaalsContact O-CD 3.26Å; V94-P96 WeakPolarHBondContact O-CD 3.49Å
95	N	89.9	Confident	85.1	Confident	95 Å²	95	112.4 Å²	112.4	51%	0.508	64%	0.642	S	S	.	*			trans	-57.4	114.3	177.1	-178.6	-18.1	0	0	0	110.2	F97 V98	N95-F97 PolarHBondContact O-N 3.39Å; N95-F97 VanDerWaalsContact O-N 3.11Å; N95-F97 WeakPolarHBondContact OD1-CD2 3.37Å; N95-F97 PolarHBondContact OD1-N 2.79Å; N95-V98 HydrophobicContact CB-CG2 3.87Å; N95-V98 PolarHBondContact O-N 3.37Å
96	P	90.4	Very high	84.5	Confident	90 Å²	90	117.3 Å²	117.3	58%	0.584	67%	0.667	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.6	-2.4	-171.9	31.7	-36.6	0	0	0	113.7	I93 V94	I93-P96 HydrophobicContact CD1-CG 4.31Å; V94-P96 VanDerWaalsContact O-CD 3.26Å; V94-P96 WeakPolarHBondContact O-CD 3.49Å
97	F	89.5	Confident	83.8	Confident	181 Å²	181	120.8 Å²	120.8	79%	0.794	68%	0.684	S	S	*	*	T	Hydrogen-bonded Turn	trans	-102	-8.6	179.2	-55.2	-73.5	0	0	0	113.4	N95 Q99	N95-F97 PolarHBondContact O-N 3.39Å; N95-F97 VanDerWaalsContact O-N 3.11Å; N95-F97 WeakPolarHBondContact OD1-CD2 3.37Å; N95-F97 PolarHBondContact OD1-N 2.79Å; F97-Q99 PolarHBondContact O-N 2.97Å
98	V	87.1	Confident	83.1	Confident	73 Å²	73	126.3 Å²	126.3	44%	0.442	71%	0.709	S	S	.	*	S	Bend	trans	-76.8	116.4	173	179.5	0	0	0	0	107.3	N95 A103	N95-V98 HydrophobicContact CB-CG2 3.87Å; N95-V98 PolarHBondContact O-N 3.37Å; V98-A103 HydrophobicContact CG1-CB 4.44Å
99	Q	81.1	Confident	82.5	Confident	116 Å²	116	125.1 Å²	125.1	54%	0.542	71%	0.705	S	S	.	*			trans	-60.7	137.4	172.7	-67.3	179.3	6.9	0	0	108.3	F97 D101 M102	F97-Q99 PolarHBondContact O-N 2.97Å; Q99-D101 PolarHBondContact O-N 2.87Å; Q99-M102 HydrophobicContact CB-CG 4.4Å; Q99-M102 PolarHBondContact O-N 3.22Å
100	P	73.2	Confident	82	Confident	119 Å²	119	128.9 Å²	128.9	77%	0.773	70%	0.703	S	S	*	*	G	3₁₀ helix	trans	-52.5	-26	-179.2	-26.2	33.3	0	0	0	113.7
101	D	71.9	Confident	81.3	Confident	151 Å²	151	131.7 Å²	131.7	81%	0.807	72%	0.722	S	S	*	*	G	3₁₀ helix	trans	-89.9	3	-175.6	-53.7	-27.6	0	0	0	114	Q99	Q99-D101 PolarHBondContact O-N 2.87Å
102	M	63.6	Low	80.6	Confident	147 Å²	147	129.3 Å²	129.3	72%	0.724	72%	0.719	S	S	*	*	G	3₁₀ helix	trans	-115.3	12.6	-179.8	-67.7	-163.2	-179.8	0	0	114.4	Q99	Q99-M102 HydrophobicContact CB-CG 4.4Å; Q99-M102 PolarHBondContact O-N 3.22Å
103	A	54.9	Low	80	Confident	146 Å²	146	122.9 Å²	122.9	100%	1.207	70%	0.7	S	S	*	*			trans	-105	0	174.9	0	0	0	0	0	112.4	V98	V98-A103 HydrophobicContact CG1-CB 4.44Å

Retrieved 103 of 103 residues in 145.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).