A0A077ZLG7_TRITR Loading...

SURF1-like protein

Probably involved in the biogenesis of the COX complex.

AlphaFold DB , UniProt , Accession A0A077ZLG7, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 111 aa.

						>A0A077ZLG7_TRITR|A0A077ZLG7
MRFLVNLDPSSGSFVKCSVGHSGSAQSRTLEGEVEVIGVNRLNEKRPPFVMKNDPVRNMWFYRDVNAMAALHNTAPVYLEADAVSTVDGGPLGGQTNVQIPDNHTAYIVTW
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	51.2	Low	47.2	Very low	160 Å²	160	91.5 Å²	91.5	79%	0.788	49%	0.486	S	S	*	.				0	140.7	0	-163.5	174	-161.5	0	0	106.3	F3 G38	M1-F3 HydrophobicContact CB-CD2 4.37Å; M1-F3 HydrophobicContact CB-CE2 3.61Å; M1-F3 HydrophobicContact CB-CZ 4.07Å; M1-F3 HydrophobicContact CG-CE2 3.89Å; M1-F3 HydrophobicContact CG-CZ 3.85Å; M1-F3 WeakPolarHBondContact O-CD2 3.35Å; M1-F3 HydrophobicContact SD-CE1 4.46Å; M1-F3 HydrophobicContact SD-CE2 4.11Å; M1-F3 HydrophobicContact SD-CZ 3.57Å; M1-F3 VanDerWaalsContact SD-CZ 3.57Å; M1-G38 PolarHBondContact N-O 3.08Å; M1-G38 PolarHBondContact O-N 2.73Å
2	R	47.9	Very low	46.8	Very low	196 Å²	196	84.9 Å²	84.9	74%	0.74	46%	0.456	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-86.5	128.5	-177.6	-70.1	-178.4	174.9	-177.8	-1.6	109.1	E35 I37	R2-E35 VanDerWaalsContact CD-OE1 3.31Å; R2-E35 WeakPolarHBondContact CD-OE1 3.5Å; R2-E35 IonicContact NE-OE1 3.92Å; R2-I37 HydrophobicContact CG-CG1 4.45Å
3	F	47.6	Very low	46.6	Very low	48 Å²	48	79.8 Å²	79.8	21%	0.211	43%	0.431	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.6	131.3	176	-67.6	-84.7	0	0	0	109.8	M1 V5 V36 N40 L79	M1-F3 HydrophobicContact CB-CD2 4.37Å; M1-F3 HydrophobicContact CB-CE2 3.61Å; M1-F3 HydrophobicContact CB-CZ 4.07Å; M1-F3 HydrophobicContact CG-CE2 3.89Å; M1-F3 HydrophobicContact CG-CZ 3.85Å; M1-F3 WeakPolarHBondContact O-CD2 3.35Å; M1-F3 HydrophobicContact SD-CE1 4.46Å; M1-F3 HydrophobicContact SD-CE2 4.11Å; M1-F3 HydrophobicContact SD-CZ 3.57Å; M1-F3 VanDerWaalsContact SD-CZ 3.57Å; F3-V5 HydrophobicContact CB-CG2 4.48Å; F3-V36 PolarHBondContact N-O 3.16Å; F3-V36 PolarHBondContact O-N 3.29Å; F3-N40 HydrophobicContact CE1-CB 4.4Å; F3-N40 HydrophobicContact CE2-CB 3.77Å; F3-N40 HydrophobicContact CZ-CB 3.45Å; F3-N40 VanDerWaalsContact CZ-CB 3.45Å; F3-L79 HydrophobicContact CB-CD1 3.78Å; F3-L79 HydrophobicContact CD2-CD1 3.24Å; F3-L79 HydrophobicContact CD2-CG 4.44Å; F3-L79 HydrophobicContact CE2-CD1 3.89Å; F3-L79 HydrophobicContact CG-CD1 3.61Å
4	L	43.3	Very low	46.3	Very low	113 Å²	113	81 Å²	81	59%	0.592	43%	0.43	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-94.2	107.7	169	-61.9	167.5	0	0	0	105.8	E33 E35	L4-E33 HydrophobicContact CB-CG 4.2Å; L4-E33 WeakPolarHBondContact CB-OE1 3.34Å; L4-E33 WeakPolarHBondContact CD1-OE1 3.44Å; L4-E33 HydrophobicContact CD2-CG 4.22Å; L4-E35 HydrophobicContact CD2-CB 3.98Å; L4-E35 HydrophobicContact CD2-CG 4.19Å
5	V	53.2	Low	46.4	Very low	32 Å²	32	81.9 Å²	81.9	19%	0.194	44%	0.44	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.9	111.2	176.8	-172.4	0	0	0	0	106.8	F3 L7 V34 V36	F3-V5 HydrophobicContact CB-CG2 4.48Å; V5-L7 HydrophobicContact CG1-CD2 3.92Å; V5-L7 PolarHBondContact O-N 3.1Å; V5-V34 PolarHBondContact N-O 2.8Å; V5-V34 PolarHBondContact O-N 3.49Å; V5-V36 HydrophobicContact CG2-CG2 4.26Å
6	N	41.9	Very low	45.9	Very low	91 Å²	91	86.7 Å²	86.7	49%	0.487	46%	0.456	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.5	111.6	171.7	-162.5	-56.6	0	0	0	107.8	D8 S13	N6-D8 VanDerWaalsContact C-N 3.26Å; N6-D8 PolarHBondContact O-N 3.22Å; N6-D8 PolarHBondContact OD1-N 2.88Å; N6-S13 WeakPolarHBondContact O-CB 3.35Å; N6-S13 PolarHBondContact O-OG 3.25Å
7	L	51.1	Low	45.8	Very low	41 Å²	41	84.6 Å²	84.6	22%	0.215	45%	0.449	C	S	.	.			trans	-89.9	60.8	178.7	-61.5	172.6	0	0	0	109.2	V5 S13 L30 G32 V34	V5-L7 HydrophobicContact CG1-CD2 3.92Å; V5-L7 PolarHBondContact O-N 3.1Å; L7-S13 WeakPolarHBondContact CD2-O 3.47Å; L7-L30 WeakPolarHBondContact CD1-O 3.47Å; L7-G32 PolarHBondContact N-O 3.04Å; L7-V34 HydrophobicContact CD1-CB 4.38Å; L7-V34 HydrophobicContact CD1-CG2 3.77Å
8	D	42	Very low	45	Very low	66 Å²	66	84.6 Å²	84.6	35%	0.353	46%	0.457	S	S	.	.			trans	-76.7	127	172	-174.3	-27.9	0	0	0	108.8	N6 S10 S11	N6-D8 VanDerWaalsContact C-N 3.26Å; N6-D8 PolarHBondContact O-N 3.22Å; N6-D8 PolarHBondContact OD1-N 2.88Å; D8-S10 PolarHBondContact O-N 3.24Å; D8-S10 WeakPolarHBondContact OD1-CB 3.39Å; D8-S10 PolarHBondContact OD1-N 3.4Å; D8-S10 PolarHBondContact OD1-OG 3.37Å; D8-S10 PolarHBondContact OD2-OG 3.48Å; D8-S10 VanDerWaalsContact OD2-OG 3.08Å; D8-S11 PolarHBondContact O-N 2.6Å; D8-S11 VanDerWaalsContact O-N 3.1Å
9	P	48.5	Very low	44.5	Very low	95 Å²	95	86.1 Å²	86.1	62%	0.617	47%	0.469	S	S	*	.	T	Hydrogen-bonded Turn	trans	-52.2	-28.4	175	-25.4	33.2	0	0	0	114	F14	P9-F14 HydrophobicContact CB-CZ 4.43Å; P9-F14 WeakPolarHBondContact O-CE2 3.38Å; P9-F14 WeakPolarHBondContact O-CZ 2.92Å
10	S	46.7	Very low	43.6	Very low	99 Å²	99	84.6 Å²	84.6	69%	0.692	48%	0.475	S	S	*	.	T	Hydrogen-bonded Turn	trans	-86	-27.4	-178.7	72.3	0	0	0	0	114	D8 G12	D8-S10 PolarHBondContact O-N 3.24Å; D8-S10 WeakPolarHBondContact OD1-CB 3.39Å; D8-S10 PolarHBondContact OD1-N 3.4Å; D8-S10 PolarHBondContact OD1-OG 3.37Å; D8-S10 PolarHBondContact OD2-OG 3.48Å; D8-S10 VanDerWaalsContact OD2-OG 3.08Å; S10-G12 PolarHBondContact O-N 2.98Å
11	S	45.7	Very low	42.8	Very low	66 Å²	66	88.7 Å²	88.7	46%	0.462	49%	0.49	S	S	.	.	T	Hydrogen-bonded Turn	trans	-85	6.7	-169.9	95.1	0	0	0	0	114.1	D8 S13	D8-S11 PolarHBondContact O-N 2.6Å; D8-S11 VanDerWaalsContact O-N 3.1Å; S11-S13 PolarHBondContact O-N 3.1Å; S11-S13 VanDerWaalsContact O-N 3.1Å; S11-S13 PolarHBondContact OG-OG 2.92Å
12	G	42.1	Very low	42	Very low	12 Å²	12	87.1 Å²	87.1	12%	0.124	50%	0.495	C	S	.	.	T	Hydrogen-bonded Turn	trans	53.7	34.2	179.5	0	0	0	0	0	111.8	S10 N73 T74 A75	S10-G12 PolarHBondContact O-N 2.98Å; G12-N73 CarbonylContact C-O 3.59Å; G12-N73 WeakPolarHBondContact CA-O 3.48Å; G12-T74 CarbonylContact O-C 3.02Å; G12-T74 WeakPolarHBondContact O-CA 3.48Å; G12-A75 PolarHBondContact O-N 3.21Å
13	S	44.7	Very low	41.4	Very low	19 Å²	19	81.3 Å²	81.3	13%	0.133	50%	0.495	C	S	.	.			trans	-104.1	49	177.5	49.3	0	0	0	0	109.4	N6 L7 S11 V15	N6-S13 WeakPolarHBondContact O-CB 3.35Å; N6-S13 PolarHBondContact O-OG 3.25Å; L7-S13 WeakPolarHBondContact CD2-O 3.47Å; S11-S13 PolarHBondContact O-N 3.1Å; S11-S13 VanDerWaalsContact O-N 3.1Å; S11-S13 PolarHBondContact OG-OG 2.92Å; S13-V15 PolarHBondContact O-N 2.81Å
14	F	43.1	Very low	40.8	Very low	96 Å²	96	83 Å²	83	42%	0.421	51%	0.514	S	S	.	.			trans	-81.4	103.3	-176.6	-70.8	-85.2	0	0	0	111.1	P9 K16 T74	P9-F14 HydrophobicContact CB-CZ 4.43Å; P9-F14 WeakPolarHBondContact O-CE2 3.38Å; P9-F14 WeakPolarHBondContact O-CZ 2.92Å; F14-K16 VanDerWaalsContact C-N 3.27Å; F14-K16 PolarHBondContact O-N 2.93Å; F14-T74 HydrophobicContact CB-CG2 4.32Å; F14-T74 WeakPolarHBondContact O-CG2 3.31Å
15	V	47.1	Very low	40.6	Very low	95 Å²	95	82.5 Å²	82.5	58%	0.576	53%	0.526	S	S	*	.			trans	-72.6	94.2	152.8	-178.2	0	0	0	0	106.2	S13 C17	S13-V15 PolarHBondContact O-N 2.81Å; V15-C17 PolarHBondContact O-N 3.42Å
16	K	38.8	Very low	40	Very low	158 Å²	158	88.4 Å²	88.4	69%	0.687	55%	0.551	S	S	*	*			trans	-68.6	100.4	175.5	-169.5	173.8	-176.4	167.4	0	108.3	F14 S18	F14-K16 VanDerWaalsContact C-N 3.27Å; F14-K16 PolarHBondContact O-N 2.93Å; K16-S18 PolarHBondContact O-N 2.86Å
17	C	43.2	Very low	40.1	Very low	52 Å²	52	88 Å²	88	35%	0.351	56%	0.555	S	S	.	*			trans	-63.9	85.4	157.2	-83.7	0	0	0	0	107.9	V15 V19 P91	V15-C17 PolarHBondContact O-N 3.42Å; C17-V19 PolarHBondContact O-N 3.34Å; C17-V19 VanDerWaalsContact O-N 3.14Å; C17-P91 WeakPolarHBondContact SG-CD 3.02Å
18	S	32.1	Very low	39.8	Very low	84 Å²	84	94.7 Å²	94.7	59%	0.587	58%	0.577	S	S	*	*			trans	-77.6	102	177.8	59.6	0	0	0	0	110.3	K16	K16-S18 PolarHBondContact O-N 2.86Å
19	V	35.2	Very low	40.4	Very low	112 Å²	112	96.2 Å²	96.2	68%	0.679	59%	0.59	S	S	*	*			trans	-33.4	135.1	164.8	178.3	0	0	0	0	114.3	C17	C17-V19 PolarHBondContact O-N 3.34Å; C17-V19 VanDerWaalsContact O-N 3.14Å
20	G	26.4	Very low	40.8	Very low	57 Å²	57	95.6 Å²	95.6	59%	0.588	58%	0.58	S	S	*	*			trans	-166.1	41.5	174	0	0	0	0	0	116.9
21	H	27.9	Very low	41.6	Very low	170 Å²	170	99.2 Å²	99.2	79%	0.787	59%	0.586	S	S	*	*			trans	-159.4	142.1	153.4	-124.3	74.8	0	0	0	112.6	G23	H21-G23 VanDerWaalsContact C-N 3.3Å; H21-G23 PolarHBondContact O-N 3.03Å
22	S	34	Very low	42.7	Very low	128 Å²	128	97.8 Å²	97.8	90%	0.895	58%	0.583	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.9	39.9	-163.1	53	0	0	0	0	116.1
23	G	34.2	Very low	44	Very low	73 Å²	73	103.4 Å²	103.4	75%	0.753	61%	0.606	S	S	*	*	T	Hydrogen-bonded Turn	trans	-122.2	-36.2	-167.6	0	0	0	0	0	118.5	H21	H21-G23 VanDerWaalsContact C-N 3.3Å; H21-G23 PolarHBondContact O-N 3.03Å
24	S	36.1	Very low	45.3	Very low	85 Å²	85	104.1 Å²	104.1	59%	0.594	61%	0.609	S	S	*	*			trans	-149.4	89.3	-171.1	44.6	0	0	0	0	110.1	Q26	S24-Q26 PolarHBondContact O-N 3.46Å; S24-Q26 VanDerWaalsContact O-N 3.09Å
25	A	38.4	Very low	46.7	Very low	102 Å²	102	104.6 Å²	104.6	84%	0.843	61%	0.612	S	S	*	*			trans	-55.4	113.1	168.2	0	0	0	0	0	109.5
26	Q	41.8	Very low	47.9	Very low	155 Å²	155	101.6 Å²	101.6	72%	0.724	59%	0.594	S	S	*	*				-164.7	101.1	118.5	-68.8	-132.8	-7.7	0	0	107.9	S24 R28	S24-Q26 PolarHBondContact O-N 3.46Å; S24-Q26 VanDerWaalsContact O-N 3.09Å; Q26-R28 PolarHBondContact O-N 3.19Å
27	S	43.5	Very low	49.8	Very low	82 Å²	82	97.5 Å²	97.5	57%	0.573	58%	0.579	S	S	*	*			trans	-64.1	86.1	155	177.6	0	0	0	0	105.7	T29	S27-T29 VanDerWaalsContact C-N 3.26Å; S27-T29 PolarHBondContact O-N 3.05Å
28	R	44.3	Very low	51.7	Low	182 Å²	182	95.3 Å²	95.3	69%	0.687	57%	0.565	S	S	*	*			trans	-76.7	91.1	175.3	-175.7	175.6	-88.4	-146.1	-4.3	105.6	Q26 L30	Q26-R28 PolarHBondContact O-N 3.19Å; R28-L30 VanDerWaalsContact C-N 3.26Å; R28-L30 VanDerWaalsContact CD-CD2 3.48Å; R28-L30 HydrophobicContact CG-CD2 3.74Å; R28-L30 HydrophobicContact CG-CG 4.23Å; R28-L30 PolarHBondContact O-N 3.48Å
29	T	54.8	Low	54.1	Low	99 Å²	99	94.5 Å²	94.5	61%	0.607	56%	0.557	S	S	*	*			trans	-57	103	155.1	-60.9	0	0	0	0	105.3	S27 E31	S27-T29 VanDerWaalsContact C-N 3.26Å; S27-T29 PolarHBondContact O-N 3.05Å; T29-E31 PolarHBondContact O-N 2.92Å
30	L	57.9	Low	56.5	Low	81 Å²	81	92 Å²	92	42%	0.424	54%	0.54	S	S	.	.			trans	-70.6	111.6	169.7	-68.5	172.6	0	0	0	105.7	L7 R28 V34	L7-L30 WeakPolarHBondContact CD1-O 3.47Å; R28-L30 VanDerWaalsContact C-N 3.26Å; R28-L30 VanDerWaalsContact CD-CD2 3.48Å; R28-L30 HydrophobicContact CG-CD2 3.74Å; R28-L30 HydrophobicContact CG-CG 4.23Å; R28-L30 PolarHBondContact O-N 3.48Å; L30-V34 HydrophobicContact CB-CG2 3.77Å; L30-V34 HydrophobicContact CD1-CG1 4.42Å; L30-V34 HydrophobicContact CD1-CG2 3.97Å
31	E	61.7	Low	59.4	Low	175 Å²	175	92.9 Å²	92.9	82%	0.818	53%	0.525	S	S	*	.			trans	-74.2	132.7	168.2	-65.3	-174.8	167.7	0	0	108.4	T29	T29-E31 PolarHBondContact O-N 2.92Å
32	G	68.8	Low	62.4	Low	37 Å²	37	91 Å²	91	38%	0.381	52%	0.52	S	S	.	.	S	Bend	trans	111.1	-166.6	177	0	0	0	0	0	114.4	L7	L7-G32 PolarHBondContact N-O 3.04Å
33	E	69.5	Low	65.1	Low	130 Å²	130	88.1 Å²	88.1	61%	0.607	50%	0.495	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-80.1	119.2	-178.6	-174.6	170.7	-164.5	0	0	110.1	L4	L4-E33 HydrophobicContact CB-CG 4.2Å; L4-E33 WeakPolarHBondContact CB-OE1 3.34Å; L4-E33 WeakPolarHBondContact CD1-OE1 3.44Å; L4-E33 HydrophobicContact CD2-CG 4.22Å
34	V	72.6	Confident	67.7	Low	34 Å²	34	88.2 Å²	88.2	21%	0.206	48%	0.476	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.5	126.4	176.9	-178	0	0	0	0	108.9	V5 L7 L30 V36	V5-V34 PolarHBondContact N-O 2.8Å; V5-V34 PolarHBondContact O-N 3.49Å; L7-V34 HydrophobicContact CD1-CB 4.38Å; L7-V34 HydrophobicContact CD1-CG2 3.77Å; L30-V34 HydrophobicContact CB-CG2 3.77Å; L30-V34 HydrophobicContact CD1-CG1 4.42Å; L30-V34 HydrophobicContact CD1-CG2 3.97Å; V34-V36 HydrophobicContact CG1-CG2 4.04Å
35	E	71.7	Confident	70.4	Confident	105 Å²	105	93.1 Å²	93.1	49%	0.491	49%	0.486	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.9	121.8	169.7	-172.7	177.3	-174.7	0	0	109.4	R2 L4	R2-E35 VanDerWaalsContact CD-OE1 3.31Å; R2-E35 WeakPolarHBondContact CD-OE1 3.5Å; R2-E35 IonicContact NE-OE1 3.92Å; L4-E35 HydrophobicContact CD2-CB 3.98Å; L4-E35 HydrophobicContact CD2-CG 4.19Å
36	V	73.7	Confident	72.9	Confident	33 Å²	33	93.3 Å²	93.3	20%	0.2	47%	0.465	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.7	127.3	174.9	-170.7	0	0	0	0	109	F3 V5 V34 L79	F3-V36 PolarHBondContact N-O 3.16Å; F3-V36 PolarHBondContact O-N 3.29Å; V5-V36 HydrophobicContact CG2-CG2 4.26Å; V34-V36 HydrophobicContact CG1-CG2 4.04Å; V36-L79 HydrophobicContact CB-CD2 4.38Å; V36-L79 HydrophobicContact CG1-CD2 3.53Å
37	I	77.7	Confident	75.3	Confident	71 Å²	71	88.1 Å²	88.1	36%	0.364	45%	0.445	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.1	123.8	175.9	-59	179.1	0	0	0	108.4	R2 D82	R2-I37 HydrophobicContact CG-CG1 4.45Å; I37-D82 PolarHBondContact O-N 3.22Å; I37-D82 VanDerWaalsContact O-N 3.08Å
38	G	82.9	Confident	77.6	Confident	6 Å²	6	89 Å²	89	6%	0.062	45%	0.449	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-166.8	-178.5	-178	0	0	0	0	0	114.9	M1 E80	M1-G38 PolarHBondContact N-O 3.08Å; M1-G38 PolarHBondContact O-N 2.73Å; G38-E80 CarbonylContact C-O 3.58Å; G38-E80 WeakPolarHBondContact CA-O 2.93Å
39	V	83.3	Confident	79.8	Confident	67 Å²	67	90.6 Å²	90.6	41%	0.406	46%	0.461	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-96.8	116.7	171.4	-178.7	0	0	0	0	108	E80	V39-E80 HydrophobicContact CB-CB 4.43Å; V39-E80 PolarHBondContact N-O 3.22Å; V39-E80 PolarHBondContact O-N 3.18Å
40	N	85.5	Confident	81.6	Confident	60 Å²	60	88 Å²	88	32%	0.321	45%	0.445	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.1	127.9	169.9	178.2	17.7	0	0	0	109.2	F3 Y78	F3-N40 HydrophobicContact CE1-CB 4.4Å; F3-N40 HydrophobicContact CE2-CB 3.77Å; F3-N40 HydrophobicContact CZ-CB 3.45Å; F3-N40 VanDerWaalsContact CZ-CB 3.45Å; N40-Y78 PolarHBondContact OD1-O 2.96Å
41	R	87.4	Confident	83.3	Confident	76 Å²	76	90.5 Å²	90.5	29%	0.287	46%	0.456	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.3	120.3	-179.5	-69.7	-62.3	-161.5	176.3	-2.3	109.7	R63 Y78 E80 T96	R41-R63 VanDerWaalsContact CB-CZ 3.44Å; R41-Y78 HydrophobicContact CB-CD1 3.67Å; R41-Y78 HydrophobicContact CB-CE1 4.41Å; R41-Y78 HydrophobicContact CB-CG 4.38Å; R41-Y78 HydrophobicContact CG-CD1 3.95Å; R41-Y78 HydrophobicContact CG-CE1 4.29Å; R41-Y78 PolarHBondContact N-O 2.9Å; R41-E80 HydrophobicContact CG-CG 4.18Å; R41-E80 VanDerWaalsContact CG-OE1 3.28Å; R41-E80 WeakPolarHBondContact CG-OE1 3.21Å; R41-E80 IonicContact CZ-OE1 3.64Å; R41-E80 IonicContact NE-OE1 2.8Å; R41-E80 PolarHBondContact NE-OE1 2.83Å; R41-E80 IonicContact NH2-OE1 3.65Å; R41-T96 PolarHBondContact NH2-OG1 3.5Å
42	L	89.6	Confident	84.8	Confident	130 Å²	130	89.6 Å²	89.6	68%	0.681	45%	0.449	S	S	*	.	P	Polyproline II helix	trans	-70.5	156.2	-178.6	-58.6	178.7	0	0	0	111.8	E44 R63	L42-E44 PolarHBondContact O-N 2.8Å; L42-R63 PolarHBondContact O-NE 3.09Å; L42-R63 PolarHBondContact O-NH2 2.97Å
43	N	92.1	Very high	85.9	Confident	67 Å²	67	88.9 Å²	88.9	36%	0.358	44%	0.437	S	S	.	.	P	Polyproline II helix	trans	-62.1	127.8	172.4	-177.8	83.4	0	0	0	111.1	D64 V65 N66	N43-D64 PolarHBondContact OD1-OD1 3.31Å; N43-V65 HydrophobicContact CB-CB 4.1Å; N43-V65 HydrophobicContact CB-CG2 4.28Å; N43-V65 PolarHBondContact OD1-N 3.05Å; N43-N66 PolarHBondContact OD1-N 2.87Å; N43-N66 PolarHBondContact OD1-ND2 3.37Å
44	E	89.4	Confident	87	Confident	76 Å²	76	84.7 Å²	84.7	36%	0.355	42%	0.419	S	S	.	.	P	Polyproline II helix	trans	-98.4	140.3	178.1	-66.8	175.1	-175.9	0	0	110.9	L42 R63	L42-E44 PolarHBondContact O-N 2.8Å; E44-R63 HydrophobicContact CG-CB 4.37Å; E44-R63 PolarHBondContact N-O 2.88Å; E44-R63 IonicContact OE1-CZ 3.67Å; E44-R63 IonicContact OE1-NE 3.47Å; E44-R63 IonicContact OE1-NH1 2.65Å; E44-R63 PolarHBondContact OE1-NH1 3.28Å; E44-R63 IonicContact OE1-NH2 3.12Å; E44-R63 PolarHBondContact OE1-NH2 2.88Å
45	K	91.6	Very high	87.7	Confident	187 Å²	187	85.6 Å²	85.6	81%	0.813	43%	0.426	S	S	*	.	P	Polyproline II helix	trans	-76.2	148.8	164.7	-67.8	-177.9	-179.9	178.3	0	108.5	P47	K45-P47 WeakPolarHBondContact O-CD 3.34Å; K45-P47 VanDerWaalsContact O-N 3.12Å
46	R	91.4	Very high	88.6	Confident	106 Å²	106	87.3 Å²	87.3	40%	0.4	44%	0.443	S	S	.	.	P	Polyproline II helix	trans	-50.1	116.9	173.9	177	-174.9	173.8	74.3	-1.3	110.9	V50 M51 K52 Y62	R46-V50 PolarHBondContact NH1-O 3.02Å; R46-V50 PolarHBondContact NH2-O 2.8Å; R46-M51 PolarHBondContact NH1-O 3.14Å; R46-K52 VanDerWaalsContact CZ-CG 3.49Å; R46-Y62 HydrophobicContact CB-CD2 4.4Å; R46-Y62 HydrophobicContact CB-CE1 4.14Å; R46-Y62 HydrophobicContact CB-CE2 3.97Å; R46-Y62 HydrophobicContact CG-CD1 4.38Å; R46-Y62 HydrophobicContact CG-CE1 3.95Å
47	P	91.1	Very high	89.3	Confident	47 Å²	47	94.6 Å²	94.6	31%	0.305	47%	0.467	S	S	.	.	P	Polyproline II helix	trans	-67.8	154.9	173.6	-18.4	32	0	0	0	111.6	K45 V50	K45-P47 WeakPolarHBondContact O-CD 3.34Å; K45-P47 VanDerWaalsContact O-N 3.12Å; P47-V50 HydrophobicContact CB-CG2 3.87Å; P47-V50 HydrophobicContact CG-CG2 4.19Å
48	P	91.7	Very high	89.7	Confident	101 Å²	101	96 Å²	96	66%	0.656	48%	0.475	S	S	*	.	T	Hydrogen-bonded Turn	trans	-62.2	147.2	171.1	29.1	-34.4	0	0	0	110.3	V50	P48-V50 PolarHBondContact O-N 3.29Å; P48-V50 VanDerWaalsContact O-N 3.14Å
49	F	91.8	Very high	90	Very high	214 Å²	214	99.2 Å²	99.2	94%	0.939	49%	0.489	S	S	*	.	T	Hydrogen-bonded Turn	trans	66.3	2.6	178	-46.3	-72.5	0	0	0	117.6
50	V	92.4	Very high	90.3	Very high	45 Å²	45	99 Å²	99	27%	0.273	48%	0.481	S	S	.	.	P	Polyproline II helix	trans	-89.4	146.1	173.8	179.7	0	0	0	0	110.6	R46 P47 P48 F61 Y62	R46-V50 PolarHBondContact NH1-O 3.02Å; R46-V50 PolarHBondContact NH2-O 2.8Å; P47-V50 HydrophobicContact CB-CG2 3.87Å; P47-V50 HydrophobicContact CG-CG2 4.19Å; P48-V50 PolarHBondContact O-N 3.29Å; P48-V50 VanDerWaalsContact O-N 3.14Å; V50-F61 HydrophobicContact CG1-CB 3.56Å; V50-Y62 HydrophobicContact CG1-CD1 4.16Å
51	M	93	Very high	90.6	Very high	133 Å²	133	100.9 Å²	100.9	66%	0.655	49%	0.487	S	S	*	.	P	Polyproline II helix	trans	-65.6	158.9	176.1	-69.8	-176.5	171.5	0	0	112.5	R46 F61	R46-M51 PolarHBondContact NH1-O 3.14Å; M51-F61 HydrophobicContact CB-CD1 4.34Å; M51-F61 HydrophobicContact CB-CD2 3.8Å; M51-F61 HydrophobicContact CB-CE1 4.37Å; M51-F61 HydrophobicContact CB-CE2 3.83Å; M51-F61 HydrophobicContact CB-CG 4.06Å; M51-F61 HydrophobicContact CB-CZ 4.12Å; M51-F61 HydrophobicContact SD-CE1 4.41Å; M51-F61 HydrophobicContact SD-CZ 4.23Å
52	K	93.2	Very high	90.7	Very high	156 Å²	156	98.9 Å²	98.9	68%	0.678	48%	0.479	S	S	*	.	P	Polyproline II helix	trans	-73.4	140.5	175.9	-73.1	-176.7	179.6	-179	0	109.5	R46 F61	R46-K52 VanDerWaalsContact CZ-CG 3.49Å; K52-F61 VanDerWaalsContact O-CD2 3.23Å; K52-F61 WeakPolarHBondContact O-CD2 3.22Å; K52-F61 VanDerWaalsContact O-CE2 3.28Å; K52-F61 WeakPolarHBondContact O-CE2 3.24Å
53	N	93.4	Very high	90.7	Very high	22 Å²	22	94.9 Å²	94.9	12%	0.118	46%	0.455	C	S	.	.	P	Polyproline II helix	trans	-59.3	147.1	171	-67.5	-15.3	0	0	0	109.5	M59 W60 F61 Y62	N53-M59 WeakPolarHBondContact CA-O 3.44Å; N53-W60 HydrophobicContact CB-CE3 4.05Å; N53-W60 HydrophobicContact CB-CZ3 4.4Å; N53-F61 PolarHBondContact OD1-N 3.42Å; N53-Y62 HydrophobicContact CB-CE1 4.34Å; N53-Y62 WeakPolarHBondContact ND2-CE2 3.38Å; N53-Y62 PolarHBondContact ND2-O 3Å; N53-Y62 WeakPolarHBondContact OD1-CD1 3.35Å; N53-Y62 WeakPolarHBondContact OD1-CE1 3.45Å; N53-Y62 PolarHBondContact OD1-N 3.49Å
54	D	90.9	Very high	90.7	Very high	42 Å²	42	93.5 Å²	93.5	23%	0.225	45%	0.448	C	S	.	.	B	Isolated β-bridge	trans	-122.7	89.4	175.4	-177.1	-16.3	0	0	0	108.4	V56 R57 N58 M59	D54-V56 PolarHBondContact O-N 3.36Å; D54-V56 WeakPolarHBondContact OD1-CB 3.17Å; D54-V56 PolarHBondContact OD1-N 2.85Å; D54-V56 VanDerWaalsContact OD1-N 3.16Å; D54-R57 HydrophobicContact CB-CB 4.43Å; D54-R57 CarbonylContact O-C 3.41Å; D54-R57 PolarHBondContact O-N 3.45Å; D54-R57 PolarHBondContact OD1-N 3.02Å; D54-R57 WeakPolarHBondContact OD2-CD 3.48Å; D54-R57 WeakPolarHBondContact OD2-CG 3.25Å; D54-R57 IonicContact OD2-NE 3.83Å; D54-N58 PolarHBondContact O-N 3Å; D54-M59 HydrophobicContact CB-CB 4.25Å; D54-M59 HydrophobicContact CB-CE 3.64Å; D54-M59 PolarHBondContact N-O 2.85Å; D54-M59 PolarHBondContact O-N 3.31Å
55	P	88.1	Confident	90.7	Very high	54 Å²	54	90.1 Å²	90.1	35%	0.351	43%	0.432	S	S	.	.	T	Hydrogen-bonded Turn	trans	-62.2	-27.7	-179.6	-24.3	34.8	0	0	0	113.4	N58 W60	P55-N58 PolarHBondContact O-N 3.25Å; P55-W60 HydrophobicContact CB-CH2 4.3Å; P55-W60 HydrophobicContact CB-CZ2 4.34Å; P55-W60 HydrophobicContact CG-CH2 4.19Å
56	V	90.2	Very high	90.7	Very high	141 Å²	141	85.3 Å²	85.3	86%	0.855	42%	0.416	S	S	*	.	T	Hydrogen-bonded Turn	trans	-69	-39.8	-179.2	-179.4	0	0	0	0	110.4	D54 N58	D54-V56 PolarHBondContact O-N 3.36Å; D54-V56 WeakPolarHBondContact OD1-CB 3.17Å; D54-V56 PolarHBondContact OD1-N 2.85Å; D54-V56 VanDerWaalsContact OD1-N 3.16Å; V56-N58 VanDerWaalsContact C-N 3.32Å
57	R	88.7	Confident	90.6	Very high	186 Å²	186	81.7 Å²	81.7	70%	0.702	41%	0.408	S	S	*	.	T	Hydrogen-bonded Turn	trans	-90.6	6.8	174.3	-62.6	-174.3	178.3	165.6	-2.7	113.4	D54 M59	D54-R57 HydrophobicContact CB-CB 4.43Å; D54-R57 CarbonylContact O-C 3.41Å; D54-R57 PolarHBondContact O-N 3.45Å; D54-R57 PolarHBondContact OD1-N 3.02Å; D54-R57 WeakPolarHBondContact OD2-CD 3.48Å; D54-R57 WeakPolarHBondContact OD2-CG 3.25Å; D54-R57 IonicContact OD2-NE 3.83Å; R57-M59 HydrophobicContact CB-CE 3.91Å; R57-M59 HydrophobicContact CB-CG 3.98Å; R57-M59 HydrophobicContact CB-SD 4.32Å; R57-M59 HydrophobicContact CG-CE 4.46Å; R57-M59 PolarHBondContact O-N 3.41Å
58	N	85.6	Confident	90.4	Very high	100 Å²	100	81 Å²	81	54%	0.535	40%	0.401	S	S	.	.	T	Hydrogen-bonded Turn	trans	52.6	37.6	-175.3	-162.5	32.8	0	0	0	113.7	D54 P55 V56 W60	D54-N58 PolarHBondContact O-N 3Å; P55-N58 PolarHBondContact O-N 3.25Å; V56-N58 VanDerWaalsContact C-N 3.32Å; N58-W60 PolarHBondContact OD1-NE1 3.42Å
59	M	90.1	Very high	90.2	Very high	73 Å²	73	76.5 Å²	76.5	36%	0.36	37%	0.373	S	S	.	.	B	Isolated β-bridge	trans	-102.5	123.2	178.6	-57.7	-173.6	-60.2	0	0	110.9	N53 D54 R57 F61	N53-M59 WeakPolarHBondContact CA-O 3.44Å; D54-M59 HydrophobicContact CB-CB 4.25Å; D54-M59 HydrophobicContact CB-CE 3.64Å; D54-M59 PolarHBondContact N-O 2.85Å; D54-M59 PolarHBondContact O-N 3.31Å; R57-M59 HydrophobicContact CB-CE 3.91Å; R57-M59 HydrophobicContact CB-CG 3.98Å; R57-M59 HydrophobicContact CB-SD 4.32Å; R57-M59 HydrophobicContact CG-CE 4.46Å; R57-M59 PolarHBondContact O-N 3.41Å; M59-F61 HydrophobicContact CB-CE2 4.42Å
60	W	89.4	Confident	90.1	Very high	63 Å²	63	70.2 Å²	70.2	24%	0.239	36%	0.36	C	S	.	.			trans	-125.8	104.5	-175.5	-56.4	91.9	0	0	0	110.1	N53 P55 N58 D64 A67 M68 L71	N53-W60 HydrophobicContact CB-CE3 4.05Å; N53-W60 HydrophobicContact CB-CZ3 4.4Å; P55-W60 HydrophobicContact CB-CH2 4.3Å; P55-W60 HydrophobicContact CB-CZ2 4.34Å; P55-W60 HydrophobicContact CG-CH2 4.19Å; N58-W60 PolarHBondContact OD1-NE1 3.42Å; W60-D64 HydrophobicContact CZ3-CB 4.3Å; W60-A67 HydrophobicContact CH2-CB 3.95Å; W60-A67 HydrophobicContact CZ3-CB 3.8Å; W60-M68 HydrophobicContact CB-CE 3.82Å; W60-M68 HydrophobicContact CD2-CE 3.5Å; W60-M68 VanDerWaalsContact CD2-CE 3.5Å; W60-M68 HydrophobicContact CD2-CG 3.9Å; W60-M68 HydrophobicContact CE3-CE 3.5Å; W60-M68 VanDerWaalsContact CE3-CE 3.5Å; W60-M68 HydrophobicContact CE3-CG 3.71Å; W60-M68 HydrophobicContact CE3-SD 4.49Å; W60-M68 HydrophobicContact CG-CE 3.64Å; W60-M68 HydrophobicContact CH2-CB 4.19Å; W60-M68 HydrophobicContact CH2-CG 3.54Å; W60-M68 HydrophobicContact CZ2-CB 4.43Å; W60-M68 HydrophobicContact CZ2-CG 3.7Å; W60-M68 HydrophobicContact CZ3-CB 4.49Å; W60-M68 HydrophobicContact CZ3-CE 4.28Å; W60-M68 HydrophobicContact CZ3-CG 3.54Å; W60-L71 HydrophobicContact CZ2-CD2 3.85Å
61	F	91.5	Very high	89.7	Confident	100 Å²	100	72 Å²	72	44%	0.439	37%	0.368	S	S	.	.	S	Bend	trans	-88.1	-20.8	178.7	-59.2	-77.9	0	0	0	113.1	V50 M51 K52 N53 M59	V50-F61 HydrophobicContact CG1-CB 3.56Å; M51-F61 HydrophobicContact CB-CD1 4.34Å; M51-F61 HydrophobicContact CB-CD2 3.8Å; M51-F61 HydrophobicContact CB-CE1 4.37Å; M51-F61 HydrophobicContact CB-CE2 3.83Å; M51-F61 HydrophobicContact CB-CG 4.06Å; M51-F61 HydrophobicContact CB-CZ 4.12Å; M51-F61 HydrophobicContact SD-CE1 4.41Å; M51-F61 HydrophobicContact SD-CZ 4.23Å; K52-F61 VanDerWaalsContact O-CD2 3.23Å; K52-F61 WeakPolarHBondContact O-CD2 3.22Å; K52-F61 VanDerWaalsContact O-CE2 3.28Å; K52-F61 WeakPolarHBondContact O-CE2 3.24Å; N53-F61 PolarHBondContact OD1-N 3.42Å; M59-F61 HydrophobicContact CB-CE2 4.42Å
62	Y	90.6	Very high	89.2	Confident	34 Å²	34	70.4 Å²	70.4	13%	0.133	36%	0.359	C	S	.	.	S	Bend	trans	-142.7	156.3	172.3	59.1	-85.6	0	0	0	109.3	R46 V50 N53 D64	R46-Y62 HydrophobicContact CB-CD2 4.4Å; R46-Y62 HydrophobicContact CB-CE1 4.14Å; R46-Y62 HydrophobicContact CB-CE2 3.97Å; R46-Y62 HydrophobicContact CG-CD1 4.38Å; R46-Y62 HydrophobicContact CG-CE1 3.95Å; V50-Y62 HydrophobicContact CG1-CD1 4.16Å; N53-Y62 HydrophobicContact CB-CE1 4.34Å; N53-Y62 WeakPolarHBondContact ND2-CE2 3.38Å; N53-Y62 PolarHBondContact ND2-O 3Å; N53-Y62 WeakPolarHBondContact OD1-CD1 3.35Å; N53-Y62 WeakPolarHBondContact OD1-CE1 3.45Å; N53-Y62 PolarHBondContact OD1-N 3.49Å; Y62-D64 HydrophobicContact CD2-CB 4.22Å; Y62-D64 HydrophobicContact CE2-CB 3.85Å; Y62-D64 PolarHBondContact O-N 3.05Å
63	R	89.2	Confident	88.8	Confident	46 Å²	46	68.8 Å²	68.8	17%	0.174	36%	0.357	C	S	.	.			trans	-82.5	83.4	-172	-168.7	178.6	57.7	-125.1	-7.5	112.1	R41 L42 E44 V65 M68	R41-R63 VanDerWaalsContact CB-CZ 3.44Å; L42-R63 PolarHBondContact O-NE 3.09Å; L42-R63 PolarHBondContact O-NH2 2.97Å; E44-R63 HydrophobicContact CG-CB 4.37Å; E44-R63 PolarHBondContact N-O 2.88Å; E44-R63 IonicContact OE1-CZ 3.67Å; E44-R63 IonicContact OE1-NE 3.47Å; E44-R63 IonicContact OE1-NH1 2.65Å; E44-R63 PolarHBondContact OE1-NH1 3.28Å; E44-R63 IonicContact OE1-NH2 3.12Å; E44-R63 PolarHBondContact OE1-NH2 2.88Å; R63-V65 HydrophobicContact CG-CG2 3.83Å; R63-V65 PolarHBondContact O-N 2.87Å; R63-M68 HydrophobicContact CG-CE 4.48Å
64	D	91.1	Very high	88.3	Confident	37 Å²	37	69.5 Å²	69.5	20%	0.198	36%	0.363	C	S	.	.			trans	-88	87.6	169.7	-166.6	-27.2	0	0	0	110.2	N43 W60 Y62 N66 A67 M68	N43-D64 PolarHBondContact OD1-OD1 3.31Å; W60-D64 HydrophobicContact CZ3-CB 4.3Å; Y62-D64 HydrophobicContact CD2-CB 4.22Å; Y62-D64 HydrophobicContact CE2-CB 3.85Å; Y62-D64 PolarHBondContact O-N 3.05Å; D64-N66 VanDerWaalsContact C-N 3.28Å; D64-N66 PolarHBondContact O-N 3.26Å; D64-N66 PolarHBondContact OD1-N 2.96Å; D64-A67 HydrophobicContact CB-CB 4.07Å; D64-A67 VanDerWaalsContact CG-CB 3.47Å; D64-A67 PolarHBondContact O-N 2.89Å; D64-A67 WeakPolarHBondContact OD1-CB 3.49Å; D64-A67 PolarHBondContact OD1-N 3.48Å; D64-M68 VanDerWaalsContact O-CG 3.25Å; D64-M68 WeakPolarHBondContact O-CG 3.35Å; D64-M68 PolarHBondContact O-N 3.36Å
65	V	90.2	Very high	88	Confident	6 Å²	6	69.5 Å²	69.5	4%	0.036	37%	0.368	C	S	.	.	H	α-helix	trans	-65.4	-34.4	-176.2	-179.7	0	0	0	0	111	N43 R63 M68 A69 Y78	N43-V65 HydrophobicContact CB-CB 4.1Å; N43-V65 HydrophobicContact CB-CG2 4.28Å; N43-V65 PolarHBondContact OD1-N 3.05Å; R63-V65 HydrophobicContact CG-CG2 3.83Å; R63-V65 PolarHBondContact O-N 2.87Å; V65-M68 PolarHBondContact O-N 2.9Å; V65-A69 WeakPolarHBondContact O-CB 3.48Å; V65-A69 PolarHBondContact O-N 2.98Å; V65-Y78 HydrophobicContact CG2-CG 4.48Å
66	N	91.1	Very high	88	Confident	86 Å²	86	70.8 Å²	70.8	46%	0.46	38%	0.377	S	S	.	.	H	α-helix	trans	-67.3	-44.6	179.2	-65.6	-50.7	0	0	0	111.4	N43 D64 A69 A70 P76	N43-N66 PolarHBondContact OD1-N 2.87Å; N43-N66 PolarHBondContact OD1-ND2 3.37Å; D64-N66 VanDerWaalsContact C-N 3.28Å; D64-N66 PolarHBondContact O-N 3.26Å; D64-N66 PolarHBondContact OD1-N 2.96Å; N66-A69 PolarHBondContact O-N 2.91Å; N66-A70 WeakPolarHBondContact O-CB 3.23Å; N66-A70 PolarHBondContact O-N 2.95Å; N66-P76 WeakPolarHBondContact OD1-CB 3.17Å
67	A	89.4	Confident	87.7	Confident	30 Å²	30	68.1 Å²	68.1	25%	0.248	36%	0.36	C	S	.	.	H	α-helix	trans	-67.1	-38.1	176.5	0	0	0	0	0	112	W60 D64 A70 L71	W60-A67 HydrophobicContact CH2-CB 3.95Å; W60-A67 HydrophobicContact CZ3-CB 3.8Å; D64-A67 HydrophobicContact CB-CB 4.07Å; D64-A67 VanDerWaalsContact CG-CB 3.47Å; D64-A67 PolarHBondContact O-N 2.89Å; D64-A67 WeakPolarHBondContact OD1-CB 3.49Å; D64-A67 PolarHBondContact OD1-N 3.48Å; A67-A70 PolarHBondContact O-N 2.75Å; A67-L71 PolarHBondContact O-N 2.65Å
68	M	87.7	Confident	87.5	Confident	32 Å²	32	63.6 Å²	63.6	16%	0.158	34%	0.344	C	S	.	.	H	α-helix	trans	-61.3	-45.8	172.9	-70.8	172.5	-175.3	0	0	111.2	W60 R63 D64 V65 A70 L71 H72 Y78	W60-M68 HydrophobicContact CB-CE 3.82Å; W60-M68 HydrophobicContact CD2-CE 3.5Å; W60-M68 VanDerWaalsContact CD2-CE 3.5Å; W60-M68 HydrophobicContact CD2-CG 3.9Å; W60-M68 HydrophobicContact CE3-CE 3.5Å; W60-M68 VanDerWaalsContact CE3-CE 3.5Å; W60-M68 HydrophobicContact CE3-CG 3.71Å; W60-M68 HydrophobicContact CE3-SD 4.49Å; W60-M68 HydrophobicContact CG-CE 3.64Å; W60-M68 HydrophobicContact CH2-CB 4.19Å; W60-M68 HydrophobicContact CH2-CG 3.54Å; W60-M68 HydrophobicContact CZ2-CB 4.43Å; W60-M68 HydrophobicContact CZ2-CG 3.7Å; W60-M68 HydrophobicContact CZ3-CB 4.49Å; W60-M68 HydrophobicContact CZ3-CE 4.28Å; W60-M68 HydrophobicContact CZ3-CG 3.54Å; R63-M68 HydrophobicContact CG-CE 4.48Å; D64-M68 VanDerWaalsContact O-CG 3.25Å; D64-M68 WeakPolarHBondContact O-CG 3.35Å; D64-M68 PolarHBondContact O-N 3.36Å; V65-M68 PolarHBondContact O-N 2.9Å; M68-A70 PolarHBondContact O-N 2.83Å; M68-L71 WeakPolarHBondContact O-CB 3.45Å; M68-L71 PolarHBondContact O-N 3.17Å; M68-H72 PolarHBondContact O-CD2 2.8Å; M68-H72 VanDerWaalsContact O-CD2 3.25Å; M68-H72 PolarHBondContact O-N 3.32Å; M68-Y78 HydrophobicContact SD-CD2 4.13Å; M68-Y78 HydrophobicContact SD-CE2 4.17Å
69	A	87.4	Confident	87.5	Confident	7 Å²	7	61.1 Å²	61.1	6%	0.058	33%	0.33	C	S	.	.	H	α-helix	trans	-64.4	-40.6	179.7	0	0	0	0	0	112.3	V65 N66 L71 H72 N73 T74 P76	V65-A69 WeakPolarHBondContact O-CB 3.48Å; V65-A69 PolarHBondContact O-N 2.98Å; N66-A69 PolarHBondContact O-N 2.91Å; A69-L71 VanDerWaalsContact C-N 3.32Å; A69-L71 PolarHBondContact O-N 3.05Å; A69-H72 PolarHBondContact O-N 3.43Å; A69-N73 WeakPolarHBondContact O-CA 3.35Å; A69-N73 PolarHBondContact O-N 3.25Å; A69-T74 WeakPolarHBondContact CA-OG1 3.5Å; A69-T74 WeakPolarHBondContact CB-O 3.28Å; A69-T74 PolarHBondContact O-N 2.58Å; A69-P76 HydrophobicContact CB-CB 4.08Å
70	A	87.9	Confident	87	Confident	81 Å²	81	59.2 Å²	59.2	67%	0.669	32%	0.321	S	S	*	.	H	α-helix	trans	-62.7	-38.2	173.5	0	0	0	0	0	112.4	N66 A67 M68	N66-A70 WeakPolarHBondContact O-CB 3.23Å; N66-A70 PolarHBondContact O-N 2.95Å; A67-A70 PolarHBondContact O-N 2.75Å; M68-A70 PolarHBondContact O-N 2.83Å
71	L	85.5	Confident	86.6	Confident	83 Å²	83	57.4 Å²	57.4	44%	0.435	32%	0.319	S	S	.	.	H	α-helix	trans	-67.2	-38.1	177.4	-178.1	64.5	0	0	0	112.3	W60 A67 M68 A69	W60-L71 HydrophobicContact CZ2-CD2 3.85Å; A67-L71 PolarHBondContact O-N 2.65Å; M68-L71 WeakPolarHBondContact O-CB 3.45Å; M68-L71 PolarHBondContact O-N 3.17Å; A69-L71 VanDerWaalsContact C-N 3.32Å; A69-L71 PolarHBondContact O-N 3.05Å
72	H	81.9	Confident	86	Confident	100 Å²	100	55.1 Å²	55.1	46%	0.463	31%	0.311	S	S	.	.	H	α-helix	trans	-98.1	0.6	-175.7	-67.1	-63.5	0	0	0	114.3	M68 A69 T74	M68-H72 PolarHBondContact O-CD2 2.8Å; M68-H72 VanDerWaalsContact O-CD2 3.25Å; M68-H72 PolarHBondContact O-N 3.32Å; A69-H72 PolarHBondContact O-N 3.43Å; H72-T74 VanDerWaalsContact C-N 3.25Å; H72-T74 HydrophobicContact CB-CG2 3.67Å; H72-T74 PolarHBondContact O-N 2.87Å
73	N	83.8	Confident	85.2	Confident	121 Å²	121	56.7 Å²	56.7	65%	0.647	33%	0.332	S	S	*	.	T	Hydrogen-bonded Turn	trans	51.2	47.1	-172	-164.7	46.8	0	0	0	111.8	G12 A69	G12-N73 CarbonylContact C-O 3.59Å; G12-N73 WeakPolarHBondContact CA-O 3.48Å; A69-N73 WeakPolarHBondContact O-CA 3.35Å; A69-N73 PolarHBondContact O-N 3.25Å
74	T	82.9	Confident	84.5	Confident	38 Å²	38	60.8 Å²	60.8	23%	0.233	36%	0.362	C	S	.	.			trans	-108.1	164.6	179.7	71.9	0	0	0	0	111.8	G12 F14 A69 H72	G12-T74 CarbonylContact O-C 3.02Å; G12-T74 WeakPolarHBondContact O-CA 3.48Å; F14-T74 HydrophobicContact CB-CG2 4.32Å; F14-T74 WeakPolarHBondContact O-CG2 3.31Å; A69-T74 WeakPolarHBondContact CA-OG1 3.5Å; A69-T74 WeakPolarHBondContact CB-O 3.28Å; A69-T74 PolarHBondContact O-N 2.58Å; H72-T74 VanDerWaalsContact C-N 3.25Å; H72-T74 HydrophobicContact CB-CG2 3.67Å; H72-T74 PolarHBondContact O-N 2.87Å
75	A	85.7	Confident	83.4	Confident	42 Å²	42	61.3 Å²	61.3	35%	0.347	37%	0.368	S	S	.	.			trans	-60.4	148	159.6	0	0	0	0	0	109.7	G12 V77	G12-A75 PolarHBondContact O-N 3.21Å; A75-V77 HydrophobicContact CB-CG2 4.49Å; A75-V77 PolarHBondContact O-N 3.08Å
76	P	87.3	Confident	82.4	Confident	81 Å²	81	63.9 Å²	63.9	53%	0.526	38%	0.384	S	S	.	.	S	Bend	trans	-77.5	57.4	-178.5	33.7	-37	0	0	0	112.2	N66 A69	N66-P76 WeakPolarHBondContact OD1-CB 3.17Å; A69-P76 HydrophobicContact CB-CB 4.08Å
77	V	85.3	Confident	81.2	Confident	84 Å²	84	64 Å²	64	51%	0.509	39%	0.387	S	S	.	.			trans	-122.9	126	178.6	-179.1	0	0	0	0	108.2	A75	A75-V77 HydrophobicContact CB-CG2 4.49Å; A75-V77 PolarHBondContact O-N 3.08Å
78	Y	84.8	Confident	80.2	Confident	92 Å²	92	69.2 Å²	69.2	36%	0.361	41%	0.411	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111	114.6	173.6	-170.4	-77.3	0	0	0	108.8	N40 R41 V65 M68 E80	N40-Y78 PolarHBondContact OD1-O 2.96Å; R41-Y78 HydrophobicContact CB-CD1 3.67Å; R41-Y78 HydrophobicContact CB-CE1 4.41Å; R41-Y78 HydrophobicContact CB-CG 4.38Å; R41-Y78 HydrophobicContact CG-CD1 3.95Å; R41-Y78 HydrophobicContact CG-CE1 4.29Å; R41-Y78 PolarHBondContact N-O 2.9Å; V65-Y78 HydrophobicContact CG2-CG 4.48Å; M68-Y78 HydrophobicContact SD-CD2 4.13Å; M68-Y78 HydrophobicContact SD-CE2 4.17Å; Y78-E80 HydrophobicContact CD1-CG 4.25Å; Y78-E80 HydrophobicContact CE1-CG 3.64Å
79	L	83.7	Confident	78.8	Confident	47 Å²	47	69.3 Å²	69.3	25%	0.246	42%	0.421	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.4	122.4	-177.5	-170.2	145.2	0	0	0	109.8	F3 V36	F3-L79 HydrophobicContact CB-CD1 3.78Å; F3-L79 HydrophobicContact CD2-CD1 3.24Å; F3-L79 HydrophobicContact CD2-CG 4.44Å; F3-L79 HydrophobicContact CE2-CD1 3.89Å; F3-L79 HydrophobicContact CG-CD1 3.61Å; V36-L79 HydrophobicContact CB-CD2 4.38Å; V36-L79 HydrophobicContact CG1-CD2 3.53Å
80	E	80.5	Confident	77.8	Confident	33 Å²	33	69.8 Å²	69.8	15%	0.154	43%	0.426	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.2	112.6	169.9	-65.9	-174.3	-137.9	0	0	109	G38 V39 R41 Y78 T96	G38-E80 CarbonylContact C-O 3.58Å; G38-E80 WeakPolarHBondContact CA-O 2.93Å; V39-E80 HydrophobicContact CB-CB 4.43Å; V39-E80 PolarHBondContact N-O 3.22Å; V39-E80 PolarHBondContact O-N 3.18Å; R41-E80 HydrophobicContact CG-CG 4.18Å; R41-E80 VanDerWaalsContact CG-OE1 3.28Å; R41-E80 WeakPolarHBondContact CG-OE1 3.21Å; R41-E80 IonicContact CZ-OE1 3.64Å; R41-E80 IonicContact NE-OE1 2.8Å; R41-E80 PolarHBondContact NE-OE1 2.83Å; R41-E80 IonicContact NH2-OE1 3.65Å; Y78-E80 HydrophobicContact CD1-CG 4.25Å; Y78-E80 HydrophobicContact CE1-CG 3.64Å; E80-T96 VanDerWaalsContact CD-OG1 3.26Å; E80-T96 PolarHBondContact OE1-OG1 3.26Å; E80-T96 WeakPolarHBondContact OE2-CB 3.35Å; E80-T96 PolarHBondContact OE2-OG1 3.13Å
81	A	80.5	Confident	76.9	Confident	25 Å²	25	69.1 Å²	69.1	21%	0.207	42%	0.415	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-66.4	149.3	177.9	0	0	0	0	0	110.9	G93 G94	A81-G93 CarbonylContact O-C 3.57Å; A81-G93 WeakPolarHBondContact O-CA 3.28Å; A81-G94 PolarHBondContact O-N 3.35Å
82	D	78.6	Confident	76.3	Confident	52 Å²	52	71 Å²	71	28%	0.278	42%	0.424	S	S	.	.			trans	-65.7	165.4	170.9	75.3	-0	0	0	0	111.8	I37 V84 S85 G93	I37-D82 PolarHBondContact O-N 3.22Å; I37-D82 VanDerWaalsContact O-N 3.08Å; D82-V84 PolarHBondContact O-N 3.42Å; D82-V84 PolarHBondContact OD1-N 3.47Å; D82-S85 PolarHBondContact O-N 3.03Å; D82-S85 WeakPolarHBondContact OD1-CB 3.41Å; D82-S85 PolarHBondContact OD1-N 3.44Å; D82-S85 PolarHBondContact OD1-OG 3.47Å; D82-G93 WeakPolarHBondContact O-CA 3.2Å
83	A	75	Confident	76.1	Confident	68 Å²	68	66.6 Å²	66.6	56%	0.562	41%	0.406	S	S	*	.	G	3₁₀ helix	trans	-62.2	-29.2	-178.3	0	0	0	0	0	112.6	S85 T86	A83-S85 VanDerWaalsContact C-N 3.33Å; A83-T86 WeakPolarHBondContact O-CB 3.4Å; A83-T86 PolarHBondContact O-N 3.23Å; A83-T86 PolarHBondContact O-OG1 3.14Å
84	V	73.5	Confident	75.8	Confident	132 Å²	132	62.8 Å²	62.8	80%	0.8	40%	0.396	S	S	*	.	G	3₁₀ helix	trans	-70.7	-30.7	-178.6	-178	0	0	0	0	111.6	D82 T86	D82-V84 PolarHBondContact O-N 3.42Å; D82-V84 PolarHBondContact OD1-N 3.47Å; V84-T86 PolarHBondContact O-N 2.96Å
85	S	68.5	Low	75.6	Confident	48 Å²	48	67.6 Å²	67.6	34%	0.336	42%	0.416	S	S	.	.	G	3₁₀ helix	trans	-78.9	8.9	179	-57.8	0	0	0	0	113.8	D82 A83 V87	D82-S85 PolarHBondContact O-N 3.03Å; D82-S85 WeakPolarHBondContact OD1-CB 3.41Å; D82-S85 PolarHBondContact OD1-N 3.44Å; D82-S85 PolarHBondContact OD1-OG 3.47Å; A83-S85 VanDerWaalsContact C-N 3.33Å; S85-V87 PolarHBondContact O-N 2.65Å
86	T	69.5	Low	75.3	Confident	59 Å²	59	67.5 Å²	67.5	36%	0.362	41%	0.411	S	S	.	.			trans	-69.9	126	178.7	-58.1	0	0	0	0	110.7	A83 V84 L92 G93	A83-T86 WeakPolarHBondContact O-CB 3.4Å; A83-T86 PolarHBondContact O-N 3.23Å; A83-T86 PolarHBondContact O-OG1 3.14Å; V84-T86 PolarHBondContact O-N 2.96Å; T86-L92 HydrophobicContact CG2-CD2 3.63Å; T86-G93 PolarHBondContact OG1-N 2.94Å; T86-G93 VanDerWaalsContact OG1-N 3.13Å
87	V	66.7	Low	75	Confident	89 Å²	89	69.5 Å²	69.5	54%	0.539	42%	0.417	S	S	.	.			trans	-112.1	137.9	176.9	-176.2	0	0	0	0	109.4	S85 G89 G90	S85-V87 PolarHBondContact O-N 2.65Å; V87-G89 PolarHBondContact O-N 3.22Å; V87-G90 WeakPolarHBondContact O-CA 3.34Å; V87-G90 PolarHBondContact O-N 3.24Å
88	D	66.7	Low	74.7	Confident	140 Å²	140	70.8 Å²	70.8	75%	0.749	43%	0.425	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.7	129.3	175.8	-172.3	22.9	0	0	0	111	G90	D88-G90 PolarHBondContact O-N 3.31Å
89	G	59.8	Low	74.6	Confident	34 Å²	34	73.3 Å²	73.3	35%	0.351	44%	0.44	S	S	.	.	T	Hydrogen-bonded Turn	trans	70	4.5	-172.9	0	0	0	0	0	115.9	V87	V87-G89 PolarHBondContact O-N 3.22Å
90	G	65.6	Low	74.6	Confident	17 Å²	17	78.3 Å²	78.3	18%	0.175	47%	0.465	C	S	.	.	S	Bend	trans	-103.3	-171.1	175.7	0	0	0	0	0	113.5	V87 D88 L92	V87-G90 WeakPolarHBondContact O-CA 3.34Å; V87-G90 PolarHBondContact O-N 3.24Å; D88-G90 PolarHBondContact O-N 3.31Å; G90-L92 PolarHBondContact O-N 2.84Å
91	P	68.3	Low	74.9	Confident	67 Å²	67	81.4 Å²	81.4	44%	0.435	49%	0.488	S	S	.	.	P	Polyproline II helix	trans	-64.8	134	173.3	28.6	-31.6	0	0	0	109.7	C17 G93	C17-P91 WeakPolarHBondContact SG-CD 3.02Å; P91-G93 PolarHBondContact O-N 3.45Å
92	L	73.8	Confident	75.1	Confident	121 Å²	121	85.9 Å²	85.9	63%	0.634	51%	0.509	S	S	*	.	P	Polyproline II helix	trans	-76.3	121.9	175.2	-65.1	172.9	0	0	0	109.5	T86 G90	T86-L92 HydrophobicContact CG2-CD2 3.63Å; G90-L92 PolarHBondContact O-N 2.84Å
93	G	78.2	Confident	75.5	Confident	8 Å²	8	88.4 Å²	88.4	8%	0.082	52%	0.522	C	S	.	.	P	Polyproline II helix	trans	-76	173.2	172.3	0	0	0	0	0	112.4	A81 D82 T86 P91 Q95	A81-G93 CarbonylContact O-C 3.57Å; A81-G93 WeakPolarHBondContact O-CA 3.28Å; D82-G93 WeakPolarHBondContact O-CA 3.2Å; T86-G93 PolarHBondContact OG1-N 2.94Å; T86-G93 VanDerWaalsContact OG1-N 3.13Å; P91-G93 PolarHBondContact O-N 3.45Å; G93-Q95 PolarHBondContact O-N 3.35Å; G93-Q95 PolarHBondContact O-NE2 2.48Å
94	G	76.8	Confident	75.8	Confident	41 Å²	41	91.8 Å²	91.8	42%	0.423	53%	0.526	S	S	.	.			trans	70.9	21.9	168.7	0	0	0	0	0	116.3	A81 T96	A81-G94 PolarHBondContact O-N 3.35Å; G94-T96 VanDerWaalsContact C-N 3.33Å; G94-T96 PolarHBondContact O-N 2.78Å
95	Q	79.5	Confident	76.5	Confident	140 Å²	140	90.8 Å²	90.8	65%	0.654	52%	0.52	S	S	*	.			trans	-72.4	-24.7	-179.4	-63.1	-58.1	-58.6	0	0	113.5	G93 N97	G93-Q95 PolarHBondContact O-N 3.35Å; G93-Q95 PolarHBondContact O-NE2 2.48Å; Q95-N97 PolarHBondContact O-N 2.8Å
96	T	78.9	Confident	77.4	Confident	40 Å²	40	91.1 Å²	91.1	25%	0.245	53%	0.526	C	S	.	.	S	Bend	trans	-73.6	113.4	172	-75.8	0	0	0	0	110.5	R41 E80 G94 V98	R41-T96 PolarHBondContact NH2-OG1 3.5Å; E80-T96 VanDerWaalsContact CD-OG1 3.26Å; E80-T96 PolarHBondContact OE1-OG1 3.26Å; E80-T96 WeakPolarHBondContact OE2-CB 3.35Å; E80-T96 PolarHBondContact OE2-OG1 3.13Å; G94-T96 VanDerWaalsContact C-N 3.33Å; G94-T96 PolarHBondContact O-N 2.78Å; T96-V98 HydrophobicContact CG2-CG1 3.96Å; T96-V98 PolarHBondContact O-N 3.31Å
97	N	80.1	Confident	78.2	Confident	123 Å²	123	95.6 Å²	95.6	66%	0.658	54%	0.538	S	S	*	.			trans	-73.7	113.8	166.8	-175.1	10.7	0	0	0	110.1	Q95 Q99	Q95-N97 PolarHBondContact O-N 2.8Å; N97-Q99 PolarHBondContact ND2-O 3.39Å; N97-Q99 WeakPolarHBondContact OD1-CA 3.38Å; N97-Q99 WeakPolarHBondContact OD1-CB 3.47Å; N97-Q99 PolarHBondContact OD1-N 2.85Å; N97-Q99 PolarHBondContact OD1-O 3.38Å
98	V	79.3	Confident	79.3	Confident	111 Å²	111	97.4 Å²	97.4	67%	0.673	54%	0.543	S	S	*	.			trans	-93.9	-6.7	174.8	-63.5	0	0	0	0	113.1	T96 I100	T96-V98 HydrophobicContact CG2-CG1 3.96Å; T96-V98 PolarHBondContact O-N 3.31Å; V98-I100 PolarHBondContact O-N 3.26Å
99	Q	83.8	Confident	80.4	Confident	144 Å²	144	96.7 Å²	96.7	67%	0.673	54%	0.543	S	S	*	.			trans	-89.2	97.6	177.6	-60.2	-65.3	-17.9	0	0	109.3	N97	N97-Q99 PolarHBondContact ND2-O 3.39Å; N97-Q99 WeakPolarHBondContact OD1-CA 3.38Å; N97-Q99 WeakPolarHBondContact OD1-CB 3.47Å; N97-Q99 PolarHBondContact OD1-N 2.85Å; N97-Q99 PolarHBondContact OD1-O 3.38Å
100	I	82.7	Confident	81.8	Confident	152 Å²	152	99.9 Å²	99.9	78%	0.779	56%	0.556	S	S	*	*			trans	-93.8	114.8	169.9	-57.5	174.1	0	0	0	106.8	V98 D102	V98-I100 PolarHBondContact O-N 3.26Å; I100-D102 PolarHBondContact O-N 3.4Å
101	P	85.9	Confident	82.8	Confident	98 Å²	98	110.1 Å²	110.1	64%	0.636	59%	0.59	S	S	*	*			trans	-66.9	129.4	178.9	26.8	-32.8	0	0	0	110.6	N103	P101-N103 PolarHBondContact O-N 3.45Å
102	D	85.7	Confident	83.5	Confident	119 Å²	119	112.3 Å²	112.3	64%	0.636	60%	0.598	S	S	*	*			trans	-88.1	100.9	170.9	-177.9	-1.7	0	0	0	109.6	I100 H104	I100-D102 PolarHBondContact O-N 3.4Å; D102-H104 WeakPolarHBondContact OD1-CB 3.34Å; D102-H104 IonicContact OD1-CD2 2.91Å; D102-H104 PolarHBondContact OD1-CD2 3.05Å; D102-H104 IonicContact OD1-CG 3.16Å; D102-H104 PolarHBondContact OD1-N 2.91Å; D102-H104 IonicContact OD1-NE2 3.79Å
103	N	87.1	Confident	84	Confident	106 Å²	106	111.8 Å²	111.8	57%	0.567	60%	0.596	S	S	*	*			trans	-110.9	31	177.3	-69	-39.9	0	0	0	111.8	P101 T105 A106 Y107	P101-N103 PolarHBondContact O-N 3.45Å; N103-T105 PolarHBondContact O-N 3.03Å; N103-A106 HydrophobicContact CB-CB 4.38Å; N103-A106 WeakPolarHBondContact O-CB 3.48Å; N103-A106 PolarHBondContact O-N 3.44Å; N103-Y107 PolarHBondContact O-N 3.19Å
104	H	82.2	Confident	84.4	Confident	138 Å²	138	117.6 Å²	117.6	64%	0.639	62%	0.624	S	S	*	*	H	α-helix	trans	-56.6	-35.9	-177.6	-77.6	-147.9	0	0	0	112.6	D102 A106 Y107 I108	D102-H104 WeakPolarHBondContact OD1-CB 3.34Å; D102-H104 IonicContact OD1-CD2 2.91Å; D102-H104 PolarHBondContact OD1-CD2 3.05Å; D102-H104 IonicContact OD1-CG 3.16Å; D102-H104 PolarHBondContact OD1-N 2.91Å; D102-H104 IonicContact OD1-NE2 3.79Å; H104-A106 VanDerWaalsContact C-N 3.34Å; H104-A106 PolarHBondContact O-N 3.19Å; H104-Y107 PolarHBondContact O-N 3.22Å; H104-I108 WeakPolarHBondContact O-CG1 3.49Å; H104-I108 PolarHBondContact O-N 3.42Å
105	T	86.3	Confident	84.8	Confident	111 Å²	111	122.1 Å²	122.1	68%	0.681	64%	0.636	S	S	*	*	H	α-helix	trans	-62.8	-37.9	176.5	-48	0	0	0	0	112.9	N103 Y107 I108 V109	N103-T105 PolarHBondContact O-N 3.03Å; T105-Y107 VanDerWaalsContact C-N 3.3Å; T105-Y107 PolarHBondContact O-N 3.48Å; T105-I108 PolarHBondContact O-N 3.39Å; T105-V109 PolarHBondContact O-N 3.31Å
106	A	88.1	Confident	85.1	Confident	56 Å²	56	121 Å²	121	46%	0.463	64%	0.635	S	S	.	*	H	α-helix	trans	-67.8	-34	177.5	0	0	0	0	0	111.7	N103 H104 V109 T110	N103-A106 HydrophobicContact CB-CB 4.38Å; N103-A106 WeakPolarHBondContact O-CB 3.48Å; N103-A106 PolarHBondContact O-N 3.44Å; H104-A106 VanDerWaalsContact C-N 3.34Å; H104-A106 PolarHBondContact O-N 3.19Å; A106-V109 PolarHBondContact O-N 3.34Å; A106-T110 PolarHBondContact O-N 3.23Å; A106-T110 PolarHBondContact O-OG1 3.13Å
107	Y	86.7	Confident	85.6	Confident	152 Å²	152	126.4 Å²	126.4	60%	0.596	66%	0.661	S	S	*	*	H	α-helix	trans	-67.1	-41	177.4	-160.4	-92.8	0	0	0	111.8	N103 H104 T105 V109 T110 W111	N103-Y107 PolarHBondContact O-N 3.19Å; H104-Y107 PolarHBondContact O-N 3.22Å; T105-Y107 VanDerWaalsContact C-N 3.3Å; T105-Y107 PolarHBondContact O-N 3.48Å; Y107-V109 VanDerWaalsContact C-N 3.26Å; Y107-V109 PolarHBondContact O-N 3.39Å; Y107-T110 PolarHBondContact O-N 3.22Å; Y107-W111 AromaticContact CD2-CD1 3.84Å; Y107-W111 HydrophobicContact CE1-CB 4.37Å; Y107-W111 AromaticContact CE1-CD1 3.85Å; Y107-W111 HydrophobicContact CE1-CG 4.3Å; Y107-W111 AromaticContact CE2-CD1 3.55Å; Y107-W111 AromaticContact CE2-NE1 3.68Å; Y107-W111 AromaticContact CZ-CD1 3.55Å; Y107-W111 AromaticContact CZ-NE1 3.94Å; Y107-W111 PolarHBondContact O-N 2.83Å; Y107-W111 VanDerWaalsContact O-N 3.13Å
108	I	88.9	Confident	85.9	Confident	128 Å²	128	126.6 Å²	126.6	66%	0.656	66%	0.661	S	S	*	*	H	α-helix	trans	-61.1	-32.8	176.1	-65.6	167.3	0	0	0	112.3	H104 T105	H104-I108 WeakPolarHBondContact O-CG1 3.49Å; H104-I108 PolarHBondContact O-N 3.42Å; T105-I108 PolarHBondContact O-N 3.39Å
109	V	91.2	Very high	86.5	Confident	124 Å²	124	127.8 Å²	127.8	75%	0.752	66%	0.66	S	S	*	*	H	α-helix	trans	-80.1	-29.1	-179.9	174.8	0	0	0	0	111.9	T105 A106 Y107	T105-V109 PolarHBondContact O-N 3.31Å; A106-V109 PolarHBondContact O-N 3.34Å; Y107-V109 VanDerWaalsContact C-N 3.26Å; Y107-V109 PolarHBondContact O-N 3.39Å
110	T	89.5	Confident	86.7	Confident	102 Å²	102	126.5 Å²	126.5	63%	0.626	66%	0.659	S	S	*	*	H	α-helix	trans	-85.1	-30.3	-174	-54	0	0	0	0	112.5	A106 Y107	A106-T110 PolarHBondContact O-N 3.23Å; A106-T110 PolarHBondContact O-OG1 3.13Å; Y107-T110 PolarHBondContact O-N 3.22Å
111	W	85.9	Confident	87	Confident	232 Å²	232	124.2 Å²	124.2	88%	0.879	65%	0.648	S	S	*	*			trans	-129.6	0	-175.1	-59.7	101.5	0	0	0	110.9	Y107	Y107-W111 AromaticContact CD2-CD1 3.84Å; Y107-W111 HydrophobicContact CE1-CB 4.37Å; Y107-W111 AromaticContact CE1-CD1 3.85Å; Y107-W111 HydrophobicContact CE1-CG 4.3Å; Y107-W111 AromaticContact CE2-CD1 3.55Å; Y107-W111 AromaticContact CE2-NE1 3.68Å; Y107-W111 AromaticContact CZ-CD1 3.55Å; Y107-W111 AromaticContact CZ-NE1 3.94Å; Y107-W111 PolarHBondContact O-N 2.83Å; Y107-W111 VanDerWaalsContact O-N 3.13Å

Retrieved 111 of 111 residues in 564.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).