A0A077ZLK2_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZLK2, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 136 aa.

						>A0A077ZLK2_TRITR|A0A077ZLK2
MQSVCGAASRGVVWGGVARYATAYGLGQCEVSVAWRDAEWRGAVWRGVAWRGVAWRGVAWRGVAWRGAARFGLAWRRVAQYGVVWGNVVWGAWWSARFVWCGVRCVVGCGVDPWCSDKLTTAQRRYHFTYKEIKRI
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	30.8	Very low	40.1	Very low	236 Å²	236	127.4 Å²	127.4	100%	1.163	81%	0.81	S	S	*	*				0	114.5	0	-76	166	171.5	0	0	108.4
2	Q	31.2	Very low	41.3	Very low	172 Å²	172	127.8 Å²	127.8	80%	0.804	81%	0.81	S	S	*	*			trans	58.8	80.3	156	-60.1	173.6	0.3	0	0	118.5
3	S	37.4	Very low	42.2	Very low	110 Å²	110	124.8 Å²	124.8	77%	0.769	79%	0.789	S	S	*	*				-138	48.3	129.2	-156.2	0	0	0	0	110	C5	S3-C5 PolarHBondContact O-N 3.1Å
4	V	45.5	Very low	42.7	Very low	147 Å²	147	127.3 Å²	127.3	89%	0.891	78%	0.775	S	S	*	*			trans	-78.8	62.2	144.8	-99.4	0	0	0	0	106.2
5	C	33.5	Very low	43.4	Very low	99 Å²	99	121 Å²	121	67%	0.669	75%	0.746	S	S	*	*			trans	-119.4	108	178.3	-79.1	0	0	0	0	108.3	S3	S3-C5 PolarHBondContact O-N 3.1Å
6	G	36.8	Very low	44.3	Very low	64 Å²	64	115.4 Å²	115.4	66%	0.66	72%	0.72	S	S	*	*	S	Bend	trans	130.9	-3.2	160.6	0	0	0	0	0	116.7	A8	G6-A8 PolarHBondContact O-N 3.16Å
7	A	44.3	Very low	45.2	Very low	113 Å²	113	111.1 Å²	111.1	93%	0.934	69%	0.692	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.4	13.2	-176	0	0	0	0	0	115.2
8	A	41.8	Very low	45.7	Very low	105 Å²	105	107.6 Å²	107.6	87%	0.868	68%	0.676	S	S	*	*	T	Hydrogen-bonded Turn	trans	-100.1	2.6	-169.8	0	0	0	0	0	116.1	G6	G6-A8 PolarHBondContact O-N 3.16Å
9	S	43.2	Very low	46.3	Very low	98 Å²	98	111.6 Å²	111.6	69%	0.685	68%	0.677	S	S	*	*	S	Bend	trans	-123.5	3.3	-172.6	57	0	0	0	0	118.1
10	R	45.9	Very low	46.8	Very low	181 Å²	181	114.2 Å²	114.2	68%	0.683	68%	0.675	S	S	*	*			trans	-143	52.7	-178	-58.9	-174.2	-154.3	152.4	7.3	115.1	V12 V13	R10-V12 PolarHBondContact O-N 3.03Å; R10-V13 PolarHBondContact O-N 3.47Å
11	G	50.6	Low	47.2	Very low	76 Å²	76	109.4 Å²	109.4	78%	0.784	65%	0.649	S	S	*	*	H	α-helix	trans	-56	-21.3	179.4	0	0	0	0	0	115.6
12	V	54.2	Low	48.7	Very low	133 Å²	133	103.6 Å²	103.6	81%	0.806	63%	0.626	S	S	*	*	H	α-helix	trans	-87.4	-33.1	-178.2	-174.7	0	0	0	0	112.9	R10	R10-V12 PolarHBondContact O-N 3.03Å
13	V	52.7	Low	50.1	Low	89 Å²	89	99 Å²	99	54%	0.539	62%	0.618	S	S	.	*	H	α-helix	trans	-74.4	-37.1	-174.7	176.3	0	0	0	0	111.4	R10 G15 G16 V17	R10-V13 PolarHBondContact O-N 3.47Å; V13-G15 VanDerWaalsContact C-N 3.33Å; V13-G15 PolarHBondContact O-N 3.08Å; V13-G16 PolarHBondContact O-N 3.34Å; V13-V17 HydrophobicContact CG1-CG2 4.21Å; V13-V17 WeakPolarHBondContact O-CG2 3.49Å; V13-V17 PolarHBondContact O-N 3.04Å; V13-V17 VanDerWaalsContact O-N 3.15Å
14	W	50.2	Low	51.1	Low	159 Å²	159	101.6 Å²	101.6	60%	0.602	61%	0.612	S	S	*	*	H	α-helix	trans	-68.9	-30.7	178.6	-81.3	80	0	0	0	113	G16 V17 A18	W14-G16 VanDerWaalsContact C-N 3.26Å; W14-G16 PolarHBondContact O-N 2.91Å; W14-V17 PolarHBondContact O-N 3.31Å; W14-A18 WeakPolarHBondContact O-CB 3.47Å; W14-A18 PolarHBondContact O-N 2.9Å
15	G	52.5	Low	51.7	Low	33 Å²	33	97.9 Å²	97.9	34%	0.34	60%	0.604	S	S	.	*	H	α-helix	trans	-63.9	-30.1	177.9	0	0	0	0	0	113.7	V13 R19	V13-G15 VanDerWaalsContact C-N 3.33Å; V13-G15 PolarHBondContact O-N 3.08Å; G15-R19 WeakPolarHBondContact O-CG 3.38Å; G15-R19 PolarHBondContact O-NE 3.03Å
16	G	58	Low	52.7	Low	31 Å²	31	96.8 Å²	96.8	32%	0.32	59%	0.591	S	S	.	*	H	α-helix	trans	-81.1	-46.4	172.9	0	0	0	0	0	112	V13 W14 A18 R19 Y20	V13-G16 PolarHBondContact O-N 3.34Å; W14-G16 VanDerWaalsContact C-N 3.26Å; W14-G16 PolarHBondContact O-N 2.91Å; G16-A18 PolarHBondContact O-N 3.17Å; G16-R19 PolarHBondContact O-N 3.46Å; G16-Y20 PolarHBondContact O-N 3.15Å
17	V	59.7	Low	53.8	Low	42 Å²	42	95.7 Å²	95.7	26%	0.255	58%	0.579	S	S	.	*	H	α-helix	trans	-65.6	-40.7	-177.5	174.4	0	0	0	0	112	V13 W14 R19 Y20 A21 V31	V13-V17 HydrophobicContact CG1-CG2 4.21Å; V13-V17 WeakPolarHBondContact O-CG2 3.49Å; V13-V17 PolarHBondContact O-N 3.04Å; V13-V17 VanDerWaalsContact O-N 3.15Å; W14-V17 PolarHBondContact O-N 3.31Å; V17-R19 VanDerWaalsContact C-N 3.32Å; V17-R19 PolarHBondContact O-N 3.22Å; V17-Y20 PolarHBondContact O-N 2.94Å; V17-A21 WeakPolarHBondContact O-CB 3.34Å; V17-A21 PolarHBondContact O-N 2.91Å; V17-V31 HydrophobicContact CG1-CG1 3.95Å
18	A	54.4	Low	54.5	Low	49 Å²	49	97 Å²	97	41%	0.405	57%	0.566	S	S	.	*	H	α-helix	trans	-63.6	-38.2	175.2	0	0	0	0	0	111.7	W14 G16 T22	W14-A18 WeakPolarHBondContact O-CB 3.47Å; W14-A18 PolarHBondContact O-N 2.9Å; G16-A18 PolarHBondContact O-N 3.17Å; A18-T22 PolarHBondContact O-N 2.8Å; A18-T22 PolarHBondContact O-OG1 3.49Å
19	R	57.8	Low	55.1	Low	183 Å²	183	96.9 Å²	96.9	69%	0.691	56%	0.557	S	S	*	*	H	α-helix	trans	-69	-38	175.1	-79.5	-167.7	-81.9	178.1	-7	112.6	G15 G16 V17 T22 A23	G15-R19 WeakPolarHBondContact O-CG 3.38Å; G15-R19 PolarHBondContact O-NE 3.03Å; G16-R19 PolarHBondContact O-N 3.46Å; V17-R19 VanDerWaalsContact C-N 3.32Å; V17-R19 PolarHBondContact O-N 3.22Å; R19-T22 WeakPolarHBondContact CA-OG1 3.15Å; R19-T22 PolarHBondContact O-OG1 2.65Å; R19-A23 WeakPolarHBondContact O-CB 3.04Å; R19-A23 PolarHBondContact O-N 3.15Å
20	Y	56	Low	55.6	Low	164 Å²	164	97.2 Å²	97.2	64%	0.643	55%	0.548	S	S	*	.	H	α-helix	trans	-69.1	-42.2	175.4	-97.8	-89.7	0	0	0	112.3	G16 V17 A23 Y24	G16-Y20 PolarHBondContact O-N 3.15Å; V17-Y20 PolarHBondContact O-N 2.94Å; Y20-A23 PolarHBondContact O-N 3.33Å; Y20-Y24 HydrophobicContact CD1-CD2 4.09Å; Y20-Y24 AromaticContact CD1-CE2 3.89Å; Y20-Y24 HydrophobicContact CD1-CE2 3.89Å; Y20-Y24 HydrophobicContact CE1-CE2 4.06Å; Y20-Y24 WeakPolarHBondContact O-CD2 3.34Å; Y20-Y24 PolarHBondContact O-N 3.38Å; Y20-Y24 VanDerWaalsContact O-N 3.08Å
21	A	54.2	Low	56.2	Low	14 Å²	14	89.8 Å²	89.8	12%	0.116	52%	0.523	C	S	.	.	H	α-helix	trans	-63.8	-43	176.9	0	0	0	0	0	111.8	V17 G25 L26 V31	V17-A21 WeakPolarHBondContact O-CB 3.34Å; V17-A21 PolarHBondContact O-N 2.91Å; A21-G25 WeakPolarHBondContact O-CA 3.19Å; A21-G25 PolarHBondContact O-N 3.44Å; A21-L26 PolarHBondContact O-N 3.1Å; A21-L26 VanDerWaalsContact O-N 3.16Å; A21-V31 HydrophobicContact CB-CG2 4.25Å
22	T	63.3	Low	56.6	Low	113 Å²	113	89.4 Å²	89.4	69%	0.693	51%	0.508	S	S	*	.	H	α-helix	trans	-67.6	-38	174	37.7	0	0	0	0	112.7	A18 R19 Y24	A18-T22 PolarHBondContact O-N 2.8Å; A18-T22 PolarHBondContact O-OG1 3.49Å; R19-T22 WeakPolarHBondContact CA-OG1 3.15Å; R19-T22 PolarHBondContact O-OG1 2.65Å; T22-Y24 PolarHBondContact O-N 3.3Å
23	A	60.1	Low	56.9	Low	75 Å²	75	87 Å²	87	62%	0.62	49%	0.493	S	S	*	.	H	α-helix	trans	-65.5	-36.1	179.4	0	0	0	0	0	113.5	R19 Y20	R19-A23 WeakPolarHBondContact O-CB 3.04Å; R19-A23 PolarHBondContact O-N 3.15Å; Y20-A23 PolarHBondContact O-N 3.33Å
24	Y	58.9	Low	56.9	Low	166 Å²	166	85.7 Å²	85.7	65%	0.651	49%	0.492	S	S	*	.	H	α-helix	trans	-103.6	4	-178	-71	-82.4	0	0	0	113.9	Y20 T22 L26	Y20-Y24 HydrophobicContact CD1-CD2 4.09Å; Y20-Y24 AromaticContact CD1-CE2 3.89Å; Y20-Y24 HydrophobicContact CD1-CE2 3.89Å; Y20-Y24 HydrophobicContact CE1-CE2 4.06Å; Y20-Y24 WeakPolarHBondContact O-CD2 3.34Å; Y20-Y24 PolarHBondContact O-N 3.38Å; Y20-Y24 VanDerWaalsContact O-N 3.08Å; T22-Y24 PolarHBondContact O-N 3.3Å; Y24-L26 PolarHBondContact O-N 3.29Å; Y24-L26 VanDerWaalsContact O-N 3.1Å
25	G	58.4	Low	57.2	Low	69 Å²	69	86 Å²	86	71%	0.711	49%	0.493	S	S	*	.	T	Hydrogen-bonded Turn	trans	62.4	14.9	-178	0	0	0	0	0	113.9	A21	A21-G25 WeakPolarHBondContact O-CA 3.19Å; A21-G25 PolarHBondContact O-N 3.44Å
26	L	53.3	Low	57.4	Low	76 Å²	76	93.1 Å²	93.1	40%	0.398	51%	0.51	S	S	.	.			trans	-83.2	127.5	-176.1	-64.4	170	0	0	0	108.9	A21 Y24 E30	A21-L26 PolarHBondContact O-N 3.1Å; A21-L26 VanDerWaalsContact O-N 3.16Å; Y24-L26 PolarHBondContact O-N 3.29Å; Y24-L26 VanDerWaalsContact O-N 3.1Å; L26-E30 WeakPolarHBondContact CA-OE2 3.14Å; L26-E30 HydrophobicContact CB-CB 4.3Å; L26-E30 WeakPolarHBondContact CB-OE2 3.47Å; L26-E30 WeakPolarHBondContact CD2-OE2 3.34Å
27	G	60	Low	57.3	Low	40 Å²	40	95.9 Å²	95.9	41%	0.412	52%	0.517	S	S	.	.			trans	-59.1	150.9	176.3	0	0	0	0	0	110.4	C29 E30	G27-C29 PolarHBondContact O-N 3.39Å; G27-E30 PolarHBondContact N-OE2 3.06Å; G27-E30 VanDerWaalsContact N-OE2 3.15Å; G27-E30 PolarHBondContact O-N 2.91Å
28	Q	59.8	Low	57.2	Low	142 Å²	142	96.5 Å²	96.5	66%	0.664	53%	0.527	S	S	*	.	H	α-helix	trans	-54.5	-23.7	177.6	-67	-178.3	1.9	0	0	112.8
29	C	53.1	Low	57.3	Low	101 Å²	101	101.4 Å²	101.4	68%	0.682	54%	0.541	S	S	*	.	H	α-helix	trans	-69.6	-31.7	174.6	-57.4	0	0	0	0	113.9	G27 S32 V33	G27-C29 PolarHBondContact O-N 3.39Å; C29-S32 PolarHBondContact O-OG 2.87Å; C29-V33 WeakPolarHBondContact O-CG2 3.39Å
30	E	54.9	Low	57.2	Low	105 Å²	105	101.6 Å²	101.6	49%	0.491	54%	0.542	S	S	.	.	H	α-helix	trans	-78	-36.9	-178.7	-70.4	176.7	133.5	0	0	111.4	L26 G27 S32 V33 A34	L26-E30 WeakPolarHBondContact CA-OE2 3.14Å; L26-E30 HydrophobicContact CB-CB 4.3Å; L26-E30 WeakPolarHBondContact CB-OE2 3.47Å; L26-E30 WeakPolarHBondContact CD2-OE2 3.34Å; G27-E30 PolarHBondContact N-OE2 3.06Å; G27-E30 VanDerWaalsContact N-OE2 3.15Å; G27-E30 PolarHBondContact O-N 2.91Å; E30-S32 VanDerWaalsContact C-N 3.29Å; E30-S32 PolarHBondContact O-N 3.25Å; E30-V33 PolarHBondContact O-N 3.42Å; E30-A34 PolarHBondContact O-N 3.29Å; E30-A34 VanDerWaalsContact O-N 3.1Å
31	V	58.1	Low	57.2	Low	26 Å²	26	102.5 Å²	102.5	16%	0.158	54%	0.544	C	S	.	.	H	α-helix	trans	-60.4	-42.9	176.2	179.4	0	0	0	0	110.2	V17 A21 V33 A34 W35	V17-V31 HydrophobicContact CG1-CG1 3.95Å; A21-V31 HydrophobicContact CB-CG2 4.25Å; V31-V33 VanDerWaalsContact C-N 3.35Å; V31-V33 PolarHBondContact O-N 3.33Å; V31-A34 PolarHBondContact O-N 3.18Å; V31-W35 PolarHBondContact O-N 3.16Å
32	S	59.2	Low	57.3	Low	67 Å²	67	103.6 Å²	103.6	47%	0.469	56%	0.557	S	S	.	*	H	α-helix	trans	-66.4	-33	-179.1	65	0	0	0	0	113.7	C29 E30 R36	C29-S32 PolarHBondContact O-OG 2.87Å; E30-S32 VanDerWaalsContact C-N 3.29Å; E30-S32 PolarHBondContact O-N 3.25Å; S32-R36 PolarHBondContact O-N 3.01Å
33	V	59.5	Low	57	Low	83 Å²	83	101 Å²	101	50%	0.503	55%	0.547	S	S	.	.	H	α-helix	trans	-69.2	-45	174.4	177.3	0	0	0	0	110.8	C29 E30 V31 W35 R36 D37	C29-V33 WeakPolarHBondContact O-CG2 3.39Å; E30-V33 PolarHBondContact O-N 3.42Å; V31-V33 VanDerWaalsContact C-N 3.35Å; V31-V33 PolarHBondContact O-N 3.33Å; V33-W35 VanDerWaalsContact C-N 3.26Å; V33-W35 PolarHBondContact O-N 3.04Å; V33-R36 PolarHBondContact O-N 3.23Å; V33-D37 PolarHBondContact O-N 3.45Å; V33-D37 VanDerWaalsContact O-N 3.16Å
34	A	53.7	Low	56.7	Low	61 Å²	61	102 Å²	102	50%	0.504	55%	0.545	S	S	.	.	H	α-helix	trans	-58.6	-36.5	179.7	0	0	0	0	0	112.9	E30 V31 A38	E30-A34 PolarHBondContact O-N 3.29Å; E30-A34 VanDerWaalsContact O-N 3.1Å; V31-A34 PolarHBondContact O-N 3.18Å; A34-A38 PolarHBondContact O-N 3.2Å
35	W	56.1	Low	56.3	Low	166 Å²	166	103.2 Å²	103.2	63%	0.629	55%	0.548	S	S	*	.	H	α-helix	trans	-68.4	-37.2	175.8	-66.3	113.2	0	0	0	112.9	V31 V33 A38 E39	V31-W35 PolarHBondContact O-N 3.16Å; V33-W35 VanDerWaalsContact C-N 3.26Å; V33-W35 PolarHBondContact O-N 3.04Å; W35-A38 PolarHBondContact O-N 3.02Å; W35-E39 PolarHBondContact O-N 3.29Å; W35-E39 VanDerWaalsContact O-N 3.11Å
36	R	56.5	Low	56.2	Low	182 Å²	182	108.8 Å²	108.8	69%	0.687	55%	0.548	S	S	*	.	H	α-helix	trans	-63.2	-45.5	176	-81.9	-174.6	-178.8	-161.2	1	111	S32 V33 A38 E39 W40	S32-R36 PolarHBondContact O-N 3.01Å; V33-R36 PolarHBondContact O-N 3.23Å; R36-A38 VanDerWaalsContact C-N 3.3Å; R36-A38 PolarHBondContact O-N 3.47Å; R36-E39 PolarHBondContact O-N 3.38Å; R36-W40 PolarHBondContact O-N 3.11Å; R36-W40 VanDerWaalsContact O-N 3.09Å
37	D	55.9	Low	56.2	Low	90 Å²	90	107.1 Å²	107.1	48%	0.481	55%	0.549	S	S	.	.	H	α-helix	trans	-64.2	-35.9	179.9	-71.1	-37	0	0	0	112.7	V33 R41	V33-D37 PolarHBondContact O-N 3.45Å; V33-D37 VanDerWaalsContact O-N 3.16Å; D37-R41 WeakPolarHBondContact O-CG 3.46Å; D37-R41 PolarHBondContact O-N 3.09Å; D37-R41 VanDerWaalsContact O-N 3.11Å
38	A	58.5	Low	56.1	Low	55 Å²	55	109.6 Å²	109.6	46%	0.455	56%	0.556	S	S	.	*	H	α-helix	trans	-65.3	-41	175.2	0	0	0	0	0	112.2	A34 W35 R36 R41 G42	A34-A38 PolarHBondContact O-N 3.2Å; W35-A38 PolarHBondContact O-N 3.02Å; R36-A38 VanDerWaalsContact C-N 3.3Å; R36-A38 PolarHBondContact O-N 3.47Å; A38-R41 PolarHBondContact O-N 3.22Å; A38-G42 PolarHBondContact O-N 3.39Å
39	E	55.8	Low	55.6	Low	152 Å²	152	105.7 Å²	105.7	71%	0.71	55%	0.548	S	S	*	.	H	α-helix	trans	-65.4	-41.2	178.1	-166	171.3	-174.1	0	0	111.7	W35 R36 G42 A43	W35-E39 PolarHBondContact O-N 3.29Å; W35-E39 VanDerWaalsContact O-N 3.11Å; R36-E39 PolarHBondContact O-N 3.38Å; E39-G42 PolarHBondContact O-N 3.41Å; E39-A43 PolarHBondContact O-N 3.47Å
40	W	54.8	Low	55.5	Low	186 Å²	186	110.2 Å²	110.2	71%	0.705	55%	0.551	S	S	*	*	H	α-helix	trans	-61.2	-44.9	174.3	-79.9	108.4	0	0	0	112.5	R36 G42 A43 V44	R36-W40 PolarHBondContact O-N 3.11Å; R36-W40 VanDerWaalsContact O-N 3.09Å; W40-G42 VanDerWaalsContact C-N 3.35Å; W40-G42 PolarHBondContact O-N 3.16Å; W40-A43 PolarHBondContact O-N 3.24Å; W40-V44 WeakPolarHBondContact O-CG2 3.46Å; W40-V44 PolarHBondContact O-N 3.37Å
41	R	56.8	Low	55.5	Low	184 Å²	184	114.1 Å²	114.1	69%	0.694	56%	0.561	S	S	*	*	H	α-helix	trans	-62.2	-43.8	176.5	-72.4	-179.5	-178.9	-122.6	1.1	111	D37 A38 A43 V44 W45	D37-R41 WeakPolarHBondContact O-CG 3.46Å; D37-R41 PolarHBondContact O-N 3.09Å; D37-R41 VanDerWaalsContact O-N 3.11Å; A38-R41 PolarHBondContact O-N 3.22Å; R41-A43 VanDerWaalsContact C-N 3.32Å; R41-A43 PolarHBondContact O-N 3.11Å; R41-V44 PolarHBondContact O-N 3.31Å; R41-W45 PolarHBondContact O-N 3.13Å; R41-W45 VanDerWaalsContact O-N 3.16Å
42	G	56.2	Low	55.3	Low	36 Å²	36	114.6 Å²	114.6	37%	0.371	57%	0.571	S	S	.	*	H	α-helix	trans	-58.9	-39.3	177	0	0	0	0	0	113.7	A38 E39 W40 W45 R46	A38-G42 PolarHBondContact O-N 3.39Å; E39-G42 PolarHBondContact O-N 3.41Å; W40-G42 VanDerWaalsContact C-N 3.35Å; W40-G42 PolarHBondContact O-N 3.16Å; G42-W45 PolarHBondContact O-N 3.02Å; G42-R46 PolarHBondContact O-N 2.93Å; G42-R46 VanDerWaalsContact O-N 3.13Å
43	A	58.1	Low	55.1	Low	59 Å²	59	116.2 Å²	116.2	49%	0.488	58%	0.578	S	S	.	*	H	α-helix	trans	-65.8	-40.7	177	0	0	0	0	0	112.6	E39 W40 R41 R46 G47	E39-A43 PolarHBondContact O-N 3.47Å; W40-A43 PolarHBondContact O-N 3.24Å; R41-A43 VanDerWaalsContact C-N 3.32Å; R41-A43 PolarHBondContact O-N 3.11Å; A43-R46 PolarHBondContact O-N 3.19Å; A43-G47 PolarHBondContact O-N 3.48Å
44	V	52.9	Low	54.7	Low	96 Å²	96	115.2 Å²	115.2	58%	0.582	58%	0.578	S	S	*	*	H	α-helix	trans	-62.8	-43.9	176.8	174.9	0	0	0	0	111.1	W40 R41 R46 G47 V48	W40-V44 WeakPolarHBondContact O-CG2 3.46Å; W40-V44 PolarHBondContact O-N 3.37Å; R41-V44 PolarHBondContact O-N 3.31Å; V44-R46 PolarHBondContact O-N 3.03Å; V44-G47 PolarHBondContact O-N 3.43Å; V44-V48 WeakPolarHBondContact O-CG2 3.46Å; V44-V48 PolarHBondContact O-N 3.06Å
45	W	50.5	Low	54.4	Low	191 Å²	191	121.3 Å²	121.3	72%	0.723	59%	0.588	S	S	*	*	H	α-helix	trans	-63.2	-40.4	177.6	-71	110.4	0	0	0	112.7	R41 G42 V48 A49	R41-W45 PolarHBondContact O-N 3.13Å; R41-W45 VanDerWaalsContact O-N 3.16Å; G42-W45 PolarHBondContact O-N 3.02Å; W45-V48 PolarHBondContact O-N 3.17Å; W45-A49 WeakPolarHBondContact O-CB 3.43Å; W45-A49 PolarHBondContact O-N 3.34Å
46	R	55.6	Low	54.3	Low	187 Å²	187	121.9 Å²	121.9	71%	0.706	59%	0.591	S	S	*	*	H	α-helix	trans	-60.8	-48.4	174	-75.2	-172.4	176.2	-165.2	0.2	110.6	G42 A43 V44 V48 A49 W50	G42-R46 PolarHBondContact O-N 2.93Å; G42-R46 VanDerWaalsContact O-N 3.13Å; A43-R46 PolarHBondContact O-N 3.19Å; V44-R46 PolarHBondContact O-N 3.03Å; R46-V48 VanDerWaalsContact C-N 3.32Å; R46-V48 PolarHBondContact O-N 3.32Å; R46-A49 PolarHBondContact O-N 2.99Å; R46-A49 VanDerWaalsContact O-N 3.17Å; R46-W50 PolarHBondContact O-N 3.32Å
47	G	54.9	Low	54.2	Low	40 Å²	40	115.1 Å²	115.1	41%	0.412	58%	0.577	S	S	.	*	H	α-helix	trans	-57.2	-41.1	179.3	0	0	0	0	0	113.9	A43 V44 R51	A43-G47 PolarHBondContact O-N 3.48Å; V44-G47 PolarHBondContact O-N 3.43Å; G47-R51 PolarHBondContact O-N 3.14Å; G47-R51 VanDerWaalsContact O-N 3.16Å
48	V	56.2	Low	54.1	Low	92 Å²	92	115.8 Å²	115.8	56%	0.558	58%	0.584	S	S	*	*	H	α-helix	trans	-68.6	-41.4	177	176.8	0	0	0	0	111.5	V44 W45 R46 W50 R51 G52	V44-V48 WeakPolarHBondContact O-CG2 3.46Å; V44-V48 PolarHBondContact O-N 3.06Å; W45-V48 PolarHBondContact O-N 3.17Å; R46-V48 VanDerWaalsContact C-N 3.32Å; R46-V48 PolarHBondContact O-N 3.32Å; V48-W50 PolarHBondContact O-N 3.24Å; V48-R51 PolarHBondContact O-N 3.03Å; V48-G52 PolarHBondContact O-N 3.45Å
49	A	51	Low	53.7	Low	60 Å²	60	116 Å²	116	50%	0.496	59%	0.586	S	S	.	*	H	α-helix	trans	-62.1	-42.9	177	0	0	0	0	0	111.9	W45 R46 R51 G52 V53	W45-A49 WeakPolarHBondContact O-CB 3.43Å; W45-A49 PolarHBondContact O-N 3.34Å; R46-A49 PolarHBondContact O-N 2.99Å; R46-A49 VanDerWaalsContact O-N 3.17Å; A49-R51 PolarHBondContact O-N 2.98Å; A49-G52 PolarHBondContact O-N 3.49Å; A49-V53 WeakPolarHBondContact O-CG2 3.4Å; A49-V53 PolarHBondContact O-N 3.1Å
50	W	50.3	Low	53.4	Low	196 Å²	196	117.7 Å²	117.7	74%	0.742	59%	0.586	S	S	*	*	H	α-helix	trans	-62.2	-42.5	176.4	-72.7	109.8	0	0	0	112.3	R46 V48 V53 A54	R46-W50 PolarHBondContact O-N 3.32Å; V48-W50 PolarHBondContact O-N 3.24Å; W50-V53 PolarHBondContact O-N 3.1Å; W50-A54 PolarHBondContact O-N 3.25Å; W50-A54 VanDerWaalsContact O-N 3.1Å
51	R	54.7	Low	53.3	Low	187 Å²	187	117.7 Å²	117.7	71%	0.706	59%	0.586	S	S	*	*	H	α-helix	trans	-61.8	-47.8	173.6	-84.6	-174	171.1	-161.1	-1.7	110.9	G47 V48 A49 V53 A54 W55	G47-R51 PolarHBondContact O-N 3.14Å; G47-R51 VanDerWaalsContact O-N 3.16Å; V48-R51 PolarHBondContact O-N 3.03Å; A49-R51 PolarHBondContact O-N 2.98Å; R51-V53 VanDerWaalsContact C-N 3.31Å; R51-V53 PolarHBondContact O-N 3.31Å; R51-A54 PolarHBondContact O-N 3.48Å; R51-A54 VanDerWaalsContact O-N 3.14Å; R51-W55 PolarHBondContact O-N 3.16Å
52	G	53.8	Low	53.1	Low	37 Å²	37	110.5 Å²	110.5	38%	0.381	57%	0.569	S	S	.	*	H	α-helix	trans	-57.3	-39.9	-179.9	0	0	0	0	0	114	V48 A49 R56	V48-G52 PolarHBondContact O-N 3.45Å; A49-G52 PolarHBondContact O-N 3.49Å; G52-R56 PolarHBondContact O-N 3.03Å; G52-R56 VanDerWaalsContact O-N 3.1Å
53	V	55.9	Low	53.1	Low	101 Å²	101	113.6 Å²	113.6	61%	0.612	58%	0.581	S	S	*	*	H	α-helix	trans	-69.4	-41	176.4	176.8	0	0	0	0	111.5	A49 W50 R51 W55 R56 G57	A49-V53 WeakPolarHBondContact O-CG2 3.4Å; A49-V53 PolarHBondContact O-N 3.1Å; W50-V53 PolarHBondContact O-N 3.1Å; R51-V53 VanDerWaalsContact C-N 3.31Å; R51-V53 PolarHBondContact O-N 3.31Å; V53-W55 PolarHBondContact O-N 3.16Å; V53-R56 PolarHBondContact O-N 2.93Å; V53-G57 PolarHBondContact O-N 3.48Å
54	A	49.9	Very low	52.6	Low	61 Å²	61	113.9 Å²	113.9	50%	0.504	58%	0.583	S	S	.	*	H	α-helix	trans	-61.6	-43.6	176.5	0	0	0	0	0	111.9	W50 R51 R56 G57 V58	W50-A54 PolarHBondContact O-N 3.25Å; W50-A54 VanDerWaalsContact O-N 3.1Å; R51-A54 PolarHBondContact O-N 3.48Å; R51-A54 VanDerWaalsContact O-N 3.14Å; A54-R56 PolarHBondContact O-N 3.49Å; A54-G57 PolarHBondContact O-N 3.09Å; A54-V58 WeakPolarHBondContact O-CG2 3.39Å; A54-V58 PolarHBondContact O-N 2.93Å; A54-V58 VanDerWaalsContact O-N 3.09Å
55	W	48.1	Very low	52.5	Low	189 Å²	189	118.4 Å²	118.4	72%	0.716	59%	0.59	S	S	*	*	H	α-helix	trans	-63.4	-40.9	176	-70.5	109.5	0	0	0	112.3	R51 V53 V58 A59	R51-W55 PolarHBondContact O-N 3.16Å; V53-W55 PolarHBondContact O-N 3.16Å; W55-V58 PolarHBondContact O-N 3.29Å; W55-A59 WeakPolarHBondContact O-CB 3.44Å; W55-A59 PolarHBondContact O-N 3.28Å
56	R	53.3	Low	52.7	Low	179 Å²	179	118.3 Å²	118.3	68%	0.675	59%	0.589	S	S	*	*	H	α-helix	trans	-60.6	-49.6	173.5	-79.5	-173.6	172.5	-145.8	-0.4	110.6	G52 V53 A54 V58 A59 W60	G52-R56 PolarHBondContact O-N 3.03Å; G52-R56 VanDerWaalsContact O-N 3.1Å; V53-R56 PolarHBondContact O-N 2.93Å; A54-R56 PolarHBondContact O-N 3.49Å; R56-V58 VanDerWaalsContact C-N 3.31Å; R56-V58 PolarHBondContact O-N 3.29Å; R56-A59 PolarHBondContact O-N 3.49Å; R56-A59 VanDerWaalsContact O-N 3.16Å; R56-W60 PolarHBondContact O-N 3.02Å
57	G	54.3	Low	52.6	Low	39 Å²	39	110.6 Å²	110.6	40%	0.402	57%	0.567	S	S	.	*	H	α-helix	trans	-56.6	-41.3	-179.3	0	0	0	0	0	113.9	V53 A54 R61	V53-G57 PolarHBondContact O-N 3.48Å; A54-G57 PolarHBondContact O-N 3.09Å; G57-R61 PolarHBondContact O-N 3.31Å; G57-R61 VanDerWaalsContact O-N 3.15Å
58	V	55.4	Low	52.7	Low	104 Å²	104	111.6 Å²	111.6	63%	0.63	57%	0.572	S	S	*	*	H	α-helix	trans	-70.6	-41.1	177.3	177.6	0	0	0	0	111.6	A54 W55 R56 W60 R61 G62	A54-V58 WeakPolarHBondContact O-CG2 3.39Å; A54-V58 PolarHBondContact O-N 2.93Å; A54-V58 VanDerWaalsContact O-N 3.09Å; W55-V58 PolarHBondContact O-N 3.29Å; R56-V58 VanDerWaalsContact C-N 3.31Å; R56-V58 PolarHBondContact O-N 3.29Å; V58-W60 PolarHBondContact O-N 3.26Å; V58-R61 PolarHBondContact O-N 3.5Å; V58-G62 PolarHBondContact O-N 3.49Å
59	A	49.8	Very low	52.6	Low	59 Å²	59	109.9 Å²	109.9	49%	0.488	57%	0.567	S	S	.	*	H	α-helix	trans	-62.7	-42.9	177	0	0	0	0	0	111.9	W55 R56 R61 G62 V63	W55-A59 WeakPolarHBondContact O-CB 3.44Å; W55-A59 PolarHBondContact O-N 3.28Å; R56-A59 PolarHBondContact O-N 3.49Å; R56-A59 VanDerWaalsContact O-N 3.16Å; A59-R61 PolarHBondContact O-N 2.98Å; A59-G62 PolarHBondContact O-N 3.33Å; A59-V63 WeakPolarHBondContact O-CG2 3.38Å; A59-V63 PolarHBondContact O-N 3.15Å
60	W	48.2	Very low	52.7	Low	188 Å²	188	116.3 Å²	116.3	71%	0.712	58%	0.579	S	S	*	*	H	α-helix	trans	-62.9	-42	176.4	-73.5	109.8	0	0	0	112.1	R56 V58 V63 A64	R56-W60 PolarHBondContact O-N 3.02Å; V58-W60 PolarHBondContact O-N 3.26Å; W60-V63 PolarHBondContact O-N 2.99Å; W60-A64 WeakPolarHBondContact O-CB 3.35Å; W60-A64 PolarHBondContact O-N 3.35Å
61	R	53.1	Low	52.9	Low	186 Å²	186	113.6 Å²	113.6	70%	0.702	57%	0.572	S	S	*	*	H	α-helix	trans	-61	-49.4	172.8	-85.3	-174.4	171.1	-157.4	-1.7	110.9	G57 V58 A59 V63 A64 W65	G57-R61 PolarHBondContact O-N 3.31Å; G57-R61 VanDerWaalsContact O-N 3.15Å; V58-R61 PolarHBondContact O-N 3.5Å; A59-R61 PolarHBondContact O-N 2.98Å; R61-V63 VanDerWaalsContact C-N 3.31Å; R61-V63 PolarHBondContact O-N 3.18Å; R61-A64 PolarHBondContact O-N 2.91Å; R61-A64 VanDerWaalsContact O-N 3.17Å; R61-W65 PolarHBondContact O-N 3.5Å
62	G	52.3	Low	52.9	Low	34 Å²	34	106.6 Å²	106.6	35%	0.351	56%	0.559	S	S	.	*	H	α-helix	trans	-57.8	-40.2	-179.4	0	0	0	0	0	113.9	V58 A59 R66	V58-G62 PolarHBondContact O-N 3.49Å; A59-G62 PolarHBondContact O-N 3.33Å; G62-R66 WeakPolarHBondContact O-CG 2.99Å; G62-R66 PolarHBondContact O-N 3.25Å
63	V	56.1	Low	53	Low	101 Å²	101	110.4 Å²	110.4	61%	0.612	57%	0.57	S	S	*	*	H	α-helix	trans	-71.1	-41.1	176.5	176.6	0	0	0	0	111.5	A59 W60 R61 W65 R66 G67	A59-V63 WeakPolarHBondContact O-CG2 3.38Å; A59-V63 PolarHBondContact O-N 3.15Å; W60-V63 PolarHBondContact O-N 2.99Å; R61-V63 VanDerWaalsContact C-N 3.31Å; R61-V63 PolarHBondContact O-N 3.18Å; V63-W65 PolarHBondContact O-N 2.87Å; V63-R66 PolarHBondContact O-N 3.19Å; V63-G67 PolarHBondContact O-N 2.99Å
64	A	49.2	Very low	52.6	Low	64 Å²	64	108 Å²	108	53%	0.529	56%	0.561	S	S	.	*	H	α-helix	trans	-61.1	-42.4	177.2	0	0	0	0	0	112.1	W60 R61 G67 A68	W60-A64 WeakPolarHBondContact O-CB 3.35Å; W60-A64 PolarHBondContact O-N 3.35Å; R61-A64 PolarHBondContact O-N 2.91Å; R61-A64 VanDerWaalsContact O-N 3.17Å; A64-G67 PolarHBondContact O-N 3.17Å; A64-A68 WeakPolarHBondContact O-CB 3.34Å; A64-A68 PolarHBondContact O-N 2.9Å
65	W	49.4	Very low	52.5	Low	192 Å²	192	113.9 Å²	113.9	73%	0.727	57%	0.57	S	S	*	*	H	α-helix	trans	-64.7	-41.1	175.6	-69.8	110.2	0	0	0	112.3	R61 V63 A69	R61-W65 PolarHBondContact O-N 3.5Å; V63-W65 PolarHBondContact O-N 2.87Å; W65-A69 VanDerWaalsContact O-CB 3.31Å; W65-A69 WeakPolarHBondContact O-CB 3.39Å; W65-A69 PolarHBondContact O-N 2.94Å
66	R	54.3	Low	52.7	Low	189 Å²	189	113 Å²	113	71%	0.713	57%	0.566	S	S	*	*	H	α-helix	trans	-66.6	-37.5	176.1	-74.5	-177.3	-175.8	-169.6	2.1	112.2	G62 V63 R70	G62-R66 WeakPolarHBondContact O-CG 2.99Å; G62-R66 PolarHBondContact O-N 3.25Å; V63-R66 PolarHBondContact O-N 3.19Å; R66-R70 WeakPolarHBondContact O-CG 3.45Å; R66-R70 PolarHBondContact O-N 3.44Å
67	G	54.8	Low	52.7	Low	24 Å²	24	112.3 Å²	112.3	25%	0.247	56%	0.564	C	S	.	*	H	α-helix	trans	-62.5	-55.6	173.4	0	0	0	0	0	111.2	V63 A64 A69 R70 F71	V63-G67 PolarHBondContact O-N 2.99Å; A64-G67 PolarHBondContact O-N 3.17Å; G67-A69 VanDerWaalsContact C-N 3.32Å; G67-A69 PolarHBondContact O-N 2.94Å; G67-R70 PolarHBondContact O-N 3.08Å; G67-R70 VanDerWaalsContact O-N 3.08Å; G67-F71 WeakPolarHBondContact O-CD2 3.31Å; G67-F71 PolarHBondContact O-N 3.32Å
68	A	57	Low	52.7	Low	61 Å²	61	114.8 Å²	114.8	50%	0.504	57%	0.571	S	S	.	*	H	α-helix	trans	-58.8	-40.5	-178.9	0	0	0	0	0	112.8	A64 R70 F71 G72	A64-A68 WeakPolarHBondContact O-CB 3.34Å; A64-A68 PolarHBondContact O-N 2.9Å; A68-R70 PolarHBondContact O-N 3.35Å; A68-F71 PolarHBondContact O-N 3.49Å; A68-G72 PolarHBondContact O-N 3.05Å
69	A	52.8	Low	52.4	Low	56 Å²	56	112.7 Å²	112.7	46%	0.463	57%	0.565	S	S	.	*	H	α-helix	trans	-64.1	-40.1	175.8	0	0	0	0	0	112.2	W65 G67 G72 L73	W65-A69 VanDerWaalsContact O-CB 3.31Å; W65-A69 WeakPolarHBondContact O-CB 3.39Å; W65-A69 PolarHBondContact O-N 2.94Å; G67-A69 VanDerWaalsContact C-N 3.32Å; G67-A69 PolarHBondContact O-N 2.94Å; A69-G72 PolarHBondContact O-N 2.96Å; A69-L73 WeakPolarHBondContact O-CG 3.43Å; A69-L73 PolarHBondContact O-N 3.13Å
70	R	53.3	Low	52.5	Low	196 Å²	196	115 Å²	115	74%	0.74	57%	0.565	S	S	*	*	H	α-helix	trans	-66.3	-41.8	175.5	-75.2	-174.9	-177.3	-177.6	0.4	112.1	R66 G67 A68 L73 A74	R66-R70 WeakPolarHBondContact O-CG 3.45Å; R66-R70 PolarHBondContact O-N 3.44Å; G67-R70 PolarHBondContact O-N 3.08Å; G67-R70 VanDerWaalsContact O-N 3.08Å; A68-R70 PolarHBondContact O-N 3.35Å; R70-L73 PolarHBondContact O-N 3.01Å; R70-A74 WeakPolarHBondContact O-CB 3.32Å; R70-A74 PolarHBondContact O-N 3.5Å
71	F	54.3	Low	52.5	Low	138 Å²	138	112.7 Å²	112.7	61%	0.605	56%	0.558	S	S	*	*	H	α-helix	trans	-64.9	-45.4	175.5	-70.5	-66.7	0	0	0	111.3	G67 A68 L73 A74 W75	G67-F71 WeakPolarHBondContact O-CD2 3.31Å; G67-F71 PolarHBondContact O-N 3.32Å; A68-F71 PolarHBondContact O-N 3.49Å; F71-L73 VanDerWaalsContact C-N 3.33Å; F71-L73 PolarHBondContact O-N 2.85Å; F71-A74 WeakPolarHBondContact O-CB 3.4Å; F71-A74 PolarHBondContact O-N 3.36Å; F71-A74 VanDerWaalsContact O-N 3.13Å; F71-W75 PolarHBondContact O-N 3.5Å
72	G	55.4	Low	52.4	Low	41 Å²	41	106.1 Å²	106.1	42%	0.423	55%	0.548	S	S	.	.	H	α-helix	trans	-58	-42.4	177.5	0	0	0	0	0	113.1	A68 A69 R76	A68-G72 PolarHBondContact O-N 3.05Å; A69-G72 PolarHBondContact O-N 2.96Å; G72-R76 WeakPolarHBondContact O-CB 3.49Å; G72-R76 PolarHBondContact O-N 2.97Å
73	L	56.8	Low	52.5	Low	116 Å²	116	108.8 Å²	108.8	61%	0.607	56%	0.557	S	S	*	*	H	α-helix	trans	-68.1	-37.4	175.4	-70.1	171.9	0	0	0	112.7	A69 R70 F71 R76 R77	A69-L73 WeakPolarHBondContact O-CG 3.43Å; A69-L73 PolarHBondContact O-N 3.13Å; R70-L73 PolarHBondContact O-N 3.01Å; F71-L73 VanDerWaalsContact C-N 3.33Å; F71-L73 PolarHBondContact O-N 2.85Å; L73-R76 PolarHBondContact O-N 3.21Å; L73-R77 PolarHBondContact O-N 3.4Å
74	A	47.2	Very low	52.1	Low	51 Å²	51	107.9 Å²	107.9	42%	0.421	55%	0.551	S	S	.	*	H	α-helix	trans	-63.7	-46.7	176.1	0	0	0	0	0	111.4	R70 F71 R76 R77 V78	R70-A74 WeakPolarHBondContact O-CB 3.32Å; R70-A74 PolarHBondContact O-N 3.5Å; F71-A74 WeakPolarHBondContact O-CB 3.4Å; F71-A74 PolarHBondContact O-N 3.36Å; F71-A74 VanDerWaalsContact O-N 3.13Å; A74-R76 VanDerWaalsContact C-N 3.31Å; A74-R76 PolarHBondContact O-N 3.03Å; A74-R77 PolarHBondContact O-N 3.37Å; A74-V78 WeakPolarHBondContact O-CG2 3.5Å; A74-V78 PolarHBondContact O-N 3.42Å
75	W	47.9	Very low	51.7	Low	184 Å²	184	113.5 Å²	113.5	70%	0.697	56%	0.559	S	S	*	*	H	α-helix	trans	-61.3	-39.3	175.4	-70.4	114.3	0	0	0	112.1	F71 R77 V78 A79	F71-W75 PolarHBondContact O-N 3.5Å; W75-R77 PolarHBondContact O-N 3.06Å; W75-V78 PolarHBondContact O-N 3.07Å; W75-A79 WeakPolarHBondContact O-CB 3.33Å; W75-A79 PolarHBondContact O-N 3.36Å
76	R	52.5	Low	51.7	Low	171 Å²	171	106.1 Å²	106.1	65%	0.645	54%	0.543	S	S	*	.	H	α-helix	trans	-63.3	-39.9	176.4	-129.7	173.8	-175.5	-100.2	0	112.3	G72 L73 A74 Q80	G72-R76 WeakPolarHBondContact O-CB 3.49Å; G72-R76 PolarHBondContact O-N 2.97Å; L73-R76 PolarHBondContact O-N 3.21Å; A74-R76 VanDerWaalsContact C-N 3.31Å; A74-R76 PolarHBondContact O-N 3.03Å; R76-Q80 VanDerWaalsContact O-CG 3.24Å; R76-Q80 WeakPolarHBondContact O-CG 3.24Å; R76-Q80 PolarHBondContact O-N 3.47Å
77	R	53.4	Low	51.8	Low	164 Å²	164	102 Å²	102	62%	0.619	54%	0.535	S	S	*	.	H	α-helix	trans	-66.7	-46.6	174.7	-74.1	-163.4	-172.5	-160.2	3.4	111.7	L73 A74 W75 A79 Q80 Y81	L73-R77 PolarHBondContact O-N 3.4Å; A74-R77 PolarHBondContact O-N 3.37Å; W75-R77 PolarHBondContact O-N 3.06Å; R77-A79 VanDerWaalsContact C-N 3.33Å; R77-A79 PolarHBondContact O-N 2.89Å; R77-Q80 WeakPolarHBondContact O-CB 3.46Å; R77-Q80 PolarHBondContact O-N 2.95Å; R77-Q80 VanDerWaalsContact O-N 3.15Å; R77-Y81 HydrophobicContact CB-CE2 4.2Å; R77-Y81 WeakPolarHBondContact O-CD2 3.33Å; R77-Y81 PolarHBondContact O-N 3.15Å
78	V	53.2	Low	51.9	Low	92 Å²	92	105.4 Å²	105.4	56%	0.558	55%	0.551	S	S	*	*	H	α-helix	trans	-61.3	-41.9	178.9	175.9	0	0	0	0	111.3	A74 W75 Q80 Y81 G82	A74-V78 WeakPolarHBondContact O-CG2 3.5Å; A74-V78 PolarHBondContact O-N 3.42Å; W75-V78 PolarHBondContact O-N 3.07Å; V78-Q80 VanDerWaalsContact C-N 3.34Å; V78-Q80 PolarHBondContact O-N 3.05Å; V78-Y81 PolarHBondContact O-N 2.91Å; V78-G82 PolarHBondContact O-N 3.46Å
79	A	48.4	Very low	51.7	Low	60 Å²	60	106 Å²	106	50%	0.496	55%	0.548	S	S	.	.	H	α-helix	trans	-62.7	-39.9	175.1	0	0	0	0	0	112.2	W75 R77 G82 V83	W75-A79 WeakPolarHBondContact O-CB 3.33Å; W75-A79 PolarHBondContact O-N 3.36Å; R77-A79 VanDerWaalsContact C-N 3.33Å; R77-A79 PolarHBondContact O-N 2.89Å; A79-G82 PolarHBondContact O-N 3.01Å; A79-V83 WeakPolarHBondContact O-CG2 2.99Å; A79-V83 PolarHBondContact O-N 2.9Å
80	Q	53.2	Low	51.2	Low	107 Å²	107	110.4 Å²	110.4	50%	0.5	55%	0.553	S	S	.	*	H	α-helix	trans	-63.4	-43.9	174.8	-75	172.1	15.7	0	0	111.8	R76 R77 V78 V83 V84	R76-Q80 VanDerWaalsContact O-CG 3.24Å; R76-Q80 WeakPolarHBondContact O-CG 3.24Å; R76-Q80 PolarHBondContact O-N 3.47Å; R77-Q80 WeakPolarHBondContact O-CB 3.46Å; R77-Q80 PolarHBondContact O-N 2.95Å; R77-Q80 VanDerWaalsContact O-N 3.15Å; V78-Q80 VanDerWaalsContact C-N 3.34Å; V78-Q80 PolarHBondContact O-N 3.05Å; Q80-V83 PolarHBondContact O-N 3.26Å; Q80-V84 VanDerWaalsContact O-CG2 3.28Å; Q80-V84 WeakPolarHBondContact O-CG2 3.35Å; Q80-V84 PolarHBondContact O-N 3.34Å
81	Y	47.7	Very low	51.5	Low	140 Å²	140	102.4 Å²	102.4	55%	0.549	53%	0.531	S	S	.	.	H	α-helix	trans	-61	-47.1	174	-69.2	-67.3	0	0	0	110.8	R77 V78 V83 V84 W85	R77-Y81 HydrophobicContact CB-CE2 4.2Å; R77-Y81 WeakPolarHBondContact O-CD2 3.33Å; R77-Y81 PolarHBondContact O-N 3.15Å; V78-Y81 PolarHBondContact O-N 2.91Å; Y81-V83 VanDerWaalsContact C-N 3.29Å; Y81-V83 PolarHBondContact O-N 3.29Å; Y81-V84 PolarHBondContact O-N 3.35Å; Y81-W85 PolarHBondContact O-N 2.98Å
82	G	51.6	Low	51.6	Low	48 Å²	48	98.6 Å²	98.6	50%	0.495	53%	0.525	S	S	.	.	H	α-helix	trans	-55.2	-41.5	177.3	0	0	0	0	0	113.6	V78 A79 G86	V78-G82 PolarHBondContact O-N 3.46Å; A79-G82 PolarHBondContact O-N 3.01Å; G82-G86 PolarHBondContact O-N 2.95Å
83	V	54.9	Low	51	Low	89 Å²	89	105.7 Å²	105.7	54%	0.539	54%	0.539	S	S	.	.	H	α-helix	trans	-67.7	-40.7	175.6	173.7	0	0	0	0	111.7	A79 Q80 Y81 G86 N87	A79-V83 WeakPolarHBondContact O-CG2 2.99Å; A79-V83 PolarHBondContact O-N 2.9Å; Q80-V83 PolarHBondContact O-N 3.26Å; Y81-V83 VanDerWaalsContact C-N 3.29Å; Y81-V83 PolarHBondContact O-N 3.29Å; V83-G86 PolarHBondContact O-N 2.93Å; V83-N87 WeakPolarHBondContact O-CB 3.28Å; V83-N87 VanDerWaalsContact O-CG 3.26Å; V83-N87 PolarHBondContact O-N 3.11Å; V83-N87 PolarHBondContact O-ND2 3.29Å; V83-N87 VanDerWaalsContact O-ND2 3.11Å
84	V	47.7	Very low	50.5	Low	82 Å²	82	105.1 Å²	105.1	50%	0.497	53%	0.529	S	S	.	.	H	α-helix	trans	-63.2	-46.2	176.9	172.6	0	0	0	0	111	Q80 Y81 G86 N87 V88	Q80-V84 VanDerWaalsContact O-CG2 3.28Å; Q80-V84 WeakPolarHBondContact O-CG2 3.35Å; Q80-V84 PolarHBondContact O-N 3.34Å; Y81-V84 PolarHBondContact O-N 3.35Å; V84-G86 PolarHBondContact O-N 3.43Å; V84-N87 PolarHBondContact O-N 2.85Å; V84-V88 WeakPolarHBondContact O-CG2 3.48Å; V84-V88 PolarHBondContact O-N 3.27Å
85	W	39.2	Very low	50.8	Low	182 Å²	182	106.2 Å²	106.2	69%	0.689	53%	0.534	S	S	*	.	H	α-helix	trans	-63.1	-41.7	176.1	-77.9	86.8	0	0	0	111.5	Y81 N87 V88 V89	Y81-W85 PolarHBondContact O-N 2.98Å; W85-N87 VanDerWaalsContact C-N 3.34Å; W85-N87 PolarHBondContact O-N 2.91Å; W85-V88 PolarHBondContact O-N 2.96Å; W85-V89 VanDerWaalsContact O-CG2 3.31Å; W85-V89 WeakPolarHBondContact O-CG2 3.31Å; W85-V89 PolarHBondContact O-N 3.49Å
86	G	50.4	Low	51.2	Low	38 Å²	38	100.5 Å²	100.5	39%	0.392	53%	0.526	S	S	.	.	H	α-helix	trans	-59	-43	174.4	0	0	0	0	0	112.8	G82 V83 V84 W90	G82-G86 PolarHBondContact O-N 2.95Å; V83-G86 PolarHBondContact O-N 2.93Å; V84-G86 PolarHBondContact O-N 3.43Å; G86-W90 WeakPolarHBondContact O-CB 3.46Å; G86-W90 PolarHBondContact O-N 3.35Å
87	N	56.3	Low	51.4	Low	103 Å²	103	101.5 Å²	101.5	55%	0.551	53%	0.53	S	S	*	.	H	α-helix	trans	-68.1	-37.8	177.4	-72.1	-34.7	0	0	0	112.7	V83 V84 W85 G91	V83-N87 WeakPolarHBondContact O-CB 3.28Å; V83-N87 VanDerWaalsContact O-CG 3.26Å; V83-N87 PolarHBondContact O-N 3.11Å; V83-N87 PolarHBondContact O-ND2 3.29Å; V83-N87 VanDerWaalsContact O-ND2 3.11Å; V84-N87 PolarHBondContact O-N 2.85Å; W85-N87 VanDerWaalsContact C-N 3.34Å; W85-N87 PolarHBondContact O-N 2.91Å; N87-G91 WeakPolarHBondContact O-CA 3.21Å; N87-G91 PolarHBondContact O-N 2.87Å
88	V	56.3	Low	51.3	Low	95 Å²	95	99.8 Å²	99.8	58%	0.576	53%	0.527	S	S	*	.	H	α-helix	trans	-67.4	-44.3	176.5	172.7	0	0	0	0	110.7	V84 W85 G91 A92	V84-V88 WeakPolarHBondContact O-CG2 3.48Å; V84-V88 PolarHBondContact O-N 3.27Å; W85-V88 PolarHBondContact O-N 2.96Å; V88-G91 PolarHBondContact O-N 3.47Å; V88-A92 VanDerWaalsContact O-CB 3.32Å; V88-A92 WeakPolarHBondContact O-CB 3.32Å; V88-A92 PolarHBondContact O-N 2.8Å
89	V	53.8	Low	51.3	Low	74 Å²	74	99.9 Å²	99.9	45%	0.448	53%	0.527	S	S	.	.	H	α-helix	trans	-64.4	-49.2	176.5	175.6	0	0	0	0	109.9	W85 G91 A92 W93	W85-V89 VanDerWaalsContact O-CG2 3.31Å; W85-V89 WeakPolarHBondContact O-CG2 3.31Å; W85-V89 PolarHBondContact O-N 3.49Å; V89-G91 VanDerWaalsContact C-N 3.33Å; V89-G91 PolarHBondContact O-N 2.92Å; V89-A92 PolarHBondContact O-N 3.41Å; V89-W93 WeakPolarHBondContact O-CB 3.45Å; V89-W93 PolarHBondContact O-N 3.25Å
90	W	42.6	Very low	51	Low	148 Å²	148	106.5 Å²	106.5	56%	0.561	54%	0.539	S	S	*	.	H	α-helix	trans	-62.1	-41.7	179	-162.6	79.6	0	0	0	111.8	G86 W93 W94	G86-W90 WeakPolarHBondContact O-CB 3.46Å; G86-W90 PolarHBondContact O-N 3.35Å; W90-W93 PolarHBondContact O-N 3.39Å; W90-W94 AromaticContact CD2-CD1 3.45Å; W90-W94 VanDerWaalsContact CD2-CD1 3.45Å; W90-W94 HydrophobicContact CD2-CG 4.46Å; W90-W94 AromaticContact CD2-NE1 3.5Å; W90-W94 AromaticContact CE2-CD1 3.47Å; W90-W94 VanDerWaalsContact CE2-CD1 3.47Å; W90-W94 AromaticContact CE2-CE2 3.92Å; W90-W94 AromaticContact CE2-NE1 2.97Å; W90-W94 AromaticContact CE3-CD1 3.71Å; W90-W94 HydrophobicContact CE3-CG 4.34Å; W90-W94 AromaticContact CE3-NE1 3.9Å; W90-W94 AromaticContact CG-CD1 3.99Å; W90-W94 AromaticContact CH2-CD1 4Å; W90-W94 HydrophobicContact CH2-CD2 4.23Å; W90-W94 AromaticContact CH2-CE2 3.53Å; W90-W94 HydrophobicContact CH2-CG 4.49Å; W90-W94 AromaticContact CH2-CZ2 3.78Å; W90-W94 HydrophobicContact CH2-CZ2 3.78Å; W90-W94 AromaticContact CH2-NE1 3.4Å; W90-W94 AromaticContact CZ2-CD1 3.79Å; W90-W94 HydrophobicContact CZ2-CD2 4.45Å; W90-W94 AromaticContact CZ2-CE2 3.43Å; W90-W94 VanDerWaalsContact CZ2-CE2 3.43Å; W90-W94 AromaticContact CZ2-CZ2 3.67Å; W90-W94 HydrophobicContact CZ2-CZ2 3.67Å; W90-W94 AromaticContact CZ2-NE1 2.95Å; W90-W94 AromaticContact CZ3-CD1 3.96Å; W90-W94 HydrophobicContact CZ3-CD2 4.45Å; W90-W94 HydrophobicContact CZ3-CG 4.34Å; W90-W94 AromaticContact CZ3-NE1 3.85Å; W90-W94 AromaticContact NE1-CD1 3.89Å; W90-W94 AromaticContact NE1-NE1 3.41Å; W90-W94 WeakPolarHBondContact O-CB 3.48Å; W90-W94 PolarHBondContact O-N 3.33Å
91	G	58.4	Low	50.8	Low	28 Å²	28	103.4 Å²	103.4	29%	0.289	53%	0.53	S	S	.	.	H	α-helix	trans	-59.7	-48.3	174	0	0	0	0	0	112.4	N87 V88 V89 W93 W94 S95	N87-G91 WeakPolarHBondContact O-CA 3.21Å; N87-G91 PolarHBondContact O-N 2.87Å; V88-G91 PolarHBondContact O-N 3.47Å; V89-G91 VanDerWaalsContact C-N 3.33Å; V89-G91 PolarHBondContact O-N 2.92Å; G91-W93 VanDerWaalsContact C-N 3.33Å; G91-W93 PolarHBondContact O-N 2.86Å; G91-W94 PolarHBondContact O-N 3.03Å; G91-S95 WeakPolarHBondContact O-CB 3.19Å; G91-S95 PolarHBondContact O-N 3.36Å; G91-S95 PolarHBondContact O-OG 3.34Å
92	A	56.5	Low	51	Low	58 Å²	58	98.5 Å²	98.5	48%	0.479	52%	0.521	S	S	.	.	H	α-helix	trans	-61.8	-40	177.1	0	0	0	0	0	112.3	V88 V89 S95 A96	V88-A92 VanDerWaalsContact O-CB 3.32Å; V88-A92 WeakPolarHBondContact O-CB 3.32Å; V88-A92 PolarHBondContact O-N 2.8Å; V89-A92 PolarHBondContact O-N 3.41Å; A92-S95 PolarHBondContact O-N 3.39Å; A92-A96 VanDerWaalsContact O-CB 3.28Å; A92-A96 WeakPolarHBondContact O-CB 3.39Å; A92-A96 PolarHBondContact O-N 3.21Å
93	W	42.3	Very low	51.1	Low	190 Å²	190	100.2 Å²	100.2	72%	0.72	52%	0.522	S	S	*	.	H	α-helix	trans	-66.3	-39.8	175.3	-79.5	58.3	0	0	0	112.1	V89 W90 G91 R97	V89-W93 WeakPolarHBondContact O-CB 3.45Å; V89-W93 PolarHBondContact O-N 3.25Å; W90-W93 PolarHBondContact O-N 3.39Å; G91-W93 VanDerWaalsContact C-N 3.33Å; G91-W93 PolarHBondContact O-N 2.86Å; W93-R97 VanDerWaalsContact O-CB 3.23Å; W93-R97 WeakPolarHBondContact O-CB 3.39Å; W93-R97 PolarHBondContact O-N 2.94Å
94	W	46.4	Very low	50.4	Low	103 Å²	103	101.9 Å²	101.9	39%	0.39	52%	0.519	S	S	.	.	H	α-helix	trans	-67.8	-43.6	174.8	-89.7	75.7	0	0	0	112.2	W90 G91 R97 F98	W90-W94 AromaticContact CD2-CD1 3.45Å; W90-W94 VanDerWaalsContact CD2-CD1 3.45Å; W90-W94 HydrophobicContact CD2-CG 4.46Å; W90-W94 AromaticContact CD2-NE1 3.5Å; W90-W94 AromaticContact CE2-CD1 3.47Å; W90-W94 VanDerWaalsContact CE2-CD1 3.47Å; W90-W94 AromaticContact CE2-CE2 3.92Å; W90-W94 AromaticContact CE2-NE1 2.97Å; W90-W94 AromaticContact CE3-CD1 3.71Å; W90-W94 HydrophobicContact CE3-CG 4.34Å; W90-W94 AromaticContact CE3-NE1 3.9Å; W90-W94 AromaticContact CG-CD1 3.99Å; W90-W94 AromaticContact CH2-CD1 4Å; W90-W94 HydrophobicContact CH2-CD2 4.23Å; W90-W94 AromaticContact CH2-CE2 3.53Å; W90-W94 HydrophobicContact CH2-CG 4.49Å; W90-W94 AromaticContact CH2-CZ2 3.78Å; W90-W94 HydrophobicContact CH2-CZ2 3.78Å; W90-W94 AromaticContact CH2-NE1 3.4Å; W90-W94 AromaticContact CZ2-CD1 3.79Å; W90-W94 HydrophobicContact CZ2-CD2 4.45Å; W90-W94 AromaticContact CZ2-CE2 3.43Å; W90-W94 VanDerWaalsContact CZ2-CE2 3.43Å; W90-W94 AromaticContact CZ2-CZ2 3.67Å; W90-W94 HydrophobicContact CZ2-CZ2 3.67Å; W90-W94 AromaticContact CZ2-NE1 2.95Å; W90-W94 AromaticContact CZ3-CD1 3.96Å; W90-W94 HydrophobicContact CZ3-CD2 4.45Å; W90-W94 HydrophobicContact CZ3-CG 4.34Å; W90-W94 AromaticContact CZ3-NE1 3.85Å; W90-W94 AromaticContact NE1-CD1 3.89Å; W90-W94 AromaticContact NE1-NE1 3.41Å; W90-W94 WeakPolarHBondContact O-CB 3.48Å; W90-W94 PolarHBondContact O-N 3.33Å; G91-W94 PolarHBondContact O-N 3.03Å; W94-R97 PolarHBondContact O-N 2.88Å; W94-F98 AromaticContact CE3-CD2 3.96Å; W94-F98 HydrophobicContact CE3-CD2 3.96Å; W94-F98 AromaticContact CE3-CE2 3.71Å; W94-F98 HydrophobicContact CE3-CE2 3.71Å; W94-F98 HydrophobicContact CZ3-CD2 4.45Å; W94-F98 AromaticContact CZ3-CE2 3.75Å; W94-F98 HydrophobicContact CZ3-CE2 3.75Å; W94-F98 WeakPolarHBondContact O-CB 3.28Å; W94-F98 PolarHBondContact O-N 2.87Å
95	S	54.4	Low	50	Low	75 Å²	75	101.7 Å²	101.7	52%	0.524	52%	0.52	S	S	.	.	H	α-helix	trans	-62.7	-47.2	176.2	-61.3	0	0	0	0	111.3	G91 A92 R97 F98 V99	G91-S95 WeakPolarHBondContact O-CB 3.19Å; G91-S95 PolarHBondContact O-N 3.36Å; G91-S95 PolarHBondContact O-OG 3.34Å; A92-S95 PolarHBondContact O-N 3.39Å; S95-R97 VanDerWaalsContact C-N 3.31Å; S95-R97 PolarHBondContact O-N 3.48Å; S95-F98 PolarHBondContact O-N 2.8Å; S95-V99 WeakPolarHBondContact O-CB 3.38Å; S95-V99 WeakPolarHBondContact O-CG2 3.44Å; S95-V99 PolarHBondContact O-N 2.82Å
96	A	56.3	Low	50.6	Low	63 Å²	63	99.1 Å²	99.1	52%	0.521	52%	0.524	S	S	.	.	H	α-helix	trans	-61	-41.1	176.7	0	0	0	0	0	111.7	A92 W100	A92-A96 VanDerWaalsContact O-CB 3.28Å; A92-A96 WeakPolarHBondContact O-CB 3.39Å; A92-A96 PolarHBondContact O-N 3.21Å; A96-W100 WeakPolarHBondContact O-CB 3.23Å; A96-W100 PolarHBondContact O-N 3Å
97	R	55.6	Low	50.5	Low	193 Å²	193	103 Å²	103	73%	0.728	54%	0.54	S	S	*	.	H	α-helix	trans	-71.8	-36.7	179.1	-171.2	163.6	-175.6	147.7	2.3	113.2	W93 W94 S95 C101	W93-R97 VanDerWaalsContact O-CB 3.23Å; W93-R97 WeakPolarHBondContact O-CB 3.39Å; W93-R97 PolarHBondContact O-N 2.94Å; W94-R97 PolarHBondContact O-N 2.88Å; S95-R97 VanDerWaalsContact C-N 3.31Å; S95-R97 PolarHBondContact O-N 3.48Å; R97-C101 VanDerWaalsContact O-CB 3.29Å; R97-C101 WeakPolarHBondContact O-CB 3.18Å; R97-C101 PolarHBondContact O-N 3.12Å
98	F	51.5	Low	49.9	Very low	128 Å²	128	99.7 Å²	99.7	56%	0.561	53%	0.53	S	S	*	.	H	α-helix	trans	-69.1	-39.2	173.5	-106.6	-87.9	0	0	0	112	W94 S95 W100 C101 G102	W94-F98 AromaticContact CE3-CD2 3.96Å; W94-F98 HydrophobicContact CE3-CD2 3.96Å; W94-F98 AromaticContact CE3-CE2 3.71Å; W94-F98 HydrophobicContact CE3-CE2 3.71Å; W94-F98 HydrophobicContact CZ3-CD2 4.45Å; W94-F98 AromaticContact CZ3-CE2 3.75Å; W94-F98 HydrophobicContact CZ3-CE2 3.75Å; W94-F98 WeakPolarHBondContact O-CB 3.28Å; W94-F98 PolarHBondContact O-N 2.87Å; S95-F98 PolarHBondContact O-N 2.8Å; F98-W100 VanDerWaalsContact C-N 3.34Å; F98-C101 PolarHBondContact O-N 2.85Å; F98-G102 WeakPolarHBondContact O-CA 3.17Å; F98-G102 PolarHBondContact O-N 3.36Å
99	V	54.4	Low	49.1	Very low	94 Å²	94	102 Å²	102	57%	0.57	55%	0.549	S	S	*	.	H	α-helix	trans	-64.4	-42.9	175	171.7	0	0	0	0	109.8	S95 C101 G102 V103	S95-V99 WeakPolarHBondContact O-CB 3.38Å; S95-V99 WeakPolarHBondContact O-CG2 3.44Å; S95-V99 PolarHBondContact O-N 2.82Å; V99-C101 PolarHBondContact O-N 3.48Å; V99-G102 PolarHBondContact O-N 2.73Å; V99-V103 HydrophobicContact CG1-CG2 4.16Å; V99-V103 WeakPolarHBondContact O-CB 3.35Å; V99-V103 WeakPolarHBondContact O-CG2 3.49Å; V99-V103 PolarHBondContact O-N 3.38Å
100	W	42	Very low	48.6	Very low	198 Å²	198	100.2 Å²	100.2	75%	0.75	55%	0.546	S	S	*	.	H	α-helix	trans	-67.2	-37.4	177.3	-144.9	63	0	0	0	112.7	A96 F98 R104	A96-W100 WeakPolarHBondContact O-CB 3.23Å; A96-W100 PolarHBondContact O-N 3Å; F98-W100 VanDerWaalsContact C-N 3.34Å; W100-R104 WeakPolarHBondContact O-CB 3.49Å; W100-R104 PolarHBondContact O-N 2.9Å; W100-R104 VanDerWaalsContact O-N 3.12Å
101	C	48.2	Very low	49	Very low	43 Å²	43	99.9 Å²	99.9	29%	0.291	56%	0.56	S	S	.	*	H	α-helix	trans	-70	-41	174.1	-156.2	0	0	0	0	111.8	R97 F98 V99 R104 C105 C115	R97-C101 VanDerWaalsContact O-CB 3.29Å; R97-C101 WeakPolarHBondContact O-CB 3.18Å; R97-C101 PolarHBondContact O-N 3.12Å; F98-C101 PolarHBondContact O-N 2.85Å; V99-C101 PolarHBondContact O-N 3.48Å; C101-R104 PolarHBondContact O-N 3.24Å; C101-C105 WeakPolarHBondContact O-CB 3.29Å; C101-C105 PolarHBondContact O-N 3.49Å; C101-C105 PolarHBondContact O-SG 3.5Å; C101-C115 VanDerWaalsContact SG-SG 3.63Å
102	G	52.6	Low	48.4	Very low	36 Å²	36	102 Å²	102	37%	0.371	56%	0.564	S	S	.	*	H	α-helix	trans	-67	-44.5	179.2	0	0	0	0	0	112.5	F98 V99 R104 C105 V106	F98-G102 WeakPolarHBondContact O-CA 3.17Å; F98-G102 PolarHBondContact O-N 3.36Å; V99-G102 PolarHBondContact O-N 2.73Å; G102-R104 VanDerWaalsContact C-N 3.33Å; G102-R104 PolarHBondContact O-N 3.09Å; G102-C105 PolarHBondContact O-N 3.46Å; G102-V106 WeakPolarHBondContact O-CG2 3.28Å; G102-V106 PolarHBondContact O-N 3.04Å; G102-V106 VanDerWaalsContact O-N 3.13Å
103	V	52.9	Low	48.2	Very low	85 Å²	85	104.3 Å²	104.3	52%	0.515	57%	0.574	S	S	.	*	H	α-helix	trans	-65.8	-38.2	176.4	176.4	0	0	0	0	110.7	V99 V106 V107	V99-V103 HydrophobicContact CG1-CG2 4.16Å; V99-V103 WeakPolarHBondContact O-CB 3.35Å; V99-V103 WeakPolarHBondContact O-CG2 3.49Å; V99-V103 PolarHBondContact O-N 3.38Å; V103-V106 PolarHBondContact O-N 3.33Å; V103-V107 WeakPolarHBondContact O-CG2 3.49Å; V103-V107 PolarHBondContact O-N 3.28Å; V103-V107 VanDerWaalsContact O-N 3.07Å
104	R	39.9	Very low	48.5	Very low	124 Å²	124	104.8 Å²	104.8	47%	0.468	58%	0.576	S	S	.	*	H	α-helix	trans	-72.7	-30.9	177	-170.9	155.6	151.4	77.5	-16.9	113.3	W100 C101 G102 V106 G108 D112	W100-R104 WeakPolarHBondContact O-CB 3.49Å; W100-R104 PolarHBondContact O-N 2.9Å; W100-R104 VanDerWaalsContact O-N 3.12Å; C101-R104 PolarHBondContact O-N 3.24Å; G102-R104 VanDerWaalsContact C-N 3.33Å; G102-R104 PolarHBondContact O-N 3.09Å; R104-V106 VanDerWaalsContact C-N 3.34Å; R104-G108 PolarHBondContact O-N 3.38Å; R104-G108 VanDerWaalsContact O-N 3.14Å; R104-D112 IonicContact CZ-OD1 3.75Å; R104-D112 IonicContact CZ-OD2 2.94Å; R104-D112 IonicContact NE-OD2 3.73Å; R104-D112 IonicContact NH1-OD2 3.16Å; R104-D112 PolarHBondContact NH1-OD2 3.2Å; R104-D112 VanDerWaalsContact NH1-OD2 3.16Å; R104-D112 IonicContact NH2-OD1 2.7Å; R104-D112 PolarHBondContact NH2-OD1 3.07Å; R104-D112 IonicContact NH2-OD2 2.68Å; R104-D112 PolarHBondContact NH2-OD2 3.33Å
105	C	39.7	Very low	48.6	Very low	78 Å²	78	102.4 Å²	102.4	53%	0.527	58%	0.575	S	S	.	*	H	α-helix	trans	-67.8	-31.7	171	-75	0	0	0	0	112.7	C101 G102	C101-C105 WeakPolarHBondContact O-CB 3.29Å; C101-C105 PolarHBondContact O-N 3.49Å; C101-C105 PolarHBondContact O-SG 3.5Å; G102-C105 PolarHBondContact O-N 3.46Å
106	V	51.5	Low	48.5	Very low	127 Å²	127	102.9 Å²	102.9	77%	0.77	58%	0.578	S	S	*	*	H	α-helix	trans	-79.1	-36.2	177.4	176.4	0	0	0	0	111.7	G102 V103 R104	G102-V106 WeakPolarHBondContact O-CG2 3.28Å; G102-V106 PolarHBondContact O-N 3.04Å; G102-V106 VanDerWaalsContact O-N 3.13Å; V103-V106 PolarHBondContact O-N 3.33Å; R104-V106 VanDerWaalsContact C-N 3.34Å
107	V	49	Very low	48.5	Very low	120 Å²	120	105.3 Å²	105.3	73%	0.727	58%	0.582	S	S	*	*	H	α-helix	trans	-95.9	-8.5	-170.5	-177.9	0	0	0	0	113.8	V103	V103-V107 WeakPolarHBondContact O-CG2 3.49Å; V103-V107 PolarHBondContact O-N 3.28Å; V103-V107 VanDerWaalsContact O-N 3.07Å
108	G	43.8	Very low	48.5	Very low	34 Å²	34	102.9 Å²	102.9	35%	0.351	58%	0.577	S	S	.	*			trans	-160.2	91.6	178.6	0	0	0	0	0	114.2	R104 G110	R104-G108 PolarHBondContact O-N 3.38Å; R104-G108 VanDerWaalsContact O-N 3.14Å; G108-G110 PolarHBondContact O-N 2.94Å
109	C	39.1	Very low	48.5	Very low	142 Å²	142	101 Å²	101	96%	0.959	57%	0.572	S	S	*	*			trans	-67.6	54.5	151.6	-75.4	0	0	0	0	110.6
110	G	43.4	Very low	48.5	Very low	38 Å²	38	99.2 Å²	99.2	39%	0.392	56%	0.562	S	S	.	*	S	Bend	trans	-135.3	91.6	-176.8	0	0	0	0	0	111	G108	G108-G110 PolarHBondContact O-N 2.94Å
111	V	50.3	Low	49.3	Very low	141 Å²	141	92.7 Å²	92.7	86%	0.855	54%	0.544	S	S	*	.			trans	68.4	33.1	148.9	-54.5	0	0	0	0	121.5	P113	V111-P113 WeakPolarHBondContact O-CD 3.42Å
112	D	45.9	Very low	49.7	Very low	71 Å²	71	92.3 Å²	92.3	38%	0.38	54%	0.544	S	S	.	.			trans	-104	91.4	167	-63.4	-79.8	0	0	0	113.4	R104 W114 C115	R104-D112 IonicContact CZ-OD1 3.75Å; R104-D112 IonicContact CZ-OD2 2.94Å; R104-D112 IonicContact NE-OD2 3.73Å; R104-D112 IonicContact NH1-OD2 3.16Å; R104-D112 PolarHBondContact NH1-OD2 3.2Å; R104-D112 VanDerWaalsContact NH1-OD2 3.16Å; R104-D112 IonicContact NH2-OD1 2.7Å; R104-D112 PolarHBondContact NH2-OD1 3.07Å; R104-D112 IonicContact NH2-OD2 2.68Å; R104-D112 PolarHBondContact NH2-OD2 3.33Å; D112-W114 PolarHBondContact O-N 3.35Å; D112-C115 PolarHBondContact O-N 2.86Å
113	P	53.2	Low	50	Low	107 Å²	107	97.3 Å²	97.3	70%	0.695	56%	0.558	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.3	-13.4	174.2	18.2	-26.2	0	0	0	113.5	V111 C115	V111-P113 WeakPolarHBondContact O-CD 3.42Å; P113-C115 VanDerWaalsContact C-N 3.32Å; P113-C115 PolarHBondContact O-N 3.48Å
114	W	49.2	Very low	50.2	Low	201 Å²	201	100.9 Å²	100.9	76%	0.761	56%	0.562	S	S	*	*	H	α-helix	trans	-73	-18.2	179.8	-119.8	59.4	0	0	0	114.9	D112	D112-W114 PolarHBondContact O-N 3.35Å
115	C	48.2	Very low	51.2	Low	52 Å²	52	103.4 Å²	103.4	35%	0.351	57%	0.572	S	S	.	*	H	α-helix	trans	-79.1	-34.6	-176.6	-137.6	0	0	0	0	113	C101 D112 P113	C101-C115 VanDerWaalsContact SG-SG 3.63Å; D112-C115 PolarHBondContact O-N 2.86Å; P113-C115 VanDerWaalsContact C-N 3.32Å; P113-C115 PolarHBondContact O-N 3.48Å
116	S	51.8	Low	51.7	Low	85 Å²	85	106.5 Å²	106.5	59%	0.594	57%	0.573	S	S	*	*	H	α-helix	trans	-72.4	-39.8	-175.9	-84.8	0	0	0	0	114.2	K118 T120	S116-K118 PolarHBondContact O-N 3.19Å; S116-T120 WeakPolarHBondContact O-CG2 3.16Å; S116-T120 PolarHBondContact O-N 2.83Å; S116-T120 PolarHBondContact O-OG1 3.43Å
117	D	56.6	Low	51.9	Low	115 Å²	115	106 Å²	106	62%	0.615	56%	0.562	S	S	*	*	H	α-helix	trans	-74.9	-30.6	-170.2	-85.5	-28.6	0	0	0	114.1	T120 T121	D117-T120 PolarHBondContact O-OG1 3.13Å; D117-T121 PolarHBondContact O-N 3.44Å; D117-T121 PolarHBondContact O-OG1 3.13Å
118	K	54.6	Low	52.4	Low	141 Å²	141	106.8 Å²	106.8	61%	0.613	56%	0.556	S	S	*	*	H	α-helix	trans	-84	-34.1	-177.8	-66.1	-67.1	-175	-176.5	0	112.6	S116 T121 A122	S116-K118 PolarHBondContact O-N 3.19Å; K118-T121 PolarHBondContact O-N 3.47Å; K118-A122 PolarHBondContact O-N 3.42Å
119	L	51.4	Low	53.1	Low	88 Å²	88	108.6 Å²	108.6	46%	0.461	56%	0.56	S	S	.	*	H	α-helix	trans	-65.2	-42.7	174.8	-83.2	164.5	0	0	0	111.3	T121 A122 Q123	L119-T121 VanDerWaalsContact C-N 3.26Å; L119-T121 PolarHBondContact O-N 3.18Å; L119-A122 PolarHBondContact O-N 2.91Å; L119-Q123 WeakPolarHBondContact O-CB 3.44Å; L119-Q123 PolarHBondContact O-N 3.2Å
120	T	56.2	Low	53.6	Low	57 Å²	57	108.2 Å²	108.2	35%	0.35	54%	0.54	S	S	.	.	H	α-helix	trans	-62.4	-34.8	175.6	56.9	0	0	0	0	112.2	S116 D117 R124	S116-T120 WeakPolarHBondContact O-CG2 3.16Å; S116-T120 PolarHBondContact O-N 2.83Å; S116-T120 PolarHBondContact O-OG1 3.43Å; D117-T120 PolarHBondContact O-OG1 3.13Å; T120-R124 VanDerWaalsContact O-CB 3.26Å; T120-R124 WeakPolarHBondContact O-CB 3.26Å; T120-R124 VanDerWaalsContact O-CG 3.32Å; T120-R124 WeakPolarHBondContact O-CG 3.37Å; T120-R124 PolarHBondContact O-N 3.41Å; T120-R124 PolarHBondContact O-NE 3.11Å; T120-R124 PolarHBondContact OG1-NH2 3.42Å
121	T	58.9	Low	54.6	Low	61 Å²	61	113 Å²	113	37%	0.374	55%	0.55	S	S	.	.	H	α-helix	trans	-74.2	-38.7	178	-50.3	0	0	0	0	112.8	D117 K118 L119 R125	D117-T121 PolarHBondContact O-N 3.44Å; D117-T121 PolarHBondContact O-OG1 3.13Å; K118-T121 PolarHBondContact O-N 3.47Å; L119-T121 VanDerWaalsContact C-N 3.26Å; L119-T121 PolarHBondContact O-N 3.18Å; T121-R125 PolarHBondContact O-N 3.27Å
122	A	56	Low	55.5	Low	36 Å²	36	112 Å²	112	30%	0.298	54%	0.536	S	S	.	.	H	α-helix	trans	-67.7	-47.6	174.4	0	0	0	0	0	110.8	K118 L119 R124 R125 Y126	K118-A122 PolarHBondContact O-N 3.42Å; L119-A122 PolarHBondContact O-N 2.91Å; A122-R124 PolarHBondContact O-N 3.22Å; A122-R125 PolarHBondContact O-N 3.44Å; A122-R125 VanDerWaalsContact O-N 3.13Å; A122-Y126 WeakPolarHBondContact O-CD2 3.04Å; A122-Y126 PolarHBondContact O-N 3.17Å
123	Q	57.6	Low	56.3	Low	141 Å²	141	114.2 Å²	114.2	66%	0.659	55%	0.546	S	S	*	.	H	α-helix	trans	-64.8	-36.4	-179.6	-164.1	164.8	-42.9	0	0	112.2	L119 Y126 H127	L119-Q123 WeakPolarHBondContact O-CB 3.44Å; L119-Q123 PolarHBondContact O-N 3.2Å; Q123-Y126 PolarHBondContact O-N 3.16Å; Q123-H127 PolarHBondContact O-N 3.14Å; Q123-H127 VanDerWaalsContact O-N 3.11Å
124	R	58.6	Low	56.5	Low	159 Å²	159	116.1 Å²	116.1	60%	0.6	54%	0.544	S	S	*	.	H	α-helix	trans	-62.7	-39.5	171.9	-85.2	-171	-77.4	-102	-0	113	T120 A122 H127 F128	T120-R124 VanDerWaalsContact O-CB 3.26Å; T120-R124 WeakPolarHBondContact O-CB 3.26Å; T120-R124 VanDerWaalsContact O-CG 3.32Å; T120-R124 WeakPolarHBondContact O-CG 3.37Å; T120-R124 PolarHBondContact O-N 3.41Å; T120-R124 PolarHBondContact O-NE 3.11Å; T120-R124 PolarHBondContact OG1-NH2 3.42Å; A122-R124 PolarHBondContact O-N 3.22Å; R124-H127 PolarHBondContact O-N 3.3Å; R124-F128 PolarHBondContact O-N 3.31Å; R124-F128 VanDerWaalsContact O-N 3.17Å
125	R	60.3	Low	57.1	Low	178 Å²	178	117.5 Å²	117.5	67%	0.672	55%	0.549	S	S	*	.	H	α-helix	trans	-64.7	-44.6	177.7	-90.6	-171.7	-79.8	-172.1	-4.2	112.2	T121 A122 H127 F128 T129	T121-R125 PolarHBondContact O-N 3.27Å; A122-R125 PolarHBondContact O-N 3.44Å; A122-R125 VanDerWaalsContact O-N 3.13Å; R125-H127 VanDerWaalsContact C-N 3.33Å; R125-H127 PolarHBondContact O-N 2.93Å; R125-F128 PolarHBondContact O-N 3.28Å; R125-T129 PolarHBondContact O-N 3.4Å; R125-T129 PolarHBondContact O-OG1 3.49Å
126	Y	50.7	Low	57.7	Low	143 Å²	143	124.8 Å²	124.8	56%	0.561	58%	0.582	S	S	*	*	H	α-helix	trans	-63.4	-38.8	176.9	-75.2	-71.6	0	0	0	112.8	A122 Q123 F128 T129 Y130	A122-Y126 WeakPolarHBondContact O-CD2 3.04Å; A122-Y126 PolarHBondContact O-N 3.17Å; Q123-Y126 PolarHBondContact O-N 3.16Å; Y126-F128 VanDerWaalsContact C-N 3.29Å; Y126-F128 PolarHBondContact O-N 3.41Å; Y126-T129 WeakPolarHBondContact CA-OG1 3.32Å; Y126-T129 PolarHBondContact O-N 3.3Å; Y126-T129 PolarHBondContact O-OG1 2.68Å; Y126-Y130 WeakPolarHBondContact O-CB 3.18Å; Y126-Y130 PolarHBondContact O-N 2.7Å
127	H	55.7	Low	58	Low	116 Å²	116	126.8 Å²	126.8	54%	0.537	58%	0.582	S	S	.	*	H	α-helix	trans	-69.7	-26.1	179.5	-151.5	-55.9	0	0	0	113	Q123 R124 R125 K131	Q123-H127 PolarHBondContact O-N 3.14Å; Q123-H127 VanDerWaalsContact O-N 3.11Å; R124-H127 PolarHBondContact O-N 3.3Å; R125-H127 VanDerWaalsContact C-N 3.33Å; R125-H127 PolarHBondContact O-N 2.93Å; H127-K131 PolarHBondContact O-N 3.29Å
128	F	60.1	Low	58	Low	136 Å²	136	127.4 Å²	127.4	60%	0.596	58%	0.58	S	S	*	*	H	α-helix	trans	-72.4	-50	173.5	-167.3	-91.1	0	0	0	111.1	R124 R125 Y126 Y130 K131 E132	R124-F128 PolarHBondContact O-N 3.31Å; R124-F128 VanDerWaalsContact O-N 3.17Å; R125-F128 PolarHBondContact O-N 3.28Å; Y126-F128 VanDerWaalsContact C-N 3.29Å; Y126-F128 PolarHBondContact O-N 3.41Å; F128-Y130 VanDerWaalsContact C-N 3.31Å; F128-Y130 PolarHBondContact O-N 3.41Å; F128-K131 PolarHBondContact O-N 3.02Å; F128-E132 HydrophobicContact CE1-CG 4.24Å; F128-E132 PolarHBondContact O-N 3.48Å
129	T	57.7	Low	58.2	Low	73 Å²	73	126.7 Å²	126.7	45%	0.448	58%	0.578	S	S	.	*	H	α-helix	trans	-60.5	-39	178.6	43.7	0	0	0	0	112.4	R125 Y126 K131 E132 I133	R125-T129 PolarHBondContact O-N 3.4Å; R125-T129 PolarHBondContact O-OG1 3.49Å; Y126-T129 WeakPolarHBondContact CA-OG1 3.32Å; Y126-T129 PolarHBondContact O-N 3.3Å; Y126-T129 PolarHBondContact O-OG1 2.68Å; T129-K131 PolarHBondContact O-N 2.96Å; T129-E132 PolarHBondContact O-N 2.78Å; T129-I133 VanDerWaalsContact O-CG1 3.28Å; T129-I133 WeakPolarHBondContact O-CG1 3.42Å; T129-I133 PolarHBondContact O-N 3.31Å; T129-I133 VanDerWaalsContact O-N 3.09Å
130	Y	49.7	Very low	58.6	Low	133 Å²	133	128.9 Å²	128.9	52%	0.522	59%	0.585	S	S	.	*	H	α-helix	trans	-69.3	-33.7	179.6	-171.1	-100.4	0	0	0	113	Y126 F128 K134	Y126-Y130 WeakPolarHBondContact O-CB 3.18Å; Y126-Y130 PolarHBondContact O-N 2.7Å; F128-Y130 VanDerWaalsContact C-N 3.31Å; F128-Y130 PolarHBondContact O-N 3.41Å; Y130-K134 HydrophobicContact CE1-CD 3.93Å; Y130-K134 PolarHBondContact O-N 3.4Å; Y130-K134 WeakPolarHBondContact OH-CE 3.4Å; Y130-K134 PolarHBondContact OH-NZ 3.26Å
131	K	64.5	Low	58.8	Low	140 Å²	140	133.4 Å²	133.4	61%	0.609	60%	0.6	S	S	*	*	H	α-helix	trans	-68.3	-36.1	175.2	-82.8	-172.7	177.3	-176.3	0	112.3	H127 F128 T129	H127-K131 PolarHBondContact O-N 3.29Å; F128-K131 PolarHBondContact O-N 3.02Å; T129-K131 PolarHBondContact O-N 2.96Å
132	E	69.8	Low	58.8	Low	120 Å²	120	138.3 Å²	138.3	56%	0.561	62%	0.615	S	S	*	*	H	α-helix	trans	-69.9	-42.2	175	-75.6	-148.4	146.6	0	0	112.4	F128 T129 K134 R135 I136	F128-E132 HydrophobicContact CE1-CG 4.24Å; F128-E132 PolarHBondContact O-N 3.48Å; T129-E132 PolarHBondContact O-N 2.78Å; E132-K134 PolarHBondContact O-N 2.82Å; E132-R135 WeakPolarHBondContact O-CB 3.18Å; E132-R135 PolarHBondContact O-N 3.02Å; E132-I136 PolarHBondContact O-N 3.28Å
133	I	61.5	Low	59	Low	116 Å²	116	145.6 Å²	145.6	60%	0.595	64%	0.637	S	S	*	*	H	α-helix	trans	-60.4	-33.5	178.9	-67.6	165.4	0	0	0	111.6	T129 R135	T129-I133 VanDerWaalsContact O-CG1 3.28Å; T129-I133 WeakPolarHBondContact O-CG1 3.42Å; T129-I133 PolarHBondContact O-N 3.31Å; T129-I133 VanDerWaalsContact O-N 3.09Å; I133-R135 VanDerWaalsContact C-N 3.3Å; I133-R135 PolarHBondContact O-N 3.2Å
134	K	57	Low	59.1	Low	148 Å²	148	145.9 Å²	145.9	64%	0.643	64%	0.636	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.3	-10	174.8	-90.5	-172.5	177.8	179.8	0	114.9	Y130 E132	Y130-K134 HydrophobicContact CE1-CD 3.93Å; Y130-K134 PolarHBondContact O-N 3.4Å; Y130-K134 WeakPolarHBondContact OH-CE 3.4Å; Y130-K134 PolarHBondContact OH-NZ 3.26Å; E132-K134 PolarHBondContact O-N 2.82Å
135	R	63.1	Low	59.1	Low	230 Å²	230	144.8 Å²	144.8	87%	0.868	64%	0.639	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93.4	-17.2	-179.8	-167.2	-178.6	-84.4	-156.7	-4.8	112.2	E132 I133	E132-R135 WeakPolarHBondContact O-CB 3.18Å; E132-R135 PolarHBondContact O-N 3.02Å; I133-R135 VanDerWaalsContact C-N 3.3Å; I133-R135 PolarHBondContact O-N 3.2Å
136	I	59.3	Low	59	Low	205 Å²	205	141.8 Å²	141.8	100%	1.051	64%	0.636	S	S	*	*			trans	-84.4	0	170	-54.5	174.9	0	0	0	108.4	E132	E132-I136 PolarHBondContact O-N 3.28Å

Retrieved 136 of 136 residues in 642.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).