A0A077ZLL5_TRITR Loading...

Integrase zinc-binding domain-containing protein

AlphaFold DB , UniProt , Accession A0A077ZLL5, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 121 aa.

						>A0A077ZLL5_TRITR|A0A077ZLL5
MVVDLLVKNQNEKQMHAGTEHTLATLRQNVWILKARSTVKRIVRACVICKRFASSPFVQKIASLPEEGITQAFPFERTGVDFAGPLYVKYGKCSKKAYVCLFTCMTIRAVHLELVMNMSTD
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	71.8	Confident	93.1	Very high	180 Å²	180	71.5 Å²	71.5	89%	0.887	37%	0.372	S	S	*	.				0	140.6	0	-71.3	177.9	66.4	0	0	109	V3 D4	M1-V3 PolarHBondContact O-N 2.8Å; M1-D4 PolarHBondContact O-N 2.8Å
2	V	90	Very high	93.4	Very high	111 Å²	111	72.9 Å²	72.9	67%	0.673	38%	0.375	S	S	*	.	H	α-helix	trans	-53.8	-37.4	-177.6	177.6	0	0	0	0	112.7	D4 L5 L6	V2-D4 VanDerWaalsContact C-N 3.3Å; V2-D4 PolarHBondContact O-N 3.12Å; V2-L5 PolarHBondContact O-N 2.96Å; V2-L6 HydrophobicContact CG1-CD1 4.18Å; V2-L6 HydrophobicContact CG1-CG 4.38Å; V2-L6 PolarHBondContact O-N 3.12Å; V2-L6 VanDerWaalsContact O-N 3.07Å
3	V	93.8	Very high	93.7	Very high	41 Å²	41	78.6 Å²	78.6	25%	0.248	40%	0.395	C	S	.	.	H	α-helix	trans	-57.1	-40.3	177.6	-177.6	0	0	0	0	112.6	M1 L5 L6 V7 I32 T38	M1-V3 PolarHBondContact O-N 2.8Å; V3-L5 VanDerWaalsContact C-N 3.33Å; V3-L5 PolarHBondContact O-N 3.16Å; V3-L6 PolarHBondContact O-N 3.41Å; V3-V7 HydrophobicContact CG1-CG2 4.37Å; V3-V7 VanDerWaalsContact O-CG2 3.27Å; V3-V7 WeakPolarHBondContact O-CG2 3.3Å; V3-V7 PolarHBondContact O-N 3.35Å; V3-I32 HydrophobicContact CG1-CD1 3.93Å; V3-I32 HydrophobicContact CG1-CG1 4.18Å; V3-I32 HydrophobicContact CG1-CG2 3.64Å; V3-T38 HydrophobicContact CG1-CG2 3.91Å
4	D	95.1	Very high	93.8	Very high	39 Å²	39	74.9 Å²	74.9	21%	0.209	38%	0.376	C	S	.	.	H	α-helix	trans	-66.8	-37.5	-178.4	-75.4	12.9	0	0	0	111.3	M1 V2 K8 R41 I42	M1-D4 PolarHBondContact O-N 2.8Å; V2-D4 VanDerWaalsContact C-N 3.3Å; V2-D4 PolarHBondContact O-N 3.12Å; D4-K8 VanDerWaalsContact O-CB 3.29Å; D4-K8 WeakPolarHBondContact O-CB 3.5Å; D4-K8 PolarHBondContact O-N 3.43Å; D4-R41 VanDerWaalsContact CG-NH2 3.33Å; D4-R41 IonicContact OD1-CZ 3.51Å; D4-R41 IonicContact OD1-NH1 2.91Å; D4-R41 IonicContact OD1-NH2 3.15Å; D4-R41 PolarHBondContact OD1-NH2 3.17Å; D4-R41 IonicContact OD2-CZ 3.76Å; D4-R41 IonicContact OD2-NH1 3.86Å; D4-R41 PolarHBondContact OD2-NH1 3.23Å; D4-R41 IonicContact OD2-NH2 2.76Å; D4-R41 PolarHBondContact OD2-NH2 3.2Å; D4-R41 VanDerWaalsContact OD2-NH2 3.15Å; D4-I42 HydrophobicContact CB-CD1 3.87Å
5	L	95.6	Very high	94	Very high	125 Å²	125	80.9 Å²	80.9	65%	0.654	41%	0.405	S	S	*	.	H	α-helix	trans	-68.7	-41.2	175.9	-65.1	176.3	0	0	0	111.6	V2 V3 K8 N9	V2-L5 PolarHBondContact O-N 2.96Å; V3-L5 VanDerWaalsContact C-N 3.33Å; V3-L5 PolarHBondContact O-N 3.16Å; L5-K8 PolarHBondContact O-N 3.37Å; L5-N9 VanDerWaalsContact O-CB 3.28Å; L5-N9 WeakPolarHBondContact O-CB 3.18Å; L5-N9 PolarHBondContact O-N 3.16Å
6	L	95.2	Very high	94.2	Very high	75 Å²	75	78.8 Å²	78.8	39%	0.393	39%	0.393	S	S	.	.	H	α-helix	trans	-60.3	-47.6	176.1	-72.2	172.4	0	0	0	111.6	V2 V3 Q10	V2-L6 HydrophobicContact CG1-CD1 4.18Å; V2-L6 HydrophobicContact CG1-CG 4.38Å; V2-L6 PolarHBondContact O-N 3.12Å; V2-L6 VanDerWaalsContact O-N 3.07Å; V3-L6 PolarHBondContact O-N 3.41Å; L6-Q10 WeakPolarHBondContact O-CB 3.39Å; L6-Q10 PolarHBondContact O-N 3.5Å
7	V	96.4	Very high	94.2	Very high	0 Å²	0	75.4 Å²	75.4	0%	0	38%	0.381	C	S	.	.	H	α-helix	trans	-64.4	-42.9	178.6	173.7	0	0	0	0	111.1	V3 Q10 N11 L26 I32 T38 V39 I42	V3-V7 HydrophobicContact CG1-CG2 4.37Å; V3-V7 VanDerWaalsContact O-CG2 3.27Å; V3-V7 WeakPolarHBondContact O-CG2 3.3Å; V3-V7 PolarHBondContact O-N 3.35Å; V7-Q10 PolarHBondContact O-N 2.91Å; V7-N11 WeakPolarHBondContact O-CB 3.2Å; V7-N11 PolarHBondContact O-N 3.41Å; V7-L26 HydrophobicContact CB-CD1 4.42Å; V7-L26 HydrophobicContact CG2-CD1 3.8Å; V7-I32 HydrophobicContact CG2-CD1 4.36Å; V7-T38 HydrophobicContact CG2-CG2 4.35Å; V7-V39 HydrophobicContact CG1-CB 4.27Å; V7-V39 HydrophobicContact CG1-CG1 4.35Å; V7-V39 HydrophobicContact CG1-CG2 4.02Å; V7-V39 HydrophobicContact CG2-CG2 4.15Å; V7-I42 HydrophobicContact CB-CB 4.41Å; V7-I42 HydrophobicContact CB-CG1 4.22Å; V7-I42 HydrophobicContact CB-CG2 4.34Å; V7-I42 HydrophobicContact CG1-CB 3.59Å; V7-I42 HydrophobicContact CG1-CG1 3.86Å; V7-I42 HydrophobicContact CG1-CG2 3.72Å
8	K	96.6	Very high	94.3	Very high	109 Å²	109	73.8 Å²	73.8	47%	0.474	39%	0.386	S	S	.	.	H	α-helix	trans	-62	-50.4	178	-178.4	179.2	171.6	-174.5	0	111.4	D4 L5 Q10 N11 E12 I42	D4-K8 VanDerWaalsContact O-CB 3.29Å; D4-K8 WeakPolarHBondContact O-CB 3.5Å; D4-K8 PolarHBondContact O-N 3.43Å; L5-K8 PolarHBondContact O-N 3.37Å; K8-Q10 VanDerWaalsContact C-N 3.29Å; K8-Q10 PolarHBondContact O-N 3.13Å; K8-N11 PolarHBondContact O-N 3.3Å; K8-N11 VanDerWaalsContact O-N 3.16Å; K8-E12 WeakPolarHBondContact CE-OE1 3.37Å; K8-E12 IonicContact NZ-OE1 3.9Å; K8-E12 WeakPolarHBondContact O-CG 3.3Å; K8-E12 PolarHBondContact O-N 3.32Å; K8-I42 HydrophobicContact CB-CG2 4.09Å
9	N	96.8	Very high	94.4	Very high	71 Å²	71	71.4 Å²	71.4	38%	0.38	38%	0.375	S	S	.	.	H	α-helix	trans	-58.8	-40.4	176.9	175.6	63.3	0	0	0	111.8	L5 E12 K13	L5-N9 VanDerWaalsContact O-CB 3.28Å; L5-N9 WeakPolarHBondContact O-CB 3.18Å; L5-N9 PolarHBondContact O-N 3.16Å; N9-E12 PolarHBondContact O-N 3.45Å; N9-K13 WeakPolarHBondContact O-CB 3.33Å; N9-K13 WeakPolarHBondContact O-CG 3.4Å; N9-K13 PolarHBondContact O-N 3.29Å
10	Q	96.2	Very high	94.5	Very high	34 Å²	34	72.8 Å²	72.8	16%	0.159	38%	0.379	C	S	.	.	H	α-helix	trans	-65.9	-42.4	176.1	-171	62.1	25.3	0	0	112.3	L6 V7 K8 E12 K13 Q14 T22 L26	L6-Q10 WeakPolarHBondContact O-CB 3.39Å; L6-Q10 PolarHBondContact O-N 3.5Å; V7-Q10 PolarHBondContact O-N 2.91Å; K8-Q10 VanDerWaalsContact C-N 3.29Å; K8-Q10 PolarHBondContact O-N 3.13Å; Q10-E12 VanDerWaalsContact C-N 3.34Å; Q10-E12 PolarHBondContact O-N 2.82Å; Q10-K13 PolarHBondContact O-N 3.13Å; Q10-Q14 WeakPolarHBondContact O-CB 3.3Å; Q10-Q14 VanDerWaalsContact O-CG 3.24Å; Q10-Q14 WeakPolarHBondContact O-CG 3.49Å; Q10-Q14 PolarHBondContact O-N 3.2Å; Q10-Q14 VanDerWaalsContact O-N 3.13Å; Q10-T22 HydrophobicContact CB-CG2 4.22Å; Q10-T22 HydrophobicContact CG-CG2 4.05Å; Q10-L26 HydrophobicContact CB-CD2 3.84Å; Q10-L26 HydrophobicContact CB-CG 4.22Å; Q10-L26 HydrophobicContact CG-CD2 3.98Å; Q10-L26 HydrophobicContact CG-CG 3.98Å
11	N	96.3	Very high	94.6	Very high	2 Å²	2	74.4 Å²	74.4	1%	0.011	39%	0.385	C	S	.	.	H	α-helix	trans	-61.4	-41.9	175.7	-179.1	-107.1	0	0	0	111.9	V7 K8 Q14 H16 A17 T22	V7-N11 WeakPolarHBondContact O-CB 3.2Å; V7-N11 PolarHBondContact O-N 3.41Å; K8-N11 PolarHBondContact O-N 3.3Å; K8-N11 VanDerWaalsContact O-N 3.16Å; N11-Q14 PolarHBondContact O-N 3.16Å; N11-H16 WeakPolarHBondContact O-CA 3.2Å; N11-H16 PolarHBondContact O-N 3.44Å; N11-H16 PolarHBondContact OD1-ND1 2.97Å; N11-H16 VanDerWaalsContact OD1-ND1 3.07Å; N11-A17 PolarHBondContact ND2-O 3.4Å; N11-T22 HydrophobicContact CB-CG2 4.38Å
12	E	97.1	Very high	95.8	Very high	88 Å²	88	65.8 Å²	65.8	41%	0.411	34%	0.342	S	S	.	.	H	α-helix	trans	-66.3	-45.1	177.8	-72.8	171.2	176.2	0	0	111.9	K8 N9 Q10 Q14 M15	K8-E12 WeakPolarHBondContact CE-OE1 3.37Å; K8-E12 IonicContact NZ-OE1 3.9Å; K8-E12 WeakPolarHBondContact O-CG 3.3Å; K8-E12 PolarHBondContact O-N 3.32Å; N9-E12 PolarHBondContact O-N 3.45Å; Q10-E12 VanDerWaalsContact C-N 3.34Å; Q10-E12 PolarHBondContact O-N 2.82Å; E12-Q14 PolarHBondContact O-N 3.18Å; E12-M15 PolarHBondContact O-N 2.74Å; E12-M15 VanDerWaalsContact O-N 3.11Å
13	K	96.6	Very high	96.2	Very high	147 Å²	147	60.6 Å²	60.6	64%	0.639	31%	0.311	S	S	*	.	H	α-helix	trans	-60.4	-28.7	175.2	-76.5	-178	178.1	-171.2	0	113.6	N9 Q10 M15	N9-K13 WeakPolarHBondContact O-CB 3.33Å; N9-K13 WeakPolarHBondContact O-CG 3.4Å; N9-K13 PolarHBondContact O-N 3.29Å; Q10-K13 PolarHBondContact O-N 3.13Å; K13-M15 VanDerWaalsContact C-N 3.3Å
14	Q	95.6	Very high	96.3	Very high	27 Å²	27	61.1 Å²	61.1	13%	0.126	32%	0.32	C	S	.	.	T	Hydrogen-bonded Turn	trans	-93.6	20.6	179.2	-67	176.3	-29.7	0	0	113.1	Q10 N11 E12 H16 A17 H21 T22 T25	Q10-Q14 WeakPolarHBondContact O-CB 3.3Å; Q10-Q14 VanDerWaalsContact O-CG 3.24Å; Q10-Q14 WeakPolarHBondContact O-CG 3.49Å; Q10-Q14 PolarHBondContact O-N 3.2Å; Q10-Q14 VanDerWaalsContact O-N 3.13Å; N11-Q14 PolarHBondContact O-N 3.16Å; E12-Q14 PolarHBondContact O-N 3.18Å; Q14-H16 PolarHBondContact O-N 2.9Å; Q14-A17 HydrophobicContact CB-CB 3.84Å; Q14-A17 WeakPolarHBondContact O-CB 3.3Å; Q14-A17 PolarHBondContact O-N 3.45Å; Q14-H21 VanDerWaalsContact CD-CD2 3.46Å; Q14-H21 PolarHBondContact NE2-CD2 2.99Å; Q14-T22 PolarHBondContact OE1-OG1 3.2Å; Q14-T25 PolarHBondContact NE2-OG1 3.33Å
15	M	97	Very high	96.4	Very high	165 Å²	165	60.6 Å²	60.6	81%	0.813	32%	0.318	S	S	*	.	T	Hydrogen-bonded Turn	trans	54.1	42.9	178.7	-56.7	-62.2	-70.5	0	0	112.4	E12 K13 A17	E12-M15 PolarHBondContact O-N 2.74Å; E12-M15 VanDerWaalsContact O-N 3.11Å; K13-M15 VanDerWaalsContact C-N 3.3Å; M15-A17 PolarHBondContact O-N 3.18Å
16	H	96.9	Very high	96.3	Very high	46 Å²	46	55.2 Å²	55.2	21%	0.213	29%	0.289	C	S	.	.	T	Hydrogen-bonded Turn	trans	64	34.4	178.4	-59.7	-66	0	0	0	115.4	N11 Q14 C46 I48	N11-H16 WeakPolarHBondContact O-CA 3.2Å; N11-H16 PolarHBondContact O-N 3.44Å; N11-H16 PolarHBondContact OD1-ND1 2.97Å; N11-H16 VanDerWaalsContact OD1-ND1 3.07Å; Q14-H16 PolarHBondContact O-N 2.9Å; H16-C46 PolarHBondContact ND1-SG 3.4Å; H16-I48 HydrophobicContact CB-CG2 4.32Å; H16-I48 WeakPolarHBondContact CD2-CG2 3.21Å; H16-I48 WeakPolarHBondContact NE2-CD1 3.2Å
17	A	95.3	Very high	96.4	Very high	22 Å²	22	58.6 Å²	58.6	18%	0.182	30%	0.297	C	S	.	.			trans	-54.8	156.4	174.6	0	0	0	0	0	113.7	N11 Q14 M15 H21 T22	N11-A17 PolarHBondContact ND2-O 3.4Å; Q14-A17 HydrophobicContact CB-CB 3.84Å; Q14-A17 WeakPolarHBondContact O-CB 3.3Å; Q14-A17 PolarHBondContact O-N 3.45Å; M15-A17 PolarHBondContact O-N 3.18Å; A17-H21 HydrophobicContact CB-CB 3.92Å; A17-H21 WeakPolarHBondContact CB-CD2 3.44Å; A17-T22 PolarHBondContact O-OG1 3.09Å
18	G	95.2	Very high	96.3	Very high	46 Å²	46	65.4 Å²	65.4	47%	0.474	33%	0.329	S	S	.	.			trans	-64.4	167.5	179.9	0	0	0	0	0	113.8	E20 H21 T22	G18-E20 VanDerWaalsContact C-N 3.29Å; G18-E20 PolarHBondContact O-N 2.88Å; G18-H21 PolarHBondContact O-N 3.43Å; G18-T22 PolarHBondContact O-N 2.93Å; G18-T22 VanDerWaalsContact O-N 3.09Å; G18-T22 PolarHBondContact O-OG1 3.06Å
19	T	96.5	Very high	96.2	Very high	28 Å²	28	66.6 Å²	66.6	17%	0.172	34%	0.34	C	S	.	.	H	α-helix	trans	-51.2	-43.5	-177.1	-60.3	0	0	0	0	113.6	L23 V39 K40	T19-L23 WeakPolarHBondContact O-CB 3.27Å; T19-L23 PolarHBondContact O-N 2.76Å; T19-V39 HydrophobicContact CG2-CB 4.31Å; T19-V39 HydrophobicContact CG2-CG1 3.97Å; T19-K40 HydrophobicContact CG2-CB 3.9Å
20	E	96.7	Very high	96	Very high	100 Å²	100	65.7 Å²	65.7	47%	0.467	34%	0.337	S	S	.	.	H	α-helix	trans	-70.9	-37.8	-175.5	-59.5	-57	142.6	0	0	112.2	G18 L23 A24 R36	G18-E20 VanDerWaalsContact C-N 3.29Å; G18-E20 PolarHBondContact O-N 2.88Å; E20-L23 PolarHBondContact O-N 3.09Å; E20-A24 WeakPolarHBondContact O-CB 3.34Å; E20-A24 PolarHBondContact O-N 2.99Å; E20-R36 IonicContact OE1-CZ 3.31Å; E20-R36 VanDerWaalsContact OE1-CZ 3.31Å; E20-R36 IonicContact OE1-NE 2.96Å; E20-R36 PolarHBondContact OE1-NE 3.44Å; E20-R36 IonicContact OE1-NH2 2.8Å; E20-R36 PolarHBondContact OE1-NH2 3.27Å
21	H	96.8	Very high	95.9	Very high	106 Å²	106	74.4 Å²	74.4	49%	0.491	37%	0.369	S	S	.	.	H	α-helix	trans	-69.2	-44.5	177.3	-172.6	82.6	0	0	0	111.7	Q14 A17 G18 L23 A24 T25	Q14-H21 VanDerWaalsContact CD-CD2 3.46Å; Q14-H21 PolarHBondContact NE2-CD2 2.99Å; A17-H21 HydrophobicContact CB-CB 3.92Å; A17-H21 WeakPolarHBondContact CB-CD2 3.44Å; G18-H21 PolarHBondContact O-N 3.43Å; H21-L23 VanDerWaalsContact C-N 3.33Å; H21-L23 PolarHBondContact O-N 2.87Å; H21-A24 PolarHBondContact O-N 3.22Å; H21-T25 PolarHBondContact O-N 3.35Å; H21-T25 VanDerWaalsContact O-N 3.16Å; H21-T25 PolarHBondContact O-OG1 3Å
22	T	96.7	Very high	95.7	Very high	0 Å²	0	75.7 Å²	75.7	0%	0	38%	0.375	C	S	.	.	H	α-helix	trans	-62.3	-40.9	174.3	-56.8	0	0	0	0	111.9	Q10 N11 Q14 A17 G18 L26 V39	Q10-T22 HydrophobicContact CB-CG2 4.22Å; Q10-T22 HydrophobicContact CG-CG2 4.05Å; N11-T22 HydrophobicContact CB-CG2 4.38Å; Q14-T22 PolarHBondContact OE1-OG1 3.2Å; A17-T22 PolarHBondContact O-OG1 3.09Å; G18-T22 PolarHBondContact O-N 2.93Å; G18-T22 VanDerWaalsContact O-N 3.09Å; G18-T22 PolarHBondContact O-OG1 3.06Å; T22-L26 HydrophobicContact CG2-CD1 4.08Å; T22-L26 WeakPolarHBondContact O-CB 3.37Å; T22-L26 VanDerWaalsContact O-CG 3.3Å; T22-L26 WeakPolarHBondContact O-CG 3.49Å; T22-L26 PolarHBondContact O-N 3.46Å; T22-V39 HydrophobicContact CG2-CG1 3.84Å
23	L	97	Very high	95.5	Very high	1 Å²	1	78.4 Å²	78.4	1%	0.005	39%	0.392	C	S	.	.	H	α-helix	trans	-64.4	-43.4	175.8	179.3	61.8	0	0	0	112.5	T19 E20 H21 T25 L26 R27 A35 R36 V39	T19-L23 WeakPolarHBondContact O-CB 3.27Å; T19-L23 PolarHBondContact O-N 2.76Å; E20-L23 PolarHBondContact O-N 3.09Å; H21-L23 VanDerWaalsContact C-N 3.33Å; H21-L23 PolarHBondContact O-N 2.87Å; L23-T25 VanDerWaalsContact C-N 3.33Å; L23-T25 PolarHBondContact O-N 3.31Å; L23-L26 PolarHBondContact O-N 3.04Å; L23-R27 HydrophobicContact CD1-CG 4.47Å; L23-R27 WeakPolarHBondContact O-CG 3.24Å; L23-R27 PolarHBondContact O-N 3.17Å; L23-R27 VanDerWaalsContact O-N 3.12Å; L23-A35 HydrophobicContact CD1-CB 3.49Å; L23-A35 VanDerWaalsContact CD1-CB 3.49Å; L23-R36 HydrophobicContact CD2-CB 3.86Å; L23-R36 HydrophobicContact CD2-CG 3.96Å; L23-V39 HydrophobicContact CD1-CG2 4.3Å
24	A	97	Very high	95.4	Very high	53 Å²	53	80 Å²	80	44%	0.438	40%	0.399	S	S	.	.	H	α-helix	trans	-60.9	-41.4	-179.8	0	0	0	0	0	112	E20 H21	E20-A24 WeakPolarHBondContact O-CB 3.34Å; E20-A24 PolarHBondContact O-N 2.99Å; H21-A24 PolarHBondContact O-N 3.22Å
25	T	96.1	Very high	95.3	Very high	28 Å²	28	79.3 Å²	79.3	17%	0.172	40%	0.398	C	S	.	.	H	α-helix	trans	-77.7	-34.7	179.5	-49.8	0	0	0	0	112.9	Q14 H21 L23 R27 Q28	Q14-T25 PolarHBondContact NE2-OG1 3.33Å; H21-T25 PolarHBondContact O-N 3.35Å; H21-T25 VanDerWaalsContact O-N 3.16Å; H21-T25 PolarHBondContact O-OG1 3Å; L23-T25 VanDerWaalsContact C-N 3.33Å; L23-T25 PolarHBondContact O-N 3.31Å; T25-R27 VanDerWaalsContact C-N 3.25Å; T25-R27 PolarHBondContact O-N 3.15Å; T25-Q28 WeakPolarHBondContact O-CB 3.44Å; T25-Q28 PolarHBondContact O-N 2.91Å
26	L	95.5	Very high	95.3	Very high	11 Å²	11	78.6 Å²	78.6	6%	0.058	39%	0.386	C	S	.	.	H	α-helix	trans	-58.3	-41.1	172.4	-76.5	169.4	0	0	0	111.4	V7 Q10 T22 L23 Q28 N29 V30 I32 V39	V7-L26 HydrophobicContact CB-CD1 4.42Å; V7-L26 HydrophobicContact CG2-CD1 3.8Å; Q10-L26 HydrophobicContact CB-CD2 3.84Å; Q10-L26 HydrophobicContact CB-CG 4.22Å; Q10-L26 HydrophobicContact CG-CD2 3.98Å; Q10-L26 HydrophobicContact CG-CG 3.98Å; T22-L26 HydrophobicContact CG2-CD1 4.08Å; T22-L26 WeakPolarHBondContact O-CB 3.37Å; T22-L26 VanDerWaalsContact O-CG 3.3Å; T22-L26 WeakPolarHBondContact O-CG 3.49Å; T22-L26 PolarHBondContact O-N 3.46Å; L23-L26 PolarHBondContact O-N 3.04Å; L26-Q28 PolarHBondContact O-N 3.43Å; L26-Q28 VanDerWaalsContact O-N 3.12Å; L26-N29 PolarHBondContact O-N 3.48Å; L26-N29 VanDerWaalsContact O-N 3.09Å; L26-V30 HydrophobicContact CB-CG2 4.1Å; L26-V30 HydrophobicContact CD2-CG2 3.97Å; L26-V30 WeakPolarHBondContact O-CG2 3.4Å; L26-V30 PolarHBondContact O-N 2.95Å; L26-I32 HydrophobicContact CD1-CD1 4.46Å; L26-V39 HydrophobicContact CD1-CG2 3.6Å
27	R	95.5	Very high	95.3	Very high	147 Å²	147	79.8 Å²	79.8	56%	0.555	40%	0.4	S	S	*	.	T	Hydrogen-bonded Turn	trans	-62.9	-16.4	179.5	-78.4	174.5	170.6	153.7	-5	114.8	L23 T25 N29	L23-R27 HydrophobicContact CD1-CG 4.47Å; L23-R27 WeakPolarHBondContact O-CG 3.24Å; L23-R27 PolarHBondContact O-N 3.17Å; L23-R27 VanDerWaalsContact O-N 3.12Å; T25-R27 VanDerWaalsContact C-N 3.25Å; T25-R27 PolarHBondContact O-N 3.15Å; R27-N29 VanDerWaalsContact C-N 3.29Å
28	Q	95.4	Very high	95.3	Very high	143 Å²	143	79.9 Å²	79.9	67%	0.668	40%	0.398	S	S	*	.	T	Hydrogen-bonded Turn	trans	-72.7	-24.3	175.8	-64.8	174.6	-18.5	0	0	112.3	T25 L26	T25-Q28 WeakPolarHBondContact O-CB 3.44Å; T25-Q28 PolarHBondContact O-N 2.91Å; L26-Q28 PolarHBondContact O-N 3.43Å; L26-Q28 VanDerWaalsContact O-N 3.12Å
29	N	93.5	Very high	95.4	Very high	133 Å²	133	77.7 Å²	77.7	71%	0.711	38%	0.375	S	S	*	.	T	Hydrogen-bonded Turn	trans	-129.8	-22.6	-170.7	-60	-68	0	0	0	114	L26 R27	L26-N29 PolarHBondContact O-N 3.48Å; L26-N29 VanDerWaalsContact O-N 3.09Å; R27-N29 VanDerWaalsContact C-N 3.29Å
30	V	93.5	Very high	95.5	Very high	53 Å²	53	80.6 Å²	80.6	32%	0.321	39%	0.386	S	S	.	.			trans	-140.5	141	-175.1	-64.9	0	0	0	0	112.3	L26 I32	L26-V30 HydrophobicContact CB-CG2 4.1Å; L26-V30 HydrophobicContact CD2-CG2 3.97Å; L26-V30 WeakPolarHBondContact O-CG2 3.4Å; L26-V30 PolarHBondContact O-N 2.95Å; V30-I32 HydrophobicContact CG2-CD1 3.92Å; V30-I32 HydrophobicContact CG2-CG1 4.22Å
31	W	93.7	Very high	95.5	Very high	217 Å²	217	81.7 Å²	81.7	82%	0.822	39%	0.386	S	S	*	.			trans	-104.4	106.4	172.1	-169.3	-97.3	0	0	0	110.7
32	I	92.3	Very high	95.5	Very high	28 Å²	28	77.8 Å²	77.8	14%	0.144	37%	0.368	C	S	.	.			trans	-105.8	124.9	-179.1	-61.8	161.4	0	0	0	109.2	V3 V7 L26 V30 K34 A35	V3-I32 HydrophobicContact CG1-CD1 3.93Å; V3-I32 HydrophobicContact CG1-CG1 4.18Å; V3-I32 HydrophobicContact CG1-CG2 3.64Å; V7-I32 HydrophobicContact CG2-CD1 4.36Å; L26-I32 HydrophobicContact CD1-CD1 4.46Å; V30-I32 HydrophobicContact CG2-CD1 3.92Å; V30-I32 HydrophobicContact CG2-CG1 4.22Å; I32-K34 PolarHBondContact O-N 3.46Å; I32-A35 HydrophobicContact CB-CB 3.88Å; I32-A35 HydrophobicContact CG2-CB 4.19Å; I32-A35 VanDerWaalsContact O-CB 3.3Å; I32-A35 WeakPolarHBondContact O-CB 3.41Å; I32-A35 PolarHBondContact O-N 2.89Å; I32-A35 VanDerWaalsContact O-N 3.16Å
33	L	93.1	Very high	95.5	Very high	146 Å²	146	78.5 Å²	78.5	76%	0.764	37%	0.372	S	S	*	.	T	Hydrogen-bonded Turn	trans	-62.2	133.1	171.7	-64.2	178.5	0	0	0	110.2	A35	L33-A35 PolarHBondContact O-N 3.16Å
34	K	93.6	Very high	95.4	Very high	180 Å²	180	86.4 Å²	86.4	78%	0.783	40%	0.402	S	S	*	.	T	Hydrogen-bonded Turn	trans	53.2	34.3	-174.8	-56	-178.2	177.6	177.7	0	113	I32 R36 S37 T38	I32-K34 PolarHBondContact O-N 3.46Å; K34-R36 VanDerWaalsContact C-N 3.28Å; K34-R36 PolarHBondContact O-N 3.13Å; K34-R36 VanDerWaalsContact O-N 3.13Å; K34-S37 WeakPolarHBondContact CB-OG 3.42Å; K34-S37 PolarHBondContact O-N 3.39Å; K34-S37 VanDerWaalsContact O-N 3.16Å; K34-S37 PolarHBondContact O-OG 2.96Å; K34-T38 PolarHBondContact O-N 3.36Å; K34-T38 PolarHBondContact O-OG1 3.37Å
35	A	94.4	Very high	95.4	Very high	13 Å²	13	86.8 Å²	86.8	11%	0.107	41%	0.405	C	S	.	.	H	α-helix	trans	-46.5	-47.1	-176.4	0	0	0	0	0	113.5	L23 I32 L33 S37 T38 V39	L23-A35 HydrophobicContact CD1-CB 3.49Å; L23-A35 VanDerWaalsContact CD1-CB 3.49Å; I32-A35 HydrophobicContact CB-CB 3.88Å; I32-A35 HydrophobicContact CG2-CB 4.19Å; I32-A35 VanDerWaalsContact O-CB 3.3Å; I32-A35 WeakPolarHBondContact O-CB 3.41Å; I32-A35 PolarHBondContact O-N 2.89Å; I32-A35 VanDerWaalsContact O-N 3.16Å; L33-A35 PolarHBondContact O-N 3.16Å; A35-S37 PolarHBondContact O-N 3.07Å; A35-T38 PolarHBondContact O-N 2.94Å; A35-T38 VanDerWaalsContact O-N 3.13Å; A35-V39 VanDerWaalsContact O-CG2 3.3Å; A35-V39 WeakPolarHBondContact O-CG2 3.16Å; A35-V39 PolarHBondContact O-N 3.46Å
36	R	96.7	Very high	95.4	Very high	149 Å²	149	86.7 Å²	86.7	56%	0.562	41%	0.406	S	S	*	.	H	α-helix	trans	-58.7	-45.5	-176.1	-169.7	177	-168.6	-158.5	3.4	112.8	E20 L23 K34 T38 K40	E20-R36 IonicContact OE1-CZ 3.31Å; E20-R36 VanDerWaalsContact OE1-CZ 3.31Å; E20-R36 IonicContact OE1-NE 2.96Å; E20-R36 PolarHBondContact OE1-NE 3.44Å; E20-R36 IonicContact OE1-NH2 2.8Å; E20-R36 PolarHBondContact OE1-NH2 3.27Å; L23-R36 HydrophobicContact CD2-CB 3.86Å; L23-R36 HydrophobicContact CD2-CG 3.96Å; K34-R36 VanDerWaalsContact C-N 3.28Å; K34-R36 PolarHBondContact O-N 3.13Å; K34-R36 VanDerWaalsContact O-N 3.13Å; R36-T38 VanDerWaalsContact C-N 3.33Å; R36-T38 PolarHBondContact O-N 3.49Å; R36-K40 WeakPolarHBondContact O-CB 3.34Å; R36-K40 PolarHBondContact O-N 3.35Å
37	S	97	Very high	95.5	Very high	72 Å²	72	90.4 Å²	90.4	50%	0.503	43%	0.428	S	S	.	.	H	α-helix	trans	-66.2	-37	177.7	44.1	0	0	0	0	111.9	K34 A35 R41	K34-S37 WeakPolarHBondContact CB-OG 3.42Å; K34-S37 PolarHBondContact O-N 3.39Å; K34-S37 VanDerWaalsContact O-N 3.16Å; K34-S37 PolarHBondContact O-OG 2.96Å; A35-S37 PolarHBondContact O-N 3.07Å; S37-R41 WeakPolarHBondContact O-CB 3.29Å; S37-R41 PolarHBondContact O-N 3.39Å
38	T	96.1	Very high	95.6	Very high	23 Å²	23	86.8 Å²	86.8	14%	0.141	42%	0.419	C	S	.	.	H	α-helix	trans	-66.7	-50	176.9	-54.9	0	0	0	0	111.2	V3 V7 K34 A35 R36 K40 R41 I42	V3-T38 HydrophobicContact CG1-CG2 3.91Å; V7-T38 HydrophobicContact CG2-CG2 4.35Å; K34-T38 PolarHBondContact O-N 3.36Å; K34-T38 PolarHBondContact O-OG1 3.37Å; A35-T38 PolarHBondContact O-N 2.94Å; A35-T38 VanDerWaalsContact O-N 3.13Å; R36-T38 VanDerWaalsContact C-N 3.33Å; R36-T38 PolarHBondContact O-N 3.49Å; T38-K40 PolarHBondContact O-N 3.36Å; T38-R41 PolarHBondContact O-N 3.07Å; T38-I42 WeakPolarHBondContact O-CG1 3.23Å; T38-I42 PolarHBondContact O-N 3.48Å
39	V	97.2	Very high	95.7	Very high	0 Å²	0	80.7 Å²	80.7	0%	0	39%	0.392	C	S	.	.	H	α-helix	trans	-58.2	-48	175.9	179.1	0	0	0	0	110.8	V7 T19 T22 L23 L26 A35 R41 I42 V43	V7-V39 HydrophobicContact CG1-CB 4.27Å; V7-V39 HydrophobicContact CG1-CG1 4.35Å; V7-V39 HydrophobicContact CG1-CG2 4.02Å; V7-V39 HydrophobicContact CG2-CG2 4.15Å; T19-V39 HydrophobicContact CG2-CB 4.31Å; T19-V39 HydrophobicContact CG2-CG1 3.97Å; T22-V39 HydrophobicContact CG2-CG1 3.84Å; L23-V39 HydrophobicContact CD1-CG2 4.3Å; L26-V39 HydrophobicContact CD1-CG2 3.6Å; A35-V39 VanDerWaalsContact O-CG2 3.3Å; A35-V39 WeakPolarHBondContact O-CG2 3.16Å; A35-V39 PolarHBondContact O-N 3.46Å; V39-R41 VanDerWaalsContact C-N 3.31Å; V39-R41 PolarHBondContact O-N 2.98Å; V39-I42 PolarHBondContact O-N 3.02Å; V39-V43 HydrophobicContact CG1-CG2 3.98Å; V39-V43 WeakPolarHBondContact O-CB 3.49Å; V39-V43 VanDerWaalsContact O-CG2 3.3Å; V39-V43 WeakPolarHBondContact O-CG2 2.78Å; V39-V43 PolarHBondContact O-N 3.03Å
40	K	97.6	Very high	95.8	Very high	90 Å²	90	80.1 Å²	80.1	39%	0.391	38%	0.383	S	S	.	.	H	α-helix	trans	-58.4	-42.2	178	-173	173.6	179.6	175	0	112	T19 R36 T38 R44	T19-K40 HydrophobicContact CG2-CB 3.9Å; R36-K40 WeakPolarHBondContact O-CB 3.34Å; R36-K40 PolarHBondContact O-N 3.35Å; T38-K40 PolarHBondContact O-N 3.36Å; K40-R44 WeakPolarHBondContact O-CB 3.38Å; K40-R44 WeakPolarHBondContact O-CG 3.4Å; K40-R44 PolarHBondContact O-N 3.11Å
41	R	97.1	Very high	95.8	Very high	123 Å²	123	86.5 Å²	86.5	46%	0.464	40%	0.402	S	S	.	.	H	α-helix	trans	-62.5	-47.4	176.6	178.3	176.6	57	81.4	1.4	111.5	D4 S37 T38 V39 A45	D4-R41 VanDerWaalsContact CG-NH2 3.33Å; D4-R41 IonicContact OD1-CZ 3.51Å; D4-R41 IonicContact OD1-NH1 2.91Å; D4-R41 IonicContact OD1-NH2 3.15Å; D4-R41 PolarHBondContact OD1-NH2 3.17Å; D4-R41 IonicContact OD2-CZ 3.76Å; D4-R41 IonicContact OD2-NH1 3.86Å; D4-R41 PolarHBondContact OD2-NH1 3.23Å; D4-R41 IonicContact OD2-NH2 2.76Å; D4-R41 PolarHBondContact OD2-NH2 3.2Å; D4-R41 VanDerWaalsContact OD2-NH2 3.15Å; S37-R41 WeakPolarHBondContact O-CB 3.29Å; S37-R41 PolarHBondContact O-N 3.39Å; T38-R41 PolarHBondContact O-N 3.07Å; V39-R41 VanDerWaalsContact C-N 3.31Å; V39-R41 PolarHBondContact O-N 2.98Å; R41-A45 WeakPolarHBondContact O-CB 3.29Å; R41-A45 PolarHBondContact O-N 3.2Å
42	I	96.3	Very high	95.8	Very high	24 Å²	24	84.3 Å²	84.3	12%	0.123	40%	0.399	C	S	.	.	H	α-helix	trans	-68.3	-46.5	-178.1	-61.6	-62.2	0	0	0	111.6	D4 V7 K8 T38 V39 R44 A45 C46	D4-I42 HydrophobicContact CB-CD1 3.87Å; V7-I42 HydrophobicContact CB-CB 4.41Å; V7-I42 HydrophobicContact CB-CG1 4.22Å; V7-I42 HydrophobicContact CB-CG2 4.34Å; V7-I42 HydrophobicContact CG1-CB 3.59Å; V7-I42 HydrophobicContact CG1-CG1 3.86Å; V7-I42 HydrophobicContact CG1-CG2 3.72Å; K8-I42 HydrophobicContact CB-CG2 4.09Å; T38-I42 WeakPolarHBondContact O-CG1 3.23Å; T38-I42 PolarHBondContact O-N 3.48Å; V39-I42 PolarHBondContact O-N 3.02Å; I42-R44 VanDerWaalsContact C-N 3.34Å; I42-R44 PolarHBondContact O-N 3.11Å; I42-A45 PolarHBondContact O-N 3.22Å; I42-A45 VanDerWaalsContact O-N 3.11Å; I42-C46 PolarHBondContact O-N 2.94Å
43	V	96.8	Very high	95.7	Very high	14 Å²	14	86.9 Å²	86.9	9%	0.085	42%	0.424	C	S	.	.	H	α-helix	trans	-61.2	-43	176.8	174.9	0	0	0	0	110.8	V39 A45 C46 C49	V39-V43 HydrophobicContact CG1-CG2 3.98Å; V39-V43 WeakPolarHBondContact O-CB 3.49Å; V39-V43 VanDerWaalsContact O-CG2 3.3Å; V39-V43 WeakPolarHBondContact O-CG2 2.78Å; V39-V43 PolarHBondContact O-N 3.03Å; V43-A45 VanDerWaalsContact C-N 3.28Å; V43-A45 PolarHBondContact O-N 2.89Å; V43-C46 WeakPolarHBondContact O-CB 3.35Å; V43-C46 PolarHBondContact O-N 2.9Å; V43-C49 HydrophobicContact CG1-CB 4.26Å; V43-C49 VanDerWaalsContact O-CB 3.29Å; V43-C49 WeakPolarHBondContact O-CB 3.45Å
44	R	95.9	Very high	95.7	Very high	167 Å²	167	83.8 Å²	83.8	63%	0.63	41%	0.414	S	S	*	.	H	α-helix	trans	-66.3	-27.3	175.3	-78.2	-179.5	170.6	-170.3	-8.2	113.5	K40 I42 K50	K40-R44 WeakPolarHBondContact O-CB 3.38Å; K40-R44 WeakPolarHBondContact O-CG 3.4Å; K40-R44 PolarHBondContact O-N 3.11Å; I42-R44 VanDerWaalsContact C-N 3.34Å; I42-R44 PolarHBondContact O-N 3.11Å; R44-K50 WeakPolarHBondContact O-CE 3.17Å; R44-K50 WeakPolarHBondContact O-CG 3.45Å
45	A	96.2	Very high	95.4	Very high	61 Å²	61	80.1 Å²	80.1	50%	0.504	41%	0.411	S	S	.	.	H	α-helix	trans	-80.8	-23.1	177	0	0	0	0	0	112.7	R41 I42 V43 V47	R41-A45 WeakPolarHBondContact O-CB 3.29Å; R41-A45 PolarHBondContact O-N 3.2Å; I42-A45 PolarHBondContact O-N 3.22Å; I42-A45 VanDerWaalsContact O-N 3.11Å; V43-A45 VanDerWaalsContact C-N 3.28Å; V43-A45 PolarHBondContact O-N 2.89Å; A45-V47 PolarHBondContact O-N 3.37Å
46	C	97.1	Very high	95.1	Very high	27 Å²	27	85.2 Å²	85.2	18%	0.182	44%	0.444	C	S	.	.			trans	-63.8	123.5	-179.4	-178.8	0	0	0	0	111.8	H16 I42 V43 I48 C49 K50	H16-C46 PolarHBondContact ND1-SG 3.4Å; I42-C46 PolarHBondContact O-N 2.94Å; V43-C46 WeakPolarHBondContact O-CB 3.35Å; V43-C46 PolarHBondContact O-N 2.9Å; C46-I48 VanDerWaalsContact C-N 3.3Å; C46-I48 PolarHBondContact O-N 3.27Å; C46-C49 HydrophobicContact CB-CB 3.94Å; C46-C49 PolarHBondContact O-N 3.1Å; C46-C49 VanDerWaalsContact SG-SG 3.67Å; C46-K50 WeakPolarHBondContact O-CG 3.35Å; C46-K50 PolarHBondContact O-N 3.24Å
47	V	96.7	Very high	94.7	Very high	88 Å²	88	86.4 Å²	86.4	53%	0.533	45%	0.453	S	S	.	.	H	α-helix	trans	-62.2	-38.2	-176.9	177.5	0	0	0	0	111.6	A45 K50 R51	A45-V47 PolarHBondContact O-N 3.37Å; V47-K50 PolarHBondContact O-N 3.43Å; V47-R51 WeakPolarHBondContact O-CG 3.34Å; V47-R51 PolarHBondContact O-N 2.96Å
48	I	97.2	Very high	94.3	Very high	71 Å²	71	88.9 Å²	88.9	36%	0.364	47%	0.465	S	S	.	.	H	α-helix	trans	-67.8	-49	179.9	-62.7	170.1	0	0	0	109.8	H16 C46 K50 R51 F52	H16-I48 HydrophobicContact CB-CG2 4.32Å; H16-I48 WeakPolarHBondContact CD2-CG2 3.21Å; H16-I48 WeakPolarHBondContact NE2-CD1 3.2Å; C46-I48 VanDerWaalsContact C-N 3.3Å; C46-I48 PolarHBondContact O-N 3.27Å; I48-K50 VanDerWaalsContact C-N 3.3Å; I48-K50 PolarHBondContact O-N 2.83Å; I48-R51 PolarHBondContact O-N 3.43Å; I48-R51 VanDerWaalsContact O-N 3.15Å; I48-F52 HydrophobicContact CG2-CD2 3.64Å; I48-F52 HydrophobicContact CG2-CE2 3.45Å; I48-F52 VanDerWaalsContact CG2-CE2 3.45Å; I48-F52 VanDerWaalsContact O-CD2 3.23Å; I48-F52 WeakPolarHBondContact O-CD2 2.9Å; I48-F52 PolarHBondContact O-N 3.03Å
49	C	97	Very high	94	Very high	15 Å²	15	94.8 Å²	94.8	10%	0.101	49%	0.491	C	S	.	.	H	α-helix	trans	-57.3	-41.8	173.6	-59.2	0	0	0	0	112.2	V43 C46 F52 A53	V43-C49 HydrophobicContact CG1-CB 4.26Å; V43-C49 VanDerWaalsContact O-CB 3.29Å; V43-C49 WeakPolarHBondContact O-CB 3.45Å; C46-C49 HydrophobicContact CB-CB 3.94Å; C46-C49 PolarHBondContact O-N 3.1Å; C46-C49 VanDerWaalsContact SG-SG 3.67Å; C49-F52 PolarHBondContact O-N 3.15Å; C49-A53 WeakPolarHBondContact O-CB 3.45Å; C49-A53 PolarHBondContact O-N 2.98Å
50	K	95.8	Very high	93.6	Very high	121 Å²	121	103.8 Å²	103.8	53%	0.526	53%	0.53	S	S	.	.	H	α-helix	trans	-61.4	-42	176.4	-76.9	-177.8	-177.5	-176.3	0	112.5	R44 C46 V47 I48 A53 S54	R44-K50 WeakPolarHBondContact O-CE 3.17Å; R44-K50 WeakPolarHBondContact O-CG 3.45Å; C46-K50 WeakPolarHBondContact O-CG 3.35Å; C46-K50 PolarHBondContact O-N 3.24Å; V47-K50 PolarHBondContact O-N 3.43Å; I48-K50 VanDerWaalsContact C-N 3.3Å; I48-K50 PolarHBondContact O-N 2.83Å; K50-A53 PolarHBondContact O-N 3.33Å; K50-S54 WeakPolarHBondContact O-CB 3.28Å; K50-S54 PolarHBondContact O-N 3.38Å
51	R	94.6	Very high	93.3	Very high	188 Å²	188	105.8 Å²	105.8	71%	0.709	54%	0.544	S	S	*	.	H	α-helix	trans	-66.4	-40.8	178	-74.3	176.4	-178.7	-172.9	0.6	112.2	V47 I48 S54	V47-R51 WeakPolarHBondContact O-CG 3.34Å; V47-R51 PolarHBondContact O-N 2.96Å; I48-R51 PolarHBondContact O-N 3.43Å; I48-R51 VanDerWaalsContact O-N 3.15Å; R51-S54 PolarHBondContact O-OG 2.9Å
52	F	92.8	Very high	93	Very high	171 Å²	171	104 Å²	104	75%	0.75	56%	0.555	S	S	*	*	H	α-helix	trans	-74.1	-31	176.8	-75.2	-67.9	0	0	0	113	I48 C49	I48-F52 HydrophobicContact CG2-CD2 3.64Å; I48-F52 HydrophobicContact CG2-CE2 3.45Å; I48-F52 VanDerWaalsContact CG2-CE2 3.45Å; I48-F52 VanDerWaalsContact O-CD2 3.23Å; I48-F52 WeakPolarHBondContact O-CD2 2.9Å; I48-F52 PolarHBondContact O-N 3.03Å; C49-F52 PolarHBondContact O-N 3.15Å
53	A	91.7	Very high	92.7	Very high	82 Å²	82	108.5 Å²	108.5	68%	0.678	59%	0.588	S	S	*	*	H	α-helix	trans	-83.9	-10	177.1	0	0	0	0	0	113.6	C49 K50 S55	C49-A53 WeakPolarHBondContact O-CB 3.45Å; C49-A53 PolarHBondContact O-N 2.98Å; K50-A53 PolarHBondContact O-N 3.33Å; A53-S55 PolarHBondContact O-N 3.35Å
54	S	91.2	Very high	92.2	Very high	80 Å²	80	114 Å²	114	56%	0.559	62%	0.616	S	S	*	*	P	Polyproline II helix	trans	-70	124.9	179.9	62.2	0	0	0	0	110.1	K50 R51	K50-S54 WeakPolarHBondContact O-CB 3.28Å; K50-S54 PolarHBondContact O-N 3.38Å; R51-S54 PolarHBondContact O-OG 2.9Å
55	S	88	Confident	91.7	Very high	103 Å²	103	109.9 Å²	109.9	72%	0.72	61%	0.611	S	S	*	*	P	Polyproline II helix	trans	-65.3	151.1	170	-54.4	0	0	0	0	110.7	A53 F57	A53-S55 PolarHBondContact O-N 3.35Å; S55-F57 PolarHBondContact O-N 3.37Å
56	P	87.5	Confident	91.2	Very high	121 Å²	121	113 Å²	113	79%	0.786	62%	0.616	S	S	*	*	P	Polyproline II helix	trans	-50.9	139.4	168.5	-24.6	33.9	0	0	0	110.4	V58	P56-V58 PolarHBondContact O-N 3.5Å
57	F	88.2	Confident	90.4	Very high	174 Å²	174	116.4 Å²	116.4	76%	0.763	63%	0.629	S	S	*	*	P	Polyproline II helix	trans	-63.3	124.2	173.7	-176.3	-99	0	0	0	108.9	S55 Q59	S55-F57 PolarHBondContact O-N 3.37Å; F57-Q59 PolarHBondContact O-N 2.95Å
58	V	89.3	Confident	89.5	Confident	123 Å²	123	114.5 Å²	114.5	75%	0.745	63%	0.627	S	S	*	*			trans	-76.6	111.5	169.3	-178.6	0	0	0	0	106.9	P56 K60	P56-V58 PolarHBondContact O-N 3.5Å; V58-K60 PolarHBondContact O-N 3.43Å; V58-K60 VanDerWaalsContact O-N 3.1Å
59	Q	89.6	Confident	88.8	Confident	147 Å²	147	116.4 Å²	116.4	69%	0.687	64%	0.637	S	S	*	*			trans	-58.2	116.8	179	-172.5	178	16.4	0	0	109.7	F57 I61	F57-Q59 PolarHBondContact O-N 2.95Å; Q59-I61 HydrophobicContact CG-CG1 4.04Å; Q59-I61 PolarHBondContact O-N 2.9Å
60	K	89.4	Confident	88.3	Confident	189 Å²	189	118.1 Å²	118.1	82%	0.822	65%	0.647	S	S	*	*			trans	-79.9	109.8	166.9	-66.1	-175.8	-179.8	-177.9	0	107.6	V58	V58-K60 PolarHBondContact O-N 3.43Å; V58-K60 VanDerWaalsContact O-N 3.1Å
61	I	91	Very high	87.9	Confident	133 Å²	133	121.5 Å²	121.5	68%	0.682	66%	0.664	S	S	*	*	P	Polyproline II helix	trans	-89.9	126.9	176.9	-57.3	175.2	0	0	0	107.3	Q59	Q59-I61 HydrophobicContact CG-CG1 4.04Å; Q59-I61 PolarHBondContact O-N 2.9Å
62	A	90.1	Very high	87.8	Confident	84 Å²	84	113.4 Å²	113.4	69%	0.694	64%	0.638	S	S	*	*	P	Polyproline II helix	trans	-69.8	164.2	171	0	0	0	0	0	110.1	L64	A62-L64 PolarHBondContact O-N 3.43Å
63	S	90.4	Very high	87.8	Confident	119 Å²	119	113 Å²	113	83%	0.832	64%	0.636	S	S	*	*	P	Polyproline II helix	trans	-52.1	141.6	169.5	-59.4	0	0	0	0	110.3
64	L	86.6	Confident	88	Confident	129 Å²	129	112.7 Å²	112.7	68%	0.675	63%	0.627	S	S	*	*	P	Polyproline II helix	trans	-57.9	139.4	176.6	-68.9	170.6	0	0	0	109.7	A62 E66 I69	A62-L64 PolarHBondContact O-N 3.43Å; L64-E66 PolarHBondContact O-N 2.98Å; L64-I69 HydrophobicContact CB-CG2 4.4Å; L64-I69 HydrophobicContact CD1-CG2 4.36Å
65	P	85.5	Confident	88.1	Confident	81 Å²	81	113.5 Å²	113.5	53%	0.526	62%	0.621	S	S	.	*	P	Polyproline II helix	trans	-58.4	136.1	175.3	23.1	-31.3	0	0	0	109.9	E67 G68	P65-E67 WeakPolarHBondContact CB-OE2 3.11Å; P65-E67 PolarHBondContact O-N 3Å; P65-E67 VanDerWaalsContact O-N 3.17Å; P65-G68 PolarHBondContact O-N 3.26Å
66	E	86	Confident	88.4	Confident	127 Å²	127	114.2 Å²	114.2	59%	0.593	61%	0.613	S	S	*	*	G	3₁₀ helix	trans	-58.5	-31.3	-179	-169.9	177	171.1	0	0	111.1	L64 G68 I69 T70 R77	L64-E66 PolarHBondContact O-N 2.98Å; E66-G68 PolarHBondContact O-N 3.12Å; E66-G68 VanDerWaalsContact O-N 3.12Å; E66-I69 WeakPolarHBondContact O-CG1 3.17Å; E66-I69 PolarHBondContact O-N 3.17Å; E66-T70 HydrophobicContact CG-CG2 3.54Å; E66-T70 PolarHBondContact O-N 3.46Å; E66-T70 PolarHBondContact O-OG1 2.98Å; E66-R77 PolarHBondContact O-NH1 3.01Å
67	E	80.4	Confident	88.6	Confident	99 Å²	99	111 Å²	111	46%	0.463	59%	0.585	S	S	.	*	G	3₁₀ helix	trans	-53.9	-32.1	176.7	-63.9	80.3	-174.1	0	0	112.5	P65 R77 M105	P65-E67 WeakPolarHBondContact CB-OE2 3.11Å; P65-E67 PolarHBondContact O-N 3Å; P65-E67 VanDerWaalsContact O-N 3.17Å; E67-R77 VanDerWaalsContact C-NH1 3.3Å; E67-R77 VanDerWaalsContact CA-NH1 3.25Å; E67-R77 WeakPolarHBondContact O-CD 3.34Å; E67-R77 PolarHBondContact O-NH1 3.47Å; E67-M105 HydrophobicContact CB-SD 4.22Å
68	G	77.5	Confident	88.9	Confident	48 Å²	48	105 Å²	105	50%	0.495	56%	0.562	S	S	.	*	G	3₁₀ helix	trans	-90.7	-6.4	-179.5	0	0	0	0	0	115.3	P65 E66	P65-G68 PolarHBondContact O-N 3.26Å; E66-G68 PolarHBondContact O-N 3.12Å; E66-G68 VanDerWaalsContact O-N 3.12Å
69	I	82.7	Confident	89.1	Confident	111 Å²	111	100.2 Å²	100.2	57%	0.569	54%	0.539	S	S	*	.	T	Hydrogen-bonded Turn	trans	-125.2	-23.4	-172.7	56.6	170.8	0	0	0	114.5	L64 E66	L64-I69 HydrophobicContact CB-CG2 4.4Å; L64-I69 HydrophobicContact CD1-CG2 4.36Å; E66-I69 WeakPolarHBondContact O-CG1 3.17Å; E66-I69 PolarHBondContact O-N 3.17Å
70	T	87	Confident	89.4	Confident	50 Å²	50	97.4 Å²	97.4	31%	0.307	53%	0.531	S	S	.	.	S	Bend	trans	-89.1	149.6	176.8	49.5	0	0	0	0	112	E66 R77	E66-T70 HydrophobicContact CG-CG2 3.54Å; E66-T70 PolarHBondContact O-N 3.46Å; E66-T70 PolarHBondContact O-OG1 2.98Å; T70-R77 PolarHBondContact O-NH1 2.79Å; T70-R77 VanDerWaalsContact O-NH1 3.07Å; T70-R77 PolarHBondContact OG1-NH1 3.31Å; T70-R77 PolarHBondContact OG1-NH2 3.07Å
71	Q	86.5	Confident	89.7	Confident	192 Å²	192	93.5 Å²	93.5	90%	0.897	52%	0.52	S	S	*	.			trans	-65.6	138	177	-67.1	-178.1	-21.8	0	0	110.2
72	A	91.4	Very high	89.9	Confident	19 Å²	19	91 Å²	91	16%	0.157	50%	0.504	C	S	.	.			trans	-149	163.6	177.1	0	0	0	0	0	108.5	E76 R77 T106	A72-E76 HydrophobicContact CB-CB 4.14Å; A72-E76 HydrophobicContact CB-CG 4.35Å; A72-R77 HydrophobicContact CB-CG 4.31Å; A72-T106 WeakPolarHBondContact O-CG2 3.39Å; A72-T106 PolarHBondContact O-OG1 2.84Å
73	F	94.8	Very high	90.1	Very high	162 Å²	162	89 Å²	89	71%	0.711	49%	0.487	S	S	*	.			trans	-68.2	156.5	172.6	-68.9	-78.4	0	0	0	111.1	F75 E76 T106	F73-F75 PolarHBondContact O-N 2.7Å; F73-E76 HydrophobicContact CB-CB 4.33Å; F73-E76 WeakPolarHBondContact CD2-OE2 3.11Å; F73-E76 PolarHBondContact N-OE2 2.89Å; F73-E76 VanDerWaalsContact O-CB 3.23Å; F73-E76 WeakPolarHBondContact O-CB 3Å; F73-E76 PolarHBondContact O-N 3.17Å; F73-E76 VanDerWaalsContact O-N 3.14Å; F73-T106 PolarHBondContact O-OG1 2.94Å
74	P	94.2	Very high	90.2	Very high	75 Å²	75	85.5 Å²	85.5	49%	0.487	47%	0.47	S	S	.	.	T	Hydrogen-bonded Turn	trans	-52.5	133.8	172.8	-27.2	35.9	0	0	0	111.8	E76 I107	P74-E76 PolarHBondContact O-N 2.96Å; P74-E76 VanDerWaalsContact O-N 3.15Å; P74-I107 HydrophobicContact CB-CD1 4.01Å; P74-I107 HydrophobicContact CB-CG1 4.37Å; P74-I107 HydrophobicContact CG-CD1 4.33Å; P74-I107 HydrophobicContact CG-CG2 4.43Å
75	F	93.9	Very high	90.6	Very high	98 Å²	98	82.3 Å²	82.3	43%	0.43	46%	0.457	S	S	.	.	T	Hydrogen-bonded Turn	trans	63.2	2.2	-177	-60	-81.6	0	0	0	117	F73 R77 T78 C104 A109 H111	F73-F75 PolarHBondContact O-N 2.7Å; F75-R77 PolarHBondContact O-N 3.46Å; F75-T78 WeakPolarHBondContact CA-OG1 3.23Å; F75-T78 PolarHBondContact O-OG1 3.5Å; F75-C104 HydrophobicContact CD1-CB 3.85Å; F75-C104 HydrophobicContact CE1-CB 3.9Å; F75-C104 HydrophobicContact CG-CB 4.24Å; F75-C104 HydrophobicContact CZ-CB 4.33Å; F75-C104 PolarHBondContact N-SG 2.76Å; F75-A109 HydrophobicContact CE2-CB 4.47Å; F75-A109 HydrophobicContact CZ-CB 3.98Å; F75-H111 HydrophobicContact CE1-CB 4.31Å
76	E	94.3	Very high	91	Very high	118 Å²	118	82.4 Å²	82.4	55%	0.551	45%	0.453	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.3	-33.3	172	-173.7	178.9	162.8	0	0	111.5	A72 F73 P74	A72-E76 HydrophobicContact CB-CB 4.14Å; A72-E76 HydrophobicContact CB-CG 4.35Å; F73-E76 HydrophobicContact CB-CB 4.33Å; F73-E76 WeakPolarHBondContact CD2-OE2 3.11Å; F73-E76 PolarHBondContact N-OE2 2.89Å; F73-E76 VanDerWaalsContact O-CB 3.23Å; F73-E76 WeakPolarHBondContact O-CB 3Å; F73-E76 PolarHBondContact O-N 3.17Å; F73-E76 VanDerWaalsContact O-N 3.14Å; P74-E76 PolarHBondContact O-N 2.96Å; P74-E76 VanDerWaalsContact O-N 3.15Å
77	R	92.8	Very high	91.4	Very high	53 Å²	53	84.3 Å²	84.3	20%	0.2	46%	0.456	C	S	.	.	S	Bend	trans	-123.3	111.9	173.6	-61.2	176.7	-175.2	168.1	0.2	108.9	E66 E67 T70 A72 F75 M105	E66-R77 PolarHBondContact O-NH1 3.01Å; E67-R77 VanDerWaalsContact C-NH1 3.3Å; E67-R77 VanDerWaalsContact CA-NH1 3.25Å; E67-R77 WeakPolarHBondContact O-CD 3.34Å; E67-R77 PolarHBondContact O-NH1 3.47Å; T70-R77 PolarHBondContact O-NH1 2.79Å; T70-R77 VanDerWaalsContact O-NH1 3.07Å; T70-R77 PolarHBondContact OG1-NH1 3.31Å; T70-R77 PolarHBondContact OG1-NH2 3.07Å; A72-R77 HydrophobicContact CB-CG 4.31Å; F75-R77 PolarHBondContact O-N 3.46Å; R77-M105 HydrophobicContact CB-CB 4.03Å; R77-M105 HydrophobicContact CB-CG 4.37Å; R77-M105 HydrophobicContact CB-SD 4.14Å; R77-M105 PolarHBondContact O-N 2.94Å
78	T	93.8	Very high	92.1	Very high	47 Å²	47	81.1 Å²	81.1	29%	0.288	44%	0.443	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.8	125	-172.4	-62.2	0	0	0	0	110	F75 F102 T103	F75-T78 WeakPolarHBondContact CA-OG1 3.23Å; F75-T78 PolarHBondContact O-OG1 3.5Å; T78-F102 HydrophobicContact CG2-CB 3.83Å; T78-F102 HydrophobicContact CG2-CD1 4.23Å; T78-T103 CarbonylContact C-O 3.54Å; T78-T103 VanDerWaalsContact CA-O 3.31Å; T78-T103 WeakPolarHBondContact CA-O 3.44Å
79	G	93.6	Very high	92.9	Very high	24 Å²	24	87.9 Å²	87.9	25%	0.247	46%	0.459	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.1	137.3	165.8	0	0	0	0	0	109.5	F102 T103	G79-F102 CarbonylContact O-C 3.57Å; G79-F102 WeakPolarHBondContact O-CA 3.48Å; G79-T103 PolarHBondContact N-O 2.85Å; G79-T103 PolarHBondContact O-N 2.84Å
80	V	95.1	Very high	93.2	Very high	88 Å²	88	88.6 Å²	88.6	53%	0.533	46%	0.455	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.2	130.8	176.3	-175.6	0	0	0	0	108.8	L101 F102	V80-L101 CarbonylContact C-O 3.6Å; V80-L101 VanDerWaalsContact CA-O 3.31Å; V80-L101 WeakPolarHBondContact CA-O 3.5Å; V80-F102 HydrophobicContact CG1-CD1 4.44Å; V80-F102 HydrophobicContact CG1-CE1 4.22Å; V80-F102 HydrophobicContact CG2-CD1 3.75Å; V80-F102 HydrophobicContact CG2-CE1 3.95Å
81	D	95.5	Very high	93.4	Very high	107 Å²	107	89 Å²	89	57%	0.572	47%	0.469	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-142.1	168	176.1	-165.3	14.8	0	0	0	110.5	C100 L101	D81-C100 CarbonylContact O-C 3.59Å; D81-L101 HydrophobicContact CB-CB 4.48Å; D81-L101 HydrophobicContact CB-CD1 4.4Å; D81-L101 PolarHBondContact N-O 3.14Å; D81-L101 PolarHBondContact O-N 2.86Å
82	F	95.7	Very high	93.7	Very high	79 Å²	79	90.1 Å²	90.1	35%	0.346	47%	0.471	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.4	131.5	175.2	-74	-85.5	0	0	0	111.5	V99 C100 V115 M118	F82-V99 CarbonylContact C-O 3.56Å; F82-V99 WeakPolarHBondContact CA-O 3.37Å; F82-C100 HydrophobicContact CD1-CB 4.03Å; F82-C100 HydrophobicContact CE1-CB 3.56Å; F82-C100 HydrophobicContact CZ-CB 4.18Å; F82-V115 HydrophobicContact CD1-CG2 4.12Å; F82-V115 HydrophobicContact CE1-CG2 3.67Å; F82-M118 HydrophobicContact CD1-CG 4.29Å; F82-M118 HydrophobicContact CG-CG 4.39Å
83	A	95.3	Very high	93.7	Very high	43 Å²	43	93.5 Å²	93.5	36%	0.355	49%	0.492	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.9	128.7	166.4	0	0	0	0	0	110.1	Y98 V99 L101	A83-Y98 CarbonylContact O-C 3.57Å; A83-Y98 WeakPolarHBondContact O-CA 3.31Å; A83-V99 HydrophobicContact CB-CB 4.38Å; A83-V99 PolarHBondContact N-O 3.35Å; A83-V99 PolarHBondContact O-N 2.97Å; A83-L101 HydrophobicContact CB-CD1 3.74Å; A83-L101 VanDerWaalsContact N-CD1 3.27Å
84	G	92.6	Very high	93.7	Very high	45 Å²	45	89.6 Å²	89.6	46%	0.464	49%	0.485	S	S	.	.	E	Extended strand (participates in β ladder)	trans	154.4	-168.9	173.5	0	0	0	0	0	113.4
85	P	93.7	Very high	93.7	Very high	63 Å²	63	90.2 Å²	90.2	41%	0.409	48%	0.48	S	S	.	.	E	Extended strand (participates in β ladder)	cis	-73.2	144.5	3.6	29.7	-34.7	0	0	0	113.7	K96 A97 Y98	P85-K96 HydrophobicContact CB-CD 4.08Å; P85-K96 HydrophobicContact CB-CG 3.64Å; P85-A97 CarbonylContact C-O 3.58Å; P85-A97 WeakPolarHBondContact CA-O 3.5Å; P85-Y98 HydrophobicContact CB-CD1 4.45Å; P85-Y98 HydrophobicContact CB-CE1 3.92Å
86	L	94.2	Very high	93.8	Very high	83 Å²	83	90.3 Å²	90.3	44%	0.435	48%	0.481	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.5	150.1	165	-59.3	178.5	0	0	0	109.2	K96 A97 V99	L86-K96 CarbonylContact O-C 3.59Å; L86-K96 WeakPolarHBondContact O-CA 3.31Å; L86-A97 PolarHBondContact N-O 2.76Å; L86-A97 PolarHBondContact O-N 2.95Å; L86-V99 HydrophobicContact CD1-CG2 3.65Å
87	Y	95.3	Very high	93.8	Very high	167 Å²	167	84.7 Å²	84.7	66%	0.655	45%	0.454	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-104.6	103.7	171.8	-73.3	-89.7	0	0	0	108.9	K95 K96	Y87-K95 CarbonylContact C-O 3.4Å; Y87-K95 WeakPolarHBondContact CA-O 3.37Å; Y87-K96 HydrophobicContact CE1-CB 4.45Å
88	V	93.4	Very high	94	Very high	32 Å²	32	83.4 Å²	83.4	19%	0.194	45%	0.45	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.1	145	-179.9	-63.6	0	0	0	0	110.3	Y90 S94 K95 A97 L114 M116	V88-Y90 PolarHBondContact O-N 2.81Å; V88-S94 CarbonylContact O-C 3.6Å; V88-S94 WeakPolarHBondContact O-CA 3.3Å; V88-K95 PolarHBondContact N-O 3.15Å; V88-K95 PolarHBondContact O-N 3.37Å; V88-A97 HydrophobicContact CG1-CB 4.05Å; V88-A97 HydrophobicContact CG2-CB 3.73Å; V88-L114 HydrophobicContact CG1-CD1 3.99Å; V88-L114 HydrophobicContact CG1-CD2 4.21Å; V88-M116 HydrophobicContact CG2-CE 4.42Å
89	K	94.1	Very high	94.2	Very high	189 Å²	189	82.4 Å²	82.4	82%	0.822	44%	0.443	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-67.5	122.2	174.5	-174.1	177.7	-179.6	-179.9	0	109.2	G91	K89-G91 VanDerWaalsContact CE-O 3.31Å; K89-G91 WeakPolarHBondContact CE-O 3.44Å
90	Y	90.3	Very high	94.3	Very high	126 Å²	126	81.5 Å²	81.5	49%	0.494	43%	0.433	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125	89.7	175.6	-165.7	-87.7	0	0	0	108.9	V88 K92 C93 K95	V88-Y90 PolarHBondContact O-N 2.81Å; Y90-K92 PolarHBondContact O-N 3.31Å; Y90-C93 CarbonylContact C-O 3.59Å; Y90-C93 WeakPolarHBondContact CA-O 3.44Å; Y90-C93 PolarHBondContact N-O 3.19Å; Y90-C93 PolarHBondContact O-N 2.79Å; Y90-C93 VanDerWaalsContact O-N 3.14Å; Y90-C93 VanDerWaalsContact O-O 3.06Å; Y90-K95 HydrophobicContact CD1-CD 3.75Å; Y90-K95 HydrophobicContact CD1-CG 4.38Å; Y90-K95 HydrophobicContact CD2-CD 3.85Å; Y90-K95 HydrophobicContact CE1-CD 4.28Å; Y90-K95 HydrophobicContact CE2-CD 4.35Å; Y90-K95 HydrophobicContact CG-CD 3.51Å; Y90-K95 HydrophobicContact CG-CG 4.01Å
91	G	90.6	Very high	94.4	Very high	58 Å²	58	79.2 Å²	79.2	60%	0.598	42%	0.418	S	S	*	.	T	Hydrogen-bonded Turn	trans	63.5	-120	-172.1	0	0	0	0	0	111.9	K89	K89-G91 VanDerWaalsContact CE-O 3.31Å; K89-G91 WeakPolarHBondContact CE-O 3.44Å
92	K	92.9	Very high	94.5	Very high	217 Å²	217	76.8 Å²	76.8	94%	0.943	40%	0.402	S	S	*	.	T	Hydrogen-bonded Turn	trans	-89.4	-5.4	177.6	-65	-176.1	-179.4	179.1	0	113.6	Y90	Y90-K92 PolarHBondContact O-N 3.31Å
93	C	92.3	Very high	94.5	Very high	89 Å²	89	75.5 Å²	75.5	60%	0.601	40%	0.401	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-114.5	163.3	-178.5	-56.4	0	0	0	0	110.4	Y90	Y90-C93 CarbonylContact C-O 3.59Å; Y90-C93 WeakPolarHBondContact CA-O 3.44Å; Y90-C93 PolarHBondContact N-O 3.19Å; Y90-C93 PolarHBondContact O-N 2.79Å; Y90-C93 VanDerWaalsContact O-N 3.14Å; Y90-C93 VanDerWaalsContact O-O 3.06Å
94	S	94	Very high	94.4	Very high	81 Å²	81	73.4 Å²	73.4	57%	0.566	38%	0.384	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-95.3	141.1	162.2	56.5	0	0	0	0	109.5	V88	V88-S94 CarbonylContact O-C 3.6Å; V88-S94 WeakPolarHBondContact O-CA 3.3Å
95	K	94.4	Very high	94.3	Very high	88 Å²	88	75.3 Å²	75.3	38%	0.383	38%	0.382	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.6	144.6	171.8	-77.7	-170.5	-179.5	179.1	0	110	Y87 V88 Y90	Y87-K95 CarbonylContact C-O 3.4Å; Y87-K95 WeakPolarHBondContact CA-O 3.37Å; V88-K95 PolarHBondContact N-O 3.15Å; V88-K95 PolarHBondContact O-N 3.37Å; Y90-K95 HydrophobicContact CD1-CD 3.75Å; Y90-K95 HydrophobicContact CD1-CG 4.38Å; Y90-K95 HydrophobicContact CD2-CD 3.85Å; Y90-K95 HydrophobicContact CE1-CD 4.28Å; Y90-K95 HydrophobicContact CE2-CD 4.35Å; Y90-K95 HydrophobicContact CG-CD 3.51Å; Y90-K95 HydrophobicContact CG-CG 4.01Å
96	K	95.6	Very high	94.1	Very high	100 Å²	100	74.8 Å²	74.8	44%	0.435	38%	0.378	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-68.1	129.8	171.1	-169	-178.1	-177	-173.5	0	108.6	P85 L86 Y87 Y98	P85-K96 HydrophobicContact CB-CD 4.08Å; P85-K96 HydrophobicContact CB-CG 3.64Å; L86-K96 CarbonylContact O-C 3.59Å; L86-K96 WeakPolarHBondContact O-CA 3.31Å; Y87-K96 HydrophobicContact CE1-CB 4.45Å; K96-Y98 WeakPolarHBondContact CE-OH 3.34Å; K96-Y98 PolarHBondContact NZ-OH 2.79Å
97	A	95.4	Very high	94	Very high	0 Å²	0	75.6 Å²	75.6	0%	0	38%	0.381	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.3	167.3	175.2	0	0	0	0	0	109.6	P85 L86 V88 L114 V115 M116	P85-A97 CarbonylContact C-O 3.58Å; P85-A97 WeakPolarHBondContact CA-O 3.5Å; L86-A97 PolarHBondContact N-O 2.76Å; L86-A97 PolarHBondContact O-N 2.95Å; V88-A97 HydrophobicContact CG1-CB 4.05Å; V88-A97 HydrophobicContact CG2-CB 3.73Å; A97-L114 HydrophobicContact CB-CD1 3.75Å; A97-L114 HydrophobicContact CB-CG 4.23Å; A97-V115 CarbonylContact C-O 3.58Å; A97-V115 VanDerWaalsContact CA-O 3.25Å; A97-V115 WeakPolarHBondContact CA-O 3.31Å; A97-V115 WeakPolarHBondContact CB-O 3.44Å; A97-M116 HydrophobicContact CB-SD 4.19Å
98	Y	97	Very high	93.8	Very high	26 Å²	26	78 Å²	78	10%	0.102	39%	0.389	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.8	159.3	172.4	-55.6	-96.7	0	0	0	108.4	A83 P85 K96 V115 M118	A83-Y98 CarbonylContact O-C 3.57Å; A83-Y98 WeakPolarHBondContact O-CA 3.31Å; P85-Y98 HydrophobicContact CB-CD1 4.45Å; P85-Y98 HydrophobicContact CB-CE1 3.92Å; K96-Y98 WeakPolarHBondContact CE-OH 3.34Å; K96-Y98 PolarHBondContact NZ-OH 2.79Å; Y98-V115 PolarHBondContact N-O 3.28Å; Y98-V115 PolarHBondContact O-N 2.83Å; Y98-M118 HydrophobicContact CD1-CG 4.18Å; Y98-M118 HydrophobicContact CD1-SD 3.89Å; Y98-M118 HydrophobicContact CD2-CG 3.77Å; Y98-M118 HydrophobicContact CD2-SD 4.46Å; Y98-M118 HydrophobicContact CE1-CE 4.23Å; Y98-M118 HydrophobicContact CE1-CG 4.25Å; Y98-M118 HydrophobicContact CE1-SD 3.67Å; Y98-M118 HydrophobicContact CE2-CG 3.82Å; Y98-M118 HydrophobicContact CE2-SD 4.25Å; Y98-M118 HydrophobicContact CG-CG 3.93Å; Y98-M118 HydrophobicContact CG-SD 4.27Å
99	V	96.6	Very high	93.9	Very high	25 Å²	25	78 Å²	78	15%	0.152	39%	0.392	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.2	115.9	168.7	-177.4	0	0	0	0	107	F82 A83 L86 L101 L112 E113 L114	F82-V99 CarbonylContact C-O 3.56Å; F82-V99 WeakPolarHBondContact CA-O 3.37Å; A83-V99 HydrophobicContact CB-CB 4.38Å; A83-V99 PolarHBondContact N-O 3.35Å; A83-V99 PolarHBondContact O-N 2.97Å; L86-V99 HydrophobicContact CD1-CG2 3.65Å; V99-L101 VanDerWaalsContact O-CD1 3.3Å; V99-L101 WeakPolarHBondContact O-CD1 3.45Å; V99-L112 HydrophobicContact CG1-CB 3.82Å; V99-L112 HydrophobicContact CG1-CD2 3.74Å; V99-L112 HydrophobicContact CG1-CG 4.22Å; V99-E113 CarbonylContact C-O 3.5Å; V99-E113 VanDerWaalsContact CA-O 3.32Å; V99-E113 WeakPolarHBondContact CA-O 3.32Å; V99-L114 HydrophobicContact CG2-CD1 4.4Å
100	C	96.8	Very high	94	Very high	6 Å²	6	72.6 Å²	72.6	4%	0.041	38%	0.375	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.2	122.7	166.3	-165.8	0	0	0	0	108.2	D81 F82 F102 L112 E113 V115	D81-C100 CarbonylContact O-C 3.59Å; F82-C100 HydrophobicContact CD1-CB 4.03Å; F82-C100 HydrophobicContact CE1-CB 3.56Å; F82-C100 HydrophobicContact CZ-CB 4.18Å; C100-F102 HydrophobicContact CB-CE2 3.93Å; C100-F102 HydrophobicContact CB-CZ 4.42Å; C100-F102 WeakPolarHBondContact SG-CE2 3.11Å; C100-F102 WeakPolarHBondContact SG-CZ 3.04Å; C100-L112 WeakPolarHBondContact O-CA 3.25Å; C100-E113 HydrophobicContact CB-CB 4.26Å; C100-E113 PolarHBondContact N-O 2.79Å; C100-E113 PolarHBondContact O-N 2.88Å; C100-V115 HydrophobicContact CB-CG1 4.29Å
101	L	96.9	Very high	94.3	Very high	39 Å²	39	71.5 Å²	71.5	20%	0.204	37%	0.374	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.6	117	178.5	-57.9	96.7	0	0	0	109.2	V80 D81 A83 V99 V110 L112	V80-L101 CarbonylContact C-O 3.6Å; V80-L101 VanDerWaalsContact CA-O 3.31Å; V80-L101 WeakPolarHBondContact CA-O 3.5Å; D81-L101 HydrophobicContact CB-CB 4.48Å; D81-L101 HydrophobicContact CB-CD1 4.4Å; D81-L101 PolarHBondContact N-O 3.14Å; D81-L101 PolarHBondContact O-N 2.86Å; A83-L101 HydrophobicContact CB-CD1 3.74Å; A83-L101 VanDerWaalsContact N-CD1 3.27Å; V99-L101 VanDerWaalsContact O-CD1 3.3Å; V99-L101 WeakPolarHBondContact O-CD1 3.45Å; L101-V110 HydrophobicContact CB-CG1 4.36Å; L101-V110 HydrophobicContact CD2-CG1 4.39Å; L101-L112 HydrophobicContact CB-CD2 4.18Å; L101-L112 HydrophobicContact CD2-CD2 3.75Å; L101-L112 HydrophobicContact CG-CD2 3.65Å
102	F	96.8	Very high	94.6	Very high	56 Å²	56	73.7 Å²	73.7	25%	0.246	37%	0.372	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.3	102.3	171.5	-61.1	-89.2	0	0	0	108.6	T78 G79 V80 C100 V110 H111 E113	T78-F102 HydrophobicContact CG2-CB 3.83Å; T78-F102 HydrophobicContact CG2-CD1 4.23Å; G79-F102 CarbonylContact O-C 3.57Å; G79-F102 WeakPolarHBondContact O-CA 3.48Å; V80-F102 HydrophobicContact CG1-CD1 4.44Å; V80-F102 HydrophobicContact CG1-CE1 4.22Å; V80-F102 HydrophobicContact CG2-CD1 3.75Å; V80-F102 HydrophobicContact CG2-CE1 3.95Å; C100-F102 HydrophobicContact CB-CE2 3.93Å; C100-F102 HydrophobicContact CB-CZ 4.42Å; C100-F102 WeakPolarHBondContact SG-CE2 3.11Å; C100-F102 WeakPolarHBondContact SG-CZ 3.04Å; F102-V110 CarbonylContact O-C 3.48Å; F102-V110 WeakPolarHBondContact O-CA 3.46Å; F102-H111 HydrophobicContact CB-CB 4.15Å; F102-H111 AromaticContact CD2-CD2 3.72Å; F102-H111 PolarHBondContact N-O 3.29Å; F102-H111 PolarHBondContact O-N 2.89Å; F102-E113 HydrophobicContact CE2-CB 4.19Å
103	T	95.4	Very high	94.8	Very high	52 Å²	52	67.8 Å²	67.8	32%	0.319	35%	0.348	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.5	114	-177.1	-57.7	0	0	0	0	110.5	T78 G79 M105 A109 V110	T78-T103 CarbonylContact C-O 3.54Å; T78-T103 VanDerWaalsContact CA-O 3.31Å; T78-T103 WeakPolarHBondContact CA-O 3.44Å; G79-T103 PolarHBondContact N-O 2.85Å; G79-T103 PolarHBondContact O-N 2.84Å; T103-M105 PolarHBondContact O-N 2.82Å; T103-A109 CarbonylContact C-O 3.58Å; T103-A109 WeakPolarHBondContact CA-O 3.39Å; T103-V110 HydrophobicContact CG2-CG2 4.23Å
104	C	93.6	Very high	94.9	Very high	0 Å²	0	68 Å²	68	0%	0	34%	0.342	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-67.5	121.9	172.2	174.6	0	0	0	0	110.5	F75 T106 I107 R108 A109	F75-C104 HydrophobicContact CD1-CB 3.85Å; F75-C104 HydrophobicContact CE1-CB 3.9Å; F75-C104 HydrophobicContact CG-CB 4.24Å; F75-C104 HydrophobicContact CZ-CB 4.33Å; F75-C104 PolarHBondContact N-SG 2.76Å; C104-T106 VanDerWaalsContact C-N 3.34Å; C104-T106 PolarHBondContact O-N 2.78Å; C104-T106 PolarHBondContact SG-N 2.76Å; C104-I107 HydrophobicContact CB-CG1 4.18Å; C104-I107 VanDerWaalsContact SG-CG1 3.58Å; C104-R108 WeakPolarHBondContact O-CA 3.46Å; C104-R108 PolarHBondContact O-N 2.8Å; C104-A109 HydrophobicContact CB-CB 4.27Å; C104-A109 PolarHBondContact N-O 2.82Å
105	M	90.8	Very high	94.9	Very high	84 Å²	84	65.4 Å²	65.4	41%	0.414	32%	0.323	S	S	.	.	T	Hydrogen-bonded Turn	trans	-72.2	-26.6	179.5	-63.9	-179.1	177.8	0	0	113	E67 R77 T103	E67-M105 HydrophobicContact CB-SD 4.22Å; R77-M105 HydrophobicContact CB-CB 4.03Å; R77-M105 HydrophobicContact CB-CG 4.37Å; R77-M105 HydrophobicContact CB-SD 4.14Å; R77-M105 PolarHBondContact O-N 2.94Å; T103-M105 PolarHBondContact O-N 2.82Å
106	T	89.9	Confident	94.8	Very high	53 Å²	53	65.8 Å²	65.8	33%	0.325	33%	0.327	S	S	.	.	T	Hydrogen-bonded Turn	trans	-72.1	-58.4	179.9	-43.8	0	0	0	0	113.2	A72 F73 C104	A72-T106 WeakPolarHBondContact O-CG2 3.39Å; A72-T106 PolarHBondContact O-OG1 2.84Å; F73-T106 PolarHBondContact O-OG1 2.94Å; C104-T106 VanDerWaalsContact C-N 3.34Å; C104-T106 PolarHBondContact O-N 2.78Å; C104-T106 PolarHBondContact SG-N 2.76Å
107	I	91.9	Very high	94.6	Very high	100 Å²	100	65.2 Å²	65.2	51%	0.513	33%	0.329	S	S	.	.	T	Hydrogen-bonded Turn	trans	-106.9	1.4	-172.8	61.5	162.3	0	0	0	113.4	P74 C104 A109	P74-I107 HydrophobicContact CB-CD1 4.01Å; P74-I107 HydrophobicContact CB-CG1 4.37Å; P74-I107 HydrophobicContact CG-CD1 4.33Å; P74-I107 HydrophobicContact CG-CG2 4.43Å; C104-I107 HydrophobicContact CB-CG1 4.18Å; C104-I107 VanDerWaalsContact SG-CG1 3.58Å; I107-A109 HydrophobicContact CD1-CB 3.66Å; I107-A109 HydrophobicContact CG1-CB 3.82Å; I107-A109 PolarHBondContact O-N 3.21Å; I107-A109 VanDerWaalsContact O-N 3.17Å
108	R	90.6	Very high	94.4	Very high	216 Å²	216	70.3 Å²	70.3	82%	0.815	35%	0.354	S	S	*	.			trans	58.7	21.6	-177.1	-55.2	-176.3	177.9	164.7	-0.3	114.7	C104	C104-R108 WeakPolarHBondContact O-CA 3.46Å; C104-R108 PolarHBondContact O-N 2.8Å
109	A	95.4	Very high	94	Very high	32 Å²	32	73 Å²	73	26%	0.264	38%	0.376	S	S	.	.			trans	-69.3	144.8	171	0	0	0	0	0	110.5	F75 T103 C104 I107	F75-A109 HydrophobicContact CE2-CB 4.47Å; F75-A109 HydrophobicContact CZ-CB 3.98Å; T103-A109 CarbonylContact C-O 3.58Å; T103-A109 WeakPolarHBondContact CA-O 3.39Å; C104-A109 HydrophobicContact CB-CB 4.27Å; C104-A109 PolarHBondContact N-O 2.82Å; I107-A109 HydrophobicContact CD1-CB 3.66Å; I107-A109 HydrophobicContact CG1-CB 3.82Å; I107-A109 PolarHBondContact O-N 3.21Å; I107-A109 VanDerWaalsContact O-N 3.17Å
110	V	97.2	Very high	93.2	Very high	76 Å²	76	78.3 Å²	78.3	46%	0.461	41%	0.409	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.1	122.4	178.8	-173.9	0	0	0	0	109	L101 F102 T103 L112	L101-V110 HydrophobicContact CB-CG1 4.36Å; L101-V110 HydrophobicContact CD2-CG1 4.39Å; F102-V110 CarbonylContact O-C 3.48Å; F102-V110 WeakPolarHBondContact O-CA 3.46Å; T103-V110 HydrophobicContact CG2-CG2 4.23Å; V110-L112 HydrophobicContact CG1-CD2 3.59Å; V110-L112 HydrophobicContact CG1-CG 4.21Å
111	H	97.2	Very high	91.9	Very high	103 Å²	103	89.1 Å²	89.1	48%	0.477	47%	0.467	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.6	131.2	168	175.5	74.8	0	0	0	108.9	F75 F102	F75-H111 HydrophobicContact CE1-CB 4.31Å; F102-H111 HydrophobicContact CB-CB 4.15Å; F102-H111 AromaticContact CD2-CD2 3.72Å; F102-H111 PolarHBondContact N-O 3.29Å; F102-H111 PolarHBondContact O-N 2.89Å
112	L	97	Very high	91.7	Very high	104 Å²	104	91.6 Å²	91.6	55%	0.545	48%	0.48	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.3	128.7	-175.4	-60.7	178.3	0	0	0	109.6	V99 C100 L101 V110	V99-L112 HydrophobicContact CG1-CB 3.82Å; V99-L112 HydrophobicContact CG1-CD2 3.74Å; V99-L112 HydrophobicContact CG1-CG 4.22Å; C100-L112 WeakPolarHBondContact O-CA 3.25Å; L101-L112 HydrophobicContact CB-CD2 4.18Å; L101-L112 HydrophobicContact CD2-CD2 3.75Å; L101-L112 HydrophobicContact CG-CD2 3.65Å; V110-L112 HydrophobicContact CG1-CD2 3.59Å; V110-L112 HydrophobicContact CG1-CG 4.21Å
113	E	96.2	Very high	91.4	Very high	94 Å²	94	93.5 Å²	93.5	44%	0.439	49%	0.492	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.6	131.2	176.7	-172.1	177.7	178.1	0	0	110.5	V99 C100 F102 V115	V99-E113 CarbonylContact C-O 3.5Å; V99-E113 VanDerWaalsContact CA-O 3.32Å; V99-E113 WeakPolarHBondContact CA-O 3.32Å; C100-E113 HydrophobicContact CB-CB 4.26Å; C100-E113 PolarHBondContact N-O 2.79Å; C100-E113 PolarHBondContact O-N 2.88Å; F102-E113 HydrophobicContact CE2-CB 4.19Å; E113-V115 HydrophobicContact CG-CG1 4.35Å
114	L	94.5	Very high	91.2	Very high	92 Å²	92	95.8 Å²	95.8	48%	0.482	50%	0.502	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-84.7	117.9	176	-174.6	75.6	0	0	0	109.8	V88 A97 V99 M116	V88-L114 HydrophobicContact CG1-CD1 3.99Å; V88-L114 HydrophobicContact CG1-CD2 4.21Å; A97-L114 HydrophobicContact CB-CD1 3.75Å; A97-L114 HydrophobicContact CB-CG 4.23Å; V99-L114 HydrophobicContact CG2-CD1 4.4Å; L114-M116 HydrophobicContact CD2-CE 4.47Å
115	V	94.7	Very high	91	Very high	28 Å²	28	101.4 Å²	101.4	17%	0.17	53%	0.531	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.4	148.7	178.6	-59.6	0	0	0	0	111.5	F82 A97 Y98 C100 E113 N117	F82-V115 HydrophobicContact CD1-CG2 4.12Å; F82-V115 HydrophobicContact CE1-CG2 3.67Å; A97-V115 CarbonylContact C-O 3.58Å; A97-V115 VanDerWaalsContact CA-O 3.25Å; A97-V115 WeakPolarHBondContact CA-O 3.31Å; A97-V115 WeakPolarHBondContact CB-O 3.44Å; Y98-V115 PolarHBondContact N-O 3.28Å; Y98-V115 PolarHBondContact O-N 2.83Å; C100-V115 HydrophobicContact CB-CG1 4.29Å; E113-V115 HydrophobicContact CG-CG1 4.35Å; V115-N117 WeakPolarHBondContact CB-O 3.35Å; V115-N117 WeakPolarHBondContact CG2-O 3.5Å
116	M	92.5	Very high	91	Very high	95 Å²	95	102.5 Å²	102.5	47%	0.468	54%	0.539	S	S	.	.	S	Bend	trans	-89.7	-16.4	-179.7	-62.8	-66.9	168.4	0	0	112.9	V88 A97 L114	V88-M116 HydrophobicContact CG2-CE 4.42Å; A97-M116 HydrophobicContact CB-SD 4.19Å; L114-M116 HydrophobicContact CD2-CE 4.47Å
117	N	90.4	Very high	91.1	Very high	88 Å²	88	105.8 Å²	105.8	47%	0.471	55%	0.553	S	S	.	*	S	Bend	trans	-144.8	171.6	176.3	62.9	39.1	0	0	0	109.3	V115 S119	V115-N117 WeakPolarHBondContact CB-O 3.35Å; V115-N117 WeakPolarHBondContact CG2-O 3.5Å; N117-S119 PolarHBondContact OD1-N 3.14Å
118	M	90.7	Very high	91	Very high	107 Å²	107	106.2 Å²	106.2	53%	0.527	56%	0.556	S	S	.	*	S	Bend	trans	-105.6	29.2	176.6	-59.7	179.3	-59.8	0	0	110.9	F82 Y98	F82-M118 HydrophobicContact CD1-CG 4.29Å; F82-M118 HydrophobicContact CG-CG 4.39Å; Y98-M118 HydrophobicContact CD1-CG 4.18Å; Y98-M118 HydrophobicContact CD1-SD 3.89Å; Y98-M118 HydrophobicContact CD2-CG 3.77Å; Y98-M118 HydrophobicContact CD2-SD 4.46Å; Y98-M118 HydrophobicContact CE1-CE 4.23Å; Y98-M118 HydrophobicContact CE1-CG 4.25Å; Y98-M118 HydrophobicContact CE1-SD 3.67Å; Y98-M118 HydrophobicContact CE2-CG 3.82Å; Y98-M118 HydrophobicContact CE2-SD 4.25Å; Y98-M118 HydrophobicContact CG-CG 3.93Å; Y98-M118 HydrophobicContact CG-SD 4.27Å
119	S	88.9	Confident	91.1	Very high	82 Å²	82	97.8 Å²	97.8	57%	0.573	54%	0.536	S	S	*	.			trans	-88.8	148.8	-178.2	-61.9	0	0	0	0	110.5	N117	N117-S119 PolarHBondContact OD1-N 3.14Å
120	T	79.5	Confident	90.7	Very high	138 Å²	138	103.3 Å²	103.3	85%	0.847	56%	0.558	S	S	*	*			trans	-100.4	119.5	163.7	55.7	0	0	0	0	107.1
121	D	70.2	Confident	90.1	Very high	232 Å²	232	105.7 Å²	105.7	100%	1.241	57%	0.567	S	S	*	*			trans	-70.3	0	171.7	-71.5	-25.7	0	0	0	111.9

Retrieved 121 of 121 residues in 23.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).