A0A077ZLP9_TRITR Loading...

Cell wall-associated hydrolase

AlphaFold DB , UniProt , Accession A0A077ZLP9, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 131 aa.

						>A0A077ZLP9_TRITR|A0A077ZLP9
MEQPRTVERFAMLVVSSCSEHRFICRRQRGAPSQLTAGAAVCGRVDGLGQQRLSVPHIAAQLCHWRDNWCTRDRDRTVSRRSEPSSRTALIGEQPNPWDRIQPQDAMSRHRGAKPPRRCGLLGEISLLSPG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	42.7	Very low	52.4	Low	241 Å²	241	134.3 Å²	134.3	100%	1.187	66%	0.658	S	S	*	*				0	90.7	0	-119.3	-174.3	-85.4	0	0	106.4
2	E	49.4	Very low	52.6	Low	184 Å²	184	131.4 Å²	131.4	86%	0.86	64%	0.644	S	S	*	*	P	Polyproline II helix	trans	-70.1	128	-179.4	-108.6	-77.7	86.7	0	0	109.1
3	Q	43.1	Very low	52.4	Low	138 Å²	138	130.4 Å²	130.4	65%	0.645	64%	0.642	S	S	*	*	P	Polyproline II helix	trans	-77.6	125.1	-176.8	-70.6	-159	66.6	0	0	109.8	R5	Q3-R5 PolarHBondContact O-N 3Å
4	P	48.7	Very low	52.6	Low	44 Å²	44	126.6 Å²	126.6	29%	0.286	63%	0.63	S	S	.	*	P	Polyproline II helix	trans	-65.5	132.2	-177.5	21.9	-28.7	0	0	0	110.1	E8 R9 M12	P4-E8 HydrophobicContact CB-CB 3.83Å; P4-E8 WeakPolarHBondContact CB-OE2 3.5Å; P4-R9 HydrophobicContact CG-CG 4.38Å; P4-R9 PolarHBondContact O-NE 3Å; P4-M12 HydrophobicContact CB-CE 3.7Å; P4-M12 HydrophobicContact CG-CE 3.38Å
5	R	53.4	Low	52.7	Low	202 Å²	202	125.1 Å²	125.1	76%	0.762	63%	0.629	S	S	*	*	P	Polyproline II helix	trans	-58.8	150.7	-177.9	-63.4	-167.4	-105.6	-177.2	-5.8	109.7	Q3 V7 E8 R9	Q3-R5 PolarHBondContact O-N 3Å; R5-V7 PolarHBondContact O-N 3.13Å; R5-E8 WeakPolarHBondContact O-CA 3.33Å; R5-E8 WeakPolarHBondContact O-CB 3.36Å; R5-E8 PolarHBondContact O-N 2.86Å; R5-R9 PolarHBondContact O-N 3.45Å
6	T	55.2	Low	52.6	Low	120 Å²	120	121.6 Å²	121.6	74%	0.736	62%	0.62	S	S	*	*	H	α-helix	trans	-47.4	-33.8	-171.3	-51.4	0	0	0	0	114.9	R9 F10	T6-R9 PolarHBondContact O-N 2.96Å; T6-F10 PolarHBondContact O-N 3.14Å; T6-F10 VanDerWaalsContact O-N 3.07Å
7	V	58.8	Low	52.5	Low	114 Å²	114	118.6 Å²	118.6	69%	0.691	61%	0.613	S	S	*	*	H	α-helix	trans	-69	-34.8	175.5	-63.5	0	0	0	0	113.5	R5 F10 A11	R5-V7 PolarHBondContact O-N 3.13Å; V7-F10 PolarHBondContact O-N 3.41Å; V7-A11 PolarHBondContact O-N 3.49Å
8	E	57.9	Low	52.1	Low	108 Å²	108	114.8 Å²	114.8	51%	0.505	60%	0.598	S	S	.	*	H	α-helix	trans	-72.6	-34.2	173.9	-70.2	-162.5	126.9	0	0	111.4	P4 R5 F10 A11 M12	P4-E8 HydrophobicContact CB-CB 3.83Å; P4-E8 WeakPolarHBondContact CB-OE2 3.5Å; R5-E8 WeakPolarHBondContact O-CA 3.33Å; R5-E8 WeakPolarHBondContact O-CB 3.36Å; R5-E8 PolarHBondContact O-N 2.86Å; E8-F10 VanDerWaalsContact C-N 3.3Å; E8-F10 PolarHBondContact O-N 3.17Å; E8-A11 PolarHBondContact O-N 3.17Å; E8-M12 WeakPolarHBondContact O-CB 3.34Å; E8-M12 WeakPolarHBondContact O-CG 3.33Å; E8-M12 PolarHBondContact O-N 3.08Å
9	R	55.7	Low	52	Low	121 Å²	121	114.2 Å²	114.2	46%	0.457	60%	0.604	S	S	.	*	H	α-helix	trans	-60.4	-43	169.8	-68.4	-175.4	176.3	-175.9	-4	111.3	P4 R5 T6 M12 L13	P4-R9 HydrophobicContact CG-CG 4.38Å; P4-R9 PolarHBondContact O-NE 3Å; R5-R9 PolarHBondContact O-N 3.45Å; T6-R9 PolarHBondContact O-N 2.96Å; R9-M12 PolarHBondContact O-N 2.86Å; R9-L13 WeakPolarHBondContact O-CB 3.5Å; R9-L13 WeakPolarHBondContact O-CG 3.5Å; R9-L13 PolarHBondContact O-N 2.76Å
10	F	55	Low	52.1	Low	152 Å²	152	117 Å²	117	67%	0.667	61%	0.614	S	S	*	*	H	α-helix	trans	-64.6	-44.1	176.2	-156.4	-90.8	0	0	0	111.7	T6 V7 E8 M12 L13 V14	T6-F10 PolarHBondContact O-N 3.14Å; T6-F10 VanDerWaalsContact O-N 3.07Å; V7-F10 PolarHBondContact O-N 3.41Å; E8-F10 VanDerWaalsContact C-N 3.3Å; E8-F10 PolarHBondContact O-N 3.17Å; F10-M12 PolarHBondContact O-N 3.17Å; F10-L13 PolarHBondContact O-N 2.95Å; F10-V14 HydrophobicContact CD1-CG2 4.21Å; F10-V14 HydrophobicContact CE1-CG2 4.15Å; F10-V14 WeakPolarHBondContact O-CG2 3.18Å; F10-V14 PolarHBondContact O-N 2.92Å
11	A	57.1	Low	52.1	Low	53 Å²	53	116.9 Å²	116.9	44%	0.438	61%	0.61	S	S	.	*	H	α-helix	trans	-62.3	-42.3	175.7	0	0	0	0	0	112.4	V7 E8 V14 V15	V7-A11 PolarHBondContact O-N 3.49Å; E8-A11 PolarHBondContact O-N 3.17Å; A11-V14 PolarHBondContact O-N 2.89Å; A11-V15 WeakPolarHBondContact O-CG2 3.4Å; A11-V15 PolarHBondContact O-N 3.16Å
12	M	54.1	Low	52.2	Low	100 Å²	100	117 Å²	117	49%	0.493	60%	0.597	S	S	.	*	H	α-helix	trans	-66	-37.2	175.7	-76.9	-167.8	-76	0	0	112.2	P4 E8 R9 F10 V14 V15 S16	P4-M12 HydrophobicContact CB-CE 3.7Å; P4-M12 HydrophobicContact CG-CE 3.38Å; E8-M12 WeakPolarHBondContact O-CB 3.34Å; E8-M12 WeakPolarHBondContact O-CG 3.33Å; E8-M12 PolarHBondContact O-N 3.08Å; R9-M12 PolarHBondContact O-N 2.86Å; F10-M12 PolarHBondContact O-N 3.17Å; M12-V14 VanDerWaalsContact C-N 3.34Å; M12-V15 PolarHBondContact O-N 2.86Å; M12-S16 WeakPolarHBondContact O-CB 3.5Å; M12-S16 PolarHBondContact O-N 3.29Å
13	L	50.6	Low	51.9	Low	118 Å²	118	115.2 Å²	115.2	62%	0.618	59%	0.587	S	S	*	*	H	α-helix	trans	-62.7	-41	172.8	-79.9	163.2	0	0	0	111.6	R9 F10 S16 S17	R9-L13 WeakPolarHBondContact O-CB 3.5Å; R9-L13 WeakPolarHBondContact O-CG 3.5Å; R9-L13 PolarHBondContact O-N 2.76Å; F10-L13 PolarHBondContact O-N 2.95Å; L13-S16 PolarHBondContact O-N 2.99Å; L13-S17 VanDerWaalsContact O-CB 3.27Å; L13-S17 WeakPolarHBondContact O-CB 3.38Å; L13-S17 PolarHBondContact O-N 3.36Å
14	V	54.5	Low	52.1	Low	78 Å²	78	116.2 Å²	116.2	47%	0.473	60%	0.595	S	S	.	*	H	α-helix	trans	-64.8	-45.6	175.1	174.2	0	0	0	0	110.8	F10 A11 M12 S17 C18	F10-V14 HydrophobicContact CD1-CG2 4.21Å; F10-V14 HydrophobicContact CE1-CG2 4.15Å; F10-V14 WeakPolarHBondContact O-CG2 3.18Å; F10-V14 PolarHBondContact O-N 2.92Å; A11-V14 PolarHBondContact O-N 2.89Å; M12-V14 VanDerWaalsContact C-N 3.34Å; V14-S17 PolarHBondContact O-N 3.09Å; V14-C18 WeakPolarHBondContact O-CB 3.38Å; V14-C18 PolarHBondContact O-N 2.87Å; V14-C18 PolarHBondContact O-SG 3.09Å
15	V	53.6	Low	52.1	Low	103 Å²	103	118.6 Å²	118.6	62%	0.624	61%	0.612	S	S	*	*	H	α-helix	trans	-65.3	-41.1	177.5	175.1	0	0	0	0	111.7	A11 M12 C18 S19	A11-V15 WeakPolarHBondContact O-CG2 3.4Å; A11-V15 PolarHBondContact O-N 3.16Å; M12-V15 PolarHBondContact O-N 2.86Å; V15-C18 CarbonylContact O-C 3.37Å; V15-C18 PolarHBondContact O-N 2.81Å; V15-S19 PolarHBondContact O-N 2.76Å
16	S	52.5	Low	51.6	Low	69 Å²	69	119.6 Å²	119.6	48%	0.483	62%	0.615	S	S	.	*	H	α-helix	trans	-67	-42.4	178.9	-170.2	0	0	0	0	111.5	M12 L13 C18 S19 E20	M12-S16 WeakPolarHBondContact O-CB 3.5Å; M12-S16 PolarHBondContact O-N 3.29Å; L13-S16 PolarHBondContact O-N 2.99Å; S16-C18 VanDerWaalsContact C-N 3.28Å; S16-C18 PolarHBondContact O-N 3.23Å; S16-S19 PolarHBondContact O-N 2.78Å; S16-E20 PolarHBondContact O-N 3.12Å
17	S	50.1	Low	51.2	Low	72 Å²	72	123 Å²	123	50%	0.503	62%	0.615	S	S	.	*	H	α-helix	trans	-64.3	-36.1	174.7	-168.4	0	0	0	0	111.2	L13 V14 S19 E20 H21	L13-S17 VanDerWaalsContact O-CB 3.27Å; L13-S17 WeakPolarHBondContact O-CB 3.38Å; L13-S17 PolarHBondContact O-N 3.36Å; V14-S17 PolarHBondContact O-N 3.09Å; S17-S19 VanDerWaalsContact C-N 3.27Å; S17-S19 PolarHBondContact O-N 2.92Å; S17-E20 PolarHBondContact O-N 3.24Å; S17-H21 WeakPolarHBondContact O-CB 3.42Å; S17-H21 PolarHBondContact O-N 3.39Å; S17-H21 VanDerWaalsContact O-N 3.11Å
18	C	45.6	Very low	50.6	Low	50 Å²	50	126.3 Å²	126.3	34%	0.338	62%	0.623	S	S	.	*	H	α-helix	trans	-71.1	-14.5	172	-69.8	0	0	0	0	114.7	V14 V15 S16 H21 C25	V14-C18 WeakPolarHBondContact O-CB 3.38Å; V14-C18 PolarHBondContact O-N 2.87Å; V14-C18 PolarHBondContact O-SG 3.09Å; V15-C18 CarbonylContact O-C 3.37Å; V15-C18 PolarHBondContact O-N 2.81Å; S16-C18 VanDerWaalsContact C-N 3.28Å; S16-C18 PolarHBondContact O-N 3.23Å; C18-H21 CarbonylContact C-O 3.56Å; C18-C25 VanDerWaalsContact SG-SG 3.62Å
19	S	50.1	Low	49.8	Very low	102 Å²	102	131 Å²	131	71%	0.713	64%	0.636	S	S	*	*	H	α-helix	trans	-87	-35	175.1	-129.3	0	0	0	0	111.6	V15 S16 S17	V15-S19 PolarHBondContact O-N 2.76Å; S16-S19 PolarHBondContact O-N 2.78Å; S17-S19 VanDerWaalsContact C-N 3.27Å; S17-S19 PolarHBondContact O-N 2.92Å
20	E	53.4	Low	48.9	Very low	170 Å²	170	128.4 Å²	128.4	79%	0.794	65%	0.647	S	S	*	*	H	α-helix	trans	-76.4	-41	179.1	-145.4	124.8	89.5	0	0	111.6	S16 S17 R22	S16-E20 PolarHBondContact O-N 3.12Å; S17-E20 PolarHBondContact O-N 3.24Å; E20-R22 PolarHBondContact O-N 2.61Å
21	H	51.9	Low	48	Very low	115 Å²	115	124.9 Å²	124.9	53%	0.532	65%	0.646	S	S	.	*	T	Hydrogen-bonded Turn	trans	-86.5	102.3	167.6	-89	-100.8	0	0	0	106.7	S17 C18 F23	S17-H21 WeakPolarHBondContact O-CB 3.42Å; S17-H21 PolarHBondContact O-N 3.39Å; S17-H21 VanDerWaalsContact O-N 3.11Å; C18-H21 CarbonylContact C-O 3.56Å; H21-F23 HydrophobicContact CB-CD2 3.48Å; H21-F23 VanDerWaalsContact CB-CD2 3.48Å; H21-F23 HydrophobicContact CB-CE2 3.91Å; H21-F23 HydrophobicContact CB-CG 4.46Å; H21-F23 AromaticContact ND1-CD2 3.89Å; H21-F23 AromaticContact ND1-CE2 3.35Å; H21-F23 WeakPolarHBondContact ND1-CE2 3.35Å; H21-F23 PolarHBondContact O-N 2.73Å
22	R	46	Very low	47.2	Very low	244 Å²	244	128.4 Å²	128.4	92%	0.921	66%	0.664	S	S	*	*	T	Hydrogen-bonded Turn	trans	-56.9	56.1	172.9	-165.7	-178	-174.8	138.5	-1.4	112.8	E20	E20-R22 PolarHBondContact O-N 2.61Å
23	F	43	Very low	46.7	Very low	146 Å²	146	129 Å²	129	64%	0.64	68%	0.678	S	S	*	*			trans	-107.8	98.1	179.6	-77.3	-103.2	0	0	0	104.6	H21 C25	H21-F23 HydrophobicContact CB-CD2 3.48Å; H21-F23 VanDerWaalsContact CB-CD2 3.48Å; H21-F23 HydrophobicContact CB-CE2 3.91Å; H21-F23 HydrophobicContact CB-CG 4.46Å; H21-F23 AromaticContact ND1-CD2 3.89Å; H21-F23 AromaticContact ND1-CE2 3.35Å; H21-F23 WeakPolarHBondContact ND1-CE2 3.35Å; H21-F23 PolarHBondContact O-N 2.73Å; F23-C25 VanDerWaalsContact C-N 3.34Å; F23-C25 PolarHBondContact O-N 3.49Å
24	I	47.6	Very low	46.3	Very low	159 Å²	159	131.6 Å²	131.6	82%	0.815	69%	0.687	S	S	*	*			trans	-55.4	103.2	170.7	-63.3	175.2	0	0	0	106.5	R26	I24-R26 PolarHBondContact O-N 3.19Å
25	C	47.9	Very low	45.6	Very low	95 Å²	95	136.3 Å²	136.3	64%	0.642	71%	0.709	S	S	*	*			trans	-65.3	88.6	168	-73.9	0	0	0	0	106.9	C18 F23 R27	C18-C25 VanDerWaalsContact SG-SG 3.62Å; F23-C25 VanDerWaalsContact C-N 3.34Å; F23-C25 PolarHBondContact O-N 3.49Å; C25-R27 VanDerWaalsContact C-N 3.26Å; C25-R27 PolarHBondContact O-N 3.3Å
26	R	43.3	Very low	44.8	Very low	223 Å²	223	137.4 Å²	137.4	84%	0.842	72%	0.716	S	S	*	*			trans	-62.8	94.9	170.8	-174.4	-179.6	-80.4	-171.5	-3.9	106.1	I24 Q28	I24-R26 PolarHBondContact O-N 3.19Å; R26-Q28 PolarHBondContact O-N 3.32Å
27	R	46.4	Very low	44.4	Very low	192 Å²	192	139.3 Å²	139.3	73%	0.725	74%	0.736	S	S	*	*			trans	-56.4	104.3	168.9	-177.6	-175.7	-74.2	-165.6	0.5	106.2	C25 R29	C25-R27 VanDerWaalsContact C-N 3.26Å; C25-R27 PolarHBondContact O-N 3.3Å; R27-R29 HydrophobicContact CG-CG 3.98Å; R27-R29 PolarHBondContact O-N 2.82Å
28	Q	46.7	Very low	43.9	Very low	183 Å²	183	139.2 Å²	139.2	86%	0.855	75%	0.747	S	S	*	*			trans	-64	87.6	162.8	-74.5	-176	2.3	0	0	106.6	R26 G30	R26-Q28 PolarHBondContact O-N 3.32Å; Q28-G30 PolarHBondContact O-N 2.78Å; Q28-G30 VanDerWaalsContact O-N 3.09Å
29	R	41.5	Very low	43.7	Very low	205 Å²	205	141.3 Å²	141.3	77%	0.774	77%	0.767	S	S	*	*			trans	-76.4	85.1	153.7	-69.9	-168.6	-149.9	-179.3	4.7	104.9	R27 A31	R27-R29 HydrophobicContact CG-CG 3.98Å; R27-R29 PolarHBondContact O-N 2.82Å; R29-A31 PolarHBondContact O-N 3.41Å; R29-A31 VanDerWaalsContact O-N 3.09Å
30	G	35.4	Very low	43.5	Very low	67 Å²	67	141 Å²	141	69%	0.691	77%	0.77	S	S	*	*			trans	-55.9	113.7	162.1	0	0	0	0	0	107.1	Q28	Q28-G30 PolarHBondContact O-N 2.78Å; Q28-G30 VanDerWaalsContact O-N 3.09Å
31	A	36	Very low	43	Very low	79 Å²	79	139.3 Å²	139.3	65%	0.653	77%	0.772	S	S	*	*			trans	-65.2	130.4	161.8	0	0	0	0	0	106.4	R29 S33	R29-A31 PolarHBondContact O-N 3.41Å; R29-A31 VanDerWaalsContact O-N 3.09Å; A31-S33 PolarHBondContact O-N 2.65Å; A31-S33 PolarHBondContact O-OG 3.41Å
32	P	42	Very low	42.4	Very low	127 Å²	127	139.7 Å²	139.7	83%	0.825	79%	0.786	S	S	*	*			trans	-60.8	107.4	177	25	-31.5	0	0	0	107.4	Q34	P32-Q34 PolarHBondContact O-N 2.83Å
33	S	41.7	Very low	41.9	Very low	112 Å²	112	131.3 Å²	131.3	78%	0.783	78%	0.776	S	S	*	*			trans	-67	100.8	-173.5	-43.3	0	0	0	0	108.5	A31 L35	A31-S33 PolarHBondContact O-N 2.65Å; A31-S33 PolarHBondContact O-OG 3.41Å; S33-L35 PolarHBondContact O-N 2.81Å
34	Q	43	Very low	41.7	Very low	173 Å²	173	135.2 Å²	135.2	81%	0.808	79%	0.786	S	S	*	*			trans	-41	129.8	137.3	-69.6	-90.5	-0.9	0	0	107	P32 T36	P32-Q34 PolarHBondContact O-N 2.83Å; Q34-T36 PolarHBondContact O-N 3.45Å
35	L	40.1	Very low	41.8	Very low	177 Å²	177	134.7 Å²	134.7	93%	0.927	79%	0.79	S	S	*	*	S	Bend	trans	-48.3	101.9	-175.2	-63	160.6	0	0	0	111.4	S33	S33-L35 PolarHBondContact O-N 2.81Å
36	T	37.8	Very low	41.5	Very low	125 Å²	125	137.1 Å²	137.1	77%	0.767	80%	0.797	S	S	*	*			trans	-128.3	105.9	166.4	-55.4	0	0	0	0	108.5	Q34 G38	Q34-T36 PolarHBondContact O-N 3.45Å; T36-G38 PolarHBondContact O-N 3Å
37	A	43.4	Very low	41.1	Very low	109 Å²	109	129.8 Å²	129.8	90%	0.901	79%	0.79	S	S	*	*			trans	-52.6	113.6	171.1	0	0	0	0	0	110.2
38	G	38.4	Very low	40.6	Very low	71 Å²	71	129.4 Å²	129.4	73%	0.732	80%	0.802	S	S	*	*			trans	-133.1	104	177	0	0	0	0	0	109.3	T36 A40	T36-G38 PolarHBondContact O-N 3Å; G38-A40 PolarHBondContact O-N 3.35Å
39	A	41.6	Very low	40.3	Very low	93 Å²	93	123.7 Å²	123.7	77%	0.769	79%	0.791	S	S	*	*			trans	-45.1	127.9	-175.1	0	0	0	0	0	114.6	V41	A39-V41 PolarHBondContact O-N 3Å
40	A	46.7	Very low	40.5	Very low	95 Å²	95	123.3 Å²	123.3	79%	0.785	80%	0.799	S	S	*	*			trans	-75.1	98.1	164.9	0	0	0	0	0	109	G38 C42	G38-A40 PolarHBondContact O-N 3.35Å; A40-C42 PolarHBondContact O-N 3.21Å
41	V	42.1	Very low	41	Very low	135 Å²	135	128.8 Å²	128.8	82%	0.818	81%	0.806	S	S	*	*			trans	-74.5	100.9	171.7	173.2	0	0	0	0	108.6	A39	A39-V41 PolarHBondContact O-N 3Å
42	C	40.3	Very low	41.3	Very low	124 Å²	124	135.7 Å²	135.7	84%	0.838	82%	0.815	S	S	*	*			trans	-90.4	98.2	166.8	-73.1	0	0	0	0	109.1	A40	A40-C42 PolarHBondContact O-N 3.21Å
43	G	35.9	Very low	41.2	Very low	68 Å²	68	137.8 Å²	137.8	70%	0.701	82%	0.819	S	S	*	*			trans	-77.2	128.4	172.7	0	0	0	0	0	111.8
44	R	38.8	Very low	41.5	Very low	227 Å²	227	137.3 Å²	137.3	86%	0.857	82%	0.815	S	S	*	*			trans	-80.8	134.4	163.3	-89.4	176.4	-86.5	157.5	-5.7	108.6
45	V	48.3	Very low	42.1	Very low	149 Å²	149	133.4 Å²	133.4	90%	0.903	80%	0.803	S	S	*	*			trans	-109.6	100.4	172.2	-121.6	0	0	0	0	106.9
46	D	41.5	Very low	42.6	Very low	146 Å²	146	129.2 Å²	129.2	78%	0.781	79%	0.787	S	S	*	*			trans	-80.5	133	172	-68.4	-54.8	0	0	0	109.6
47	G	35.2	Very low	43.5	Very low	68 Å²	68	130.1 Å²	130.1	70%	0.701	78%	0.782	S	S	*	*	S	Bend	trans	94.6	115.2	148.2	0	0	0	0	0	118.3
48	L	37	Very low	44.3	Very low	185 Å²	185	130.5 Å²	130.5	97%	0.969	77%	0.767	S	S	*	*			trans	79.3	77.2	145.5	-47	-177.6	0	0	0	117.3
49	G	39.6	Very low	45.1	Very low	62 Å²	62	128.5 Å²	128.5	64%	0.639	74%	0.744	S	S	*	*			trans	166.3	70.2	161.9	0	0	0	0	0	112.2	Q51	G49-Q51 PolarHBondContact O-N 3.36Å
50	Q	45.2	Very low	45.8	Very low	198 Å²	198	126.4 Å²	126.4	93%	0.925	73%	0.727	S	S	*	*			trans	-67.6	33.8	170	-64	-159.6	55.5	0	0	113.3	R52	Q50-R52 PolarHBondContact O-N 3.32Å
51	Q	45.5	Very low	46.4	Very low	182 Å²	182	126.6 Å²	126.6	85%	0.85	71%	0.711	S	S	*	*			trans	-76	63	153	-59.9	-167.5	82.5	0	0	106.6	G49 L53	G49-Q51 PolarHBondContact O-N 3.36Å; Q51-L53 VanDerWaalsContact C-N 3.29Å; Q51-L53 PolarHBondContact O-N 2.86Å
52	R	42.7	Very low	47	Very low	223 Å²	223	125.3 Å²	125.3	84%	0.842	70%	0.699	S	S	*	*			trans	-46.6	102	173.5	176.3	179.6	-171.1	-105.7	3.6	105.4	Q50 S54	Q50-R52 PolarHBondContact O-N 3.32Å; R52-S54 WeakPolarHBondContact O-CA 3.35Å; R52-S54 PolarHBondContact O-N 2.96Å
53	L	41.1	Very low	47.8	Very low	172 Å²	172	122.8 Å²	122.8	90%	0.901	68%	0.682	S	S	*	*			trans	-25.1	80.7	172.7	-66.3	157.9	0	0	0	108.8	Q51 V55	Q51-L53 VanDerWaalsContact C-N 3.29Å; Q51-L53 PolarHBondContact O-N 2.86Å; L53-V55 PolarHBondContact O-N 3.39Å; L53-V55 VanDerWaalsContact O-N 3.16Å
54	S	47.2	Very low	48.7	Very low	101 Å²	101	125.6 Å²	125.6	71%	0.706	68%	0.677	S	S	*	*			trans	-73.8	119.8	-176.9	54.5	0	0	0	0	101.4	R52 P56	R52-S54 WeakPolarHBondContact O-CA 3.35Å; R52-S54 PolarHBondContact O-N 2.96Å; S54-P56 VanDerWaalsContact O-N 3.13Å
55	V	54.8	Low	49.4	Very low	91 Å²	91	123.5 Å²	123.5	55%	0.552	67%	0.669	S	S	*	*	S	Bend	trans	-20.3	119.8	170.1	167.2	0	0	0	0	108.5	L53 H57 A59	L53-V55 PolarHBondContact O-N 3.39Å; L53-V55 VanDerWaalsContact O-N 3.16Å; V55-H57 PolarHBondContact O-N 3.44Å; V55-A59 HydrophobicContact CG1-CB 3.34Å
56	P	52.4	Low	49.8	Very low	90 Å²	90	126.1 Å²	126.1	58%	0.584	66%	0.663	S	S	*	*			trans	-45.7	135.6	-162.6	15.8	-29.7	0	0	0	107.9	S54 I58 A59 A60	S54-P56 VanDerWaalsContact O-N 3.13Å; P56-I58 CarbonylContact O-C 3.54Å; P56-I58 PolarHBondContact O-N 3.34Å; P56-A59 HydrophobicContact CG-CB 3.81Å; P56-A59 WeakPolarHBondContact O-CA 3.27Å; P56-A59 WeakPolarHBondContact O-CB 3.41Å; P56-A59 PolarHBondContact O-N 2.79Å; P56-A60 PolarHBondContact O-N 3.19Å
57	H	56.9	Low	50.5	Low	143 Å²	143	124.1 Å²	124.1	66%	0.662	65%	0.652	S	S	*	*	H	α-helix	trans	-45.4	-28.2	-176.4	-179.8	62.5	0	0	0	112.7	V55 Q61	V55-H57 PolarHBondContact O-N 3.44Å; H57-Q61 PolarHBondContact CD2-NE2 2.64Å; H57-Q61 PolarHBondContact NE2-NE2 3.03Å; H57-Q61 WeakPolarHBondContact O-CB 3.43Å; H57-Q61 WeakPolarHBondContact O-CG 3.38Å; H57-Q61 PolarHBondContact O-N 3.5Å; H57-Q61 PolarHBondContact O-NE2 2.91Å
58	I	59.1	Low	51.7	Low	117 Å²	117	123.9 Å²	123.9	60%	0.6	64%	0.635	S	S	*	*	H	α-helix	trans	-63.7	-49.3	169.2	-62	168.4	0	0	0	113.6	P56 A60 Q61 L62	P56-I58 CarbonylContact O-C 3.54Å; P56-I58 PolarHBondContact O-N 3.34Å; I58-A60 VanDerWaalsContact C-N 3.32Å; I58-A60 PolarHBondContact O-N 2.86Å; I58-Q61 CarbonylContact O-C 3.42Å; I58-Q61 WeakPolarHBondContact O-CB 3.35Å; I58-Q61 PolarHBondContact O-N 3.07Å; I58-L62 HydrophobicContact CG2-CD1 4.17Å; I58-L62 HydrophobicContact CG2-CG 4.45Å; I58-L62 WeakPolarHBondContact O-CB 3.2Å; I58-L62 VanDerWaalsContact O-CG 3.31Å; I58-L62 WeakPolarHBondContact O-CG 3.23Å; I58-L62 PolarHBondContact O-N 2.77Å
59	A	54.4	Low	52.3	Low	30 Å²	30	124.4 Å²	124.4	25%	0.248	62%	0.624	C	S	.	*	H	α-helix	trans	-65.1	-35.7	174.9	0	0	0	0	0	111.9	V55 P56 L62 C63	V55-A59 HydrophobicContact CG1-CB 3.34Å; P56-A59 HydrophobicContact CG-CB 3.81Å; P56-A59 WeakPolarHBondContact O-CA 3.27Å; P56-A59 WeakPolarHBondContact O-CB 3.41Å; P56-A59 PolarHBondContact O-N 2.79Å; A59-L62 PolarHBondContact O-N 3.07Å; A59-C63 WeakPolarHBondContact O-CB 3.44Å; A59-C63 PolarHBondContact O-N 3.41Å; A59-C63 PolarHBondContact O-SG 2.76Å
60	A	58.2	Low	53	Low	48 Å²	48	125 Å²	125	40%	0.397	62%	0.617	S	S	.	*	H	α-helix	trans	-63.3	-41.9	169.8	0	0	0	0	0	111.8	P56 I58 C63 H64	P56-A60 PolarHBondContact O-N 3.19Å; I58-A60 VanDerWaalsContact C-N 3.32Å; I58-A60 PolarHBondContact O-N 2.86Å; A60-C63 PolarHBondContact O-N 3.13Å; A60-H64 WeakPolarHBondContact O-CB 3.31Å; A60-H64 PolarHBondContact O-N 2.91Å
61	Q	57.3	Low	53.6	Low	100 Å²	100	119.4 Å²	119.4	47%	0.467	60%	0.597	S	S	.	*	H	α-helix	trans	-62.3	-40.9	173.2	-78.4	169.9	88.9	0	0	112.2	H57 I58 H64 W65	H57-Q61 PolarHBondContact CD2-NE2 2.64Å; H57-Q61 PolarHBondContact NE2-NE2 3.03Å; H57-Q61 WeakPolarHBondContact O-CB 3.43Å; H57-Q61 WeakPolarHBondContact O-CG 3.38Å; H57-Q61 PolarHBondContact O-N 3.5Å; H57-Q61 PolarHBondContact O-NE2 2.91Å; I58-Q61 CarbonylContact O-C 3.42Å; I58-Q61 WeakPolarHBondContact O-CB 3.35Å; I58-Q61 PolarHBondContact O-N 3.07Å; Q61-H64 PolarHBondContact O-N 3.19Å; Q61-W65 WeakPolarHBondContact O-CB 3.35Å; Q61-W65 PolarHBondContact O-N 3.07Å
62	L	55.2	Low	54.1	Low	108 Å²	108	118 Å²	118	57%	0.565	58%	0.584	S	S	*	*	H	α-helix	trans	-68.2	-39.3	177.7	-72.5	172.5	0	0	0	112.3	I58 A59 W65 R66	I58-L62 HydrophobicContact CG2-CD1 4.17Å; I58-L62 HydrophobicContact CG2-CG 4.45Å; I58-L62 WeakPolarHBondContact O-CB 3.2Å; I58-L62 VanDerWaalsContact O-CG 3.31Å; I58-L62 WeakPolarHBondContact O-CG 3.23Å; I58-L62 PolarHBondContact O-N 2.77Å; A59-L62 PolarHBondContact O-N 3.07Å; L62-W65 PolarHBondContact O-N 3.35Å; L62-R66 PolarHBondContact O-N 3.48Å
63	C	58.4	Low	54.6	Low	71 Å²	71	113 Å²	113	48%	0.48	57%	0.574	S	S	.	*	H	α-helix	trans	-63.1	-45.6	172.7	-68	0	0	0	0	110.7	A59 A60 W65 R66 D67	A59-C63 WeakPolarHBondContact O-CB 3.44Å; A59-C63 PolarHBondContact O-N 3.41Å; A59-C63 PolarHBondContact O-SG 2.76Å; A60-C63 PolarHBondContact O-N 3.13Å; C63-W65 VanDerWaalsContact C-N 3.3Å; C63-W65 PolarHBondContact O-N 3.42Å; C63-R66 PolarHBondContact O-N 3.37Å; C63-D67 PolarHBondContact O-N 3.39Å
64	H	53.2	Low	55.4	Low	126 Å²	126	114.9 Å²	114.9	58%	0.583	57%	0.569	S	S	*	*	H	α-helix	trans	-61.1	-37.4	174.3	-176.5	68.8	0	0	0	112.4	A60 Q61 D67 N68	A60-H64 WeakPolarHBondContact O-CB 3.31Å; A60-H64 PolarHBondContact O-N 2.91Å; Q61-H64 PolarHBondContact O-N 3.19Å; H64-D67 PolarHBondContact O-N 3.33Å; H64-N68 VanDerWaalsContact O-CB 3.23Å; H64-N68 WeakPolarHBondContact O-CB 3.35Å; H64-N68 PolarHBondContact O-N 2.79Å
65	W	54.3	Low	55.6	Low	183 Å²	183	117 Å²	117	69%	0.693	57%	0.572	S	S	*	*	H	α-helix	trans	-65.6	-39.5	177	-137	77.1	0	0	0	112.2	Q61 L62 C63 W69	Q61-W65 WeakPolarHBondContact O-CB 3.35Å; Q61-W65 PolarHBondContact O-N 3.07Å; L62-W65 PolarHBondContact O-N 3.35Å; C63-W65 VanDerWaalsContact C-N 3.3Å; C63-W65 PolarHBondContact O-N 3.42Å; W65-W69 PolarHBondContact O-N 2.91Å; W65-W69 VanDerWaalsContact O-N 3.15Å
66	R	56.9	Low	55.7	Low	205 Å²	205	120.4 Å²	120.4	77%	0.774	58%	0.575	S	S	*	*	H	α-helix	trans	-64.5	-41.8	174	-85.7	178	147.5	170.5	-5.9	112.1	L62 C63	L62-R66 PolarHBondContact O-N 3.48Å; C63-R66 PolarHBondContact O-N 3.37Å
67	D	56.6	Low	55.7	Low	103 Å²	103	122.1 Å²	122.1	55%	0.551	58%	0.584	S	S	*	*	H	α-helix	trans	-73.1	-37.8	178.8	-65.3	-27.2	0	0	0	111.6	C63 H64 W69 C70 T71	C63-D67 PolarHBondContact O-N 3.39Å; H64-D67 PolarHBondContact O-N 3.33Å; D67-W69 PolarHBondContact O-N 2.94Å; D67-C70 PolarHBondContact O-N 3.36Å; D67-T71 WeakPolarHBondContact O-CB 3.44Å; D67-T71 WeakPolarHBondContact O-CG2 3.37Å; D67-T71 PolarHBondContact O-N 3.01Å; D67-T71 PolarHBondContact O-OG1 3.3Å
68	N	59.5	Low	55.2	Low	64 Å²	64	122.6 Å²	122.6	34%	0.342	60%	0.597	S	S	.	*	H	α-helix	trans	-59.4	-44.2	175.8	177.5	-73.4	0	0	0	112	H64 C70 T71 R72	H64-N68 VanDerWaalsContact O-CB 3.23Å; H64-N68 WeakPolarHBondContact O-CB 3.35Å; H64-N68 PolarHBondContact O-N 2.79Å; N68-C70 VanDerWaalsContact C-N 3.26Å; N68-C70 PolarHBondContact O-N 3.27Å; N68-T71 WeakPolarHBondContact CA-OG1 3.46Å; N68-T71 PolarHBondContact O-N 3.49Å; N68-T71 PolarHBondContact O-OG1 2.99Å; N68-R72 WeakPolarHBondContact O-CB 3.18Å; N68-R72 PolarHBondContact O-N 3.43Å
69	W	50.2	Low	54.9	Low	196 Å²	196	121.2 Å²	121.2	74%	0.742	60%	0.598	S	S	*	*	H	α-helix	trans	-58.8	-40	-179.4	174.5	-82.5	0	0	0	111.8	W65 D67	W65-W69 PolarHBondContact O-N 2.91Å; W65-W69 VanDerWaalsContact O-N 3.15Å; D67-W69 PolarHBondContact O-N 2.94Å
70	C	54.5	Low	54.8	Low	74 Å²	74	130.6 Å²	130.6	50%	0.5	63%	0.627	S	S	.	*	H	α-helix	trans	-88	-30.8	-178.1	-152	0	0	0	0	113	D67 N68	D67-C70 PolarHBondContact O-N 3.36Å; N68-C70 VanDerWaalsContact C-N 3.26Å; N68-C70 PolarHBondContact O-N 3.27Å
71	T	57.1	Low	54.3	Low	80 Å²	80	140.4 Å²	140.4	49%	0.491	65%	0.653	S	S	.	*	H	α-helix	trans	-75.9	-39.6	177.6	49.8	0	0	0	0	112.1	D67 N68 D73 R74	D67-T71 WeakPolarHBondContact O-CB 3.44Å; D67-T71 WeakPolarHBondContact O-CG2 3.37Å; D67-T71 PolarHBondContact O-N 3.01Å; D67-T71 PolarHBondContact O-OG1 3.3Å; N68-T71 WeakPolarHBondContact CA-OG1 3.46Å; N68-T71 PolarHBondContact O-N 3.49Å; N68-T71 PolarHBondContact O-OG1 2.99Å; T71-D73 PolarHBondContact O-N 3.28Å; T71-R74 PolarHBondContact O-N 3.22Å
72	R	57	Low	54.4	Low	153 Å²	153	141 Å²	141	58%	0.577	67%	0.669	S	S	*	*	H	α-helix	trans	-67.5	-23.6	178.2	-168.8	169.1	-173.2	175.3	2.5	113.1	N68	N68-R72 WeakPolarHBondContact O-CB 3.18Å; N68-R72 PolarHBondContact O-N 3.43Å
73	D	53.5	Low	54.6	Low	118 Å²	118	144.5 Å²	144.5	63%	0.631	68%	0.682	S	S	*	*	H	α-helix	trans	-79.9	-24.4	177	-150.9	64.3	0	0	0	112.5	T71 R76	T71-D73 PolarHBondContact O-N 3.28Å; D73-R76 PolarHBondContact O-N 3.49Å
74	R	56.3	Low	54.6	Low	211 Å²	211	145.9 Å²	145.9	80%	0.796	69%	0.69	S	S	*	*	H	α-helix	trans	-72.8	-27.7	177.8	-76.5	-177	177.1	172.8	0.2	113.9	T71	T71-R74 PolarHBondContact O-N 3.22Å
75	D	52.7	Low	54.4	Low	147 Å²	147	146.1 Å²	146.1	79%	0.786	71%	0.706	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.8	3	177.4	-73.2	-33.2	0	0	0	113.6	T77	D75-T77 PolarHBondContact O-N 2.88Å
76	R	55.6	Low	54.2	Low	162 Å²	162	142 Å²	142	61%	0.611	71%	0.705	S	S	*	*	S	Bend	trans	-94.4	95.2	179.7	-80.8	-174.6	170.8	-167.3	-2.2	111.3	D73 V78	D73-R76 PolarHBondContact O-N 3.49Å; R76-V78 PolarHBondContact O-N 3.5Å; R76-V78 VanDerWaalsContact O-N 3.12Å
77	T	52.4	Low	54.1	Low	126 Å²	126	143.6 Å²	143.6	77%	0.773	71%	0.711	S	S	*	*			trans	-21.9	112.5	152.4	-56.7	0	0	0	0	111.3	D75 S79	D75-T77 PolarHBondContact O-N 2.88Å; T77-S79 VanDerWaalsContact C-N 3.29Å; T77-S79 PolarHBondContact O-N 3.12Å
78	V	45.9	Very low	54	Low	153 Å²	153	145 Å²	145	93%	0.927	72%	0.724	S	S	*	*	S	Bend	trans	-57.6	85.8	176.9	-113.4	0	0	0	0	109.9	R76	R76-V78 PolarHBondContact O-N 3.5Å; R76-V78 VanDerWaalsContact O-N 3.12Å
79	S	54	Low	53.9	Low	88 Å²	88	146.2 Å²	146.2	62%	0.615	74%	0.743	S	S	*	*			trans	-156.4	124.1	170.8	-162.6	0	0	0	0	109.9	T77	T77-S79 VanDerWaalsContact C-N 3.29Å; T77-S79 PolarHBondContact O-N 3.12Å
80	R	52.2	Low	54.4	Low	227 Å²	227	145.5 Å²	145.5	86%	0.857	75%	0.753	S	S	*	*			trans	89.3	64.1	174.1	-48.2	169.3	-172.9	-133.8	0.5	114.1	S82	R80-S82 PolarHBondContact O-N 3.34Å; R80-S82 VanDerWaalsContact O-N 3.09Å
81	R	47.8	Very low	54.5	Low	253 Å²	253	150.4 Å²	150.4	96%	0.955	77%	0.772	S	S	*	*			trans	-46.9	111.9	151.7	-162	178.6	-166.4	176.3	2.8	107.9	E83	R81-E83 PolarHBondContact O-N 3.43Å
82	S	59.3	Low	54.6	Low	113 Å²	113	150 Å²	150	79%	0.79	78%	0.783	S	S	*	*	P	Polyproline II helix	trans	-66.5	118.9	176.5	-58.2	0	0	0	0	108.9	R80	R80-S82 PolarHBondContact O-N 3.34Å; R80-S82 VanDerWaalsContact O-N 3.09Å
83	E	59.3	Low	54.9	Low	181 Å²	181	151.7 Å²	151.7	85%	0.846	80%	0.798	S	S	*	*	P	Polyproline II helix	trans	-61.1	123.1	174.8	-150.1	164.4	124.8	0	0	108.5	R81 S85	R81-E83 PolarHBondContact O-N 3.43Å; E83-S85 PolarHBondContact O-N 3.29Å
84	P	57.3	Low	55.7	Low	100 Å²	100	154.8 Å²	154.8	65%	0.649	81%	0.808	S	S	*	*	P	Polyproline II helix	trans	-69	122.2	-177.6	28.2	-30.9	0	0	0	107.6	S86	P84-S86 PolarHBondContact O-N 2.83Å; P84-S86 PolarHBondContact O-OG 2.6Å
85	S	49.4	Very low	56.3	Low	131 Å²	131	148.2 Å²	148.2	92%	0.916	79%	0.793	S	S	*	*			trans	-44.1	103.5	175.8	-174.3	0	0	0	0	110.3	E83	E83-S85 PolarHBondContact O-N 3.29Å
86	S	50.4	Low	57.2	Low	97 Å²	97	145.3 Å²	145.3	68%	0.678	78%	0.778	S	S	*	*			trans	-111.7	102.8	-173.4	-65.8	0	0	0	0	108.4	P84	P84-S86 PolarHBondContact O-N 2.83Å; P84-S86 PolarHBondContact O-OG 2.6Å
87	R	54.3	Low	57.6	Low	239 Å²	239	141.6 Å²	141.6	90%	0.902	78%	0.775	S	S	*	*			trans	178	92.4	150.1	-104.8	167.2	154.8	145.4	-4.3	109.2
88	T	54.3	Low	58.5	Low	132 Å²	132	144.3 Å²	144.3	81%	0.81	77%	0.771	S	S	*	*				76.8	100.7	90.7	-55.7	0	0	0	0	113.7
89	A	57.4	Low	59.6	Low	90 Å²	90	143.5 Å²	143.5	74%	0.744	76%	0.761	S	S	*	*			trans	-175.5	90.1	139.2	0	0	0	0	0	108.4
90	L	62.1	Low	60.2	Low	181 Å²	181	148.3 Å²	148.3	95%	0.948	77%	0.766	S	S	*	*			trans	-174.2	32.2	156.5	-99.8	166.2	0	0	0	111.4
91	I	57.2	Low	60.9	Low	176 Å²	176	141.6 Å²	141.6	90%	0.903	75%	0.746	S	S	*	*			trans	-107.7	111.7	168.8	-50.3	172.7	0	0	0	105.4
92	G	57.9	Low	61.9	Low	71 Å²	71	135.5 Å²	135.5	73%	0.732	73%	0.728	S	S	*	*	S	Bend	trans	-169.6	-44.4	174.8	0	0	0	0	0	116
93	E	64.3	Low	62.2	Low	189 Å²	189	134.1 Å²	134.1	88%	0.883	72%	0.716	S	S	*	*			trans	-140.3	43.3	-173.3	-62.2	-149.1	156.9	0	0	113.7	P95	E93-P95 VanDerWaalsContact C-CD 3.46Å; E93-P95 WeakPolarHBondContact O-CD 2.96Å
94	Q	70.1	Confident	62.4	Low	183 Å²	183	131.1 Å²	131.1	86%	0.855	70%	0.703	S	S	*	*			trans	-95.7	92.2	166	-150.7	-175.1	79.2	0	0	108.6	N96	Q94-N96 PolarHBondContact O-N 2.87Å
95	P	68.5	Low	62.6	Low	73 Å²	73	132 Å²	132	47%	0.474	70%	0.702	S	S	.	*			trans	-59.8	141.3	172.2	25.1	-33.2	0	0	0	109.1	E93	E93-P95 VanDerWaalsContact C-CD 3.46Å; E93-P95 WeakPolarHBondContact O-CD 2.96Å
96	N	71.8	Confident	63.2	Low	87 Å²	87	129.2 Å²	129.2	47%	0.465	69%	0.687	S	S	.	*			trans	-56.2	127	-173.5	-160.6	-6.8	0	0	0	110	Q94 W98 D99	Q94-N96 PolarHBondContact O-N 2.87Å; N96-W98 PolarHBondContact O-N 3.31Å; N96-D99 PolarHBondContact O-N 2.93Å
97	P	64.6	Low	63.6	Low	84 Å²	84	131.6 Å²	131.6	55%	0.545	69%	0.689	S	S	.	*	G	3₁₀ helix	trans	-60.3	-20.4	-177.6	21.8	-34.9	0	0	0	113.8	D99 R100	P97-D99 VanDerWaalsContact C-N 3.25Å; P97-D99 PolarHBondContact O-N 2.96Å; P97-R100 PolarHBondContact O-N 3.15Å
98	W	70.2	Confident	64.1	Low	183 Å²	183	124.4 Å²	124.4	69%	0.693	68%	0.675	S	S	*	*	G	3₁₀ helix	trans	-61.8	-29.2	178.1	-58.7	117.6	0	0	0	113.4	N96 R100 I101	N96-W98 PolarHBondContact O-N 3.31Å; W98-R100 PolarHBondContact O-N 3.02Å; W98-I101 HydrophobicContact CD2-CD1 4.46Å; W98-I101 HydrophobicContact CE3-CD1 3.32Å; W98-I101 HydrophobicContact CE3-CG1 4.44Å; W98-I101 HydrophobicContact CZ3-CD1 3.57Å; W98-I101 PolarHBondContact O-N 3.29Å
99	D	69	Low	64.5	Low	135 Å²	135	128.8 Å²	128.8	72%	0.722	68%	0.677	S	S	*	*	G	3₁₀ helix	trans	-70.5	-12.2	-179.7	-66	-29.7	0	0	0	113.2	N96 P97	N96-D99 PolarHBondContact O-N 2.93Å; P97-D99 VanDerWaalsContact C-N 3.25Å; P97-D99 PolarHBondContact O-N 2.96Å
100	R	67.9	Low	64.8	Low	190 Å²	190	133 Å²	133	72%	0.717	68%	0.681	S	S	*	*	G	3₁₀ helix	trans	-106.2	1.2	-177.2	-60.7	-177.9	-175.9	-178.3	0.6	113.7	P97 W98 Q102	P97-R100 PolarHBondContact O-N 3.15Å; W98-R100 PolarHBondContact O-N 3.02Å; R100-Q102 PolarHBondContact O-N 3.47Å
101	I	66.6	Low	64.9	Low	86 Å²	86	135.9 Å²	135.9	44%	0.441	68%	0.679	S	S	.	*			trans	-71.5	108.3	178.2	-59.5	-170.4	0	0	0	108.2	W98	W98-I101 HydrophobicContact CD2-CD1 4.46Å; W98-I101 HydrophobicContact CE3-CD1 3.32Å; W98-I101 HydrophobicContact CE3-CG1 4.44Å; W98-I101 HydrophobicContact CZ3-CD1 3.57Å; W98-I101 PolarHBondContact O-N 3.29Å
102	Q	68.1	Low	65.4	Low	125 Å²	125	130.6 Å²	130.6	58%	0.584	67%	0.668	S	S	*	*			trans	-62.2	132.6	174.5	-72.7	-171.8	81.2	0	0	109.2	R100 Q104 D105	R100-Q102 PolarHBondContact O-N 3.47Å; Q102-Q104 PolarHBondContact O-N 3.35Å; Q102-D105 PolarHBondContact O-N 3.5Å
103	P	65.1	Low	66	Low	83 Å²	83	132 Å²	132	54%	0.539	67%	0.673	S	S	.	*	H	α-helix	trans	-52.7	-24.9	177.2	-27.9	34.7	0	0	0	113.9	D105 A106 M107	P103-D105 VanDerWaalsContact C-N 3.33Å; P103-D105 PolarHBondContact O-N 2.91Å; P103-A106 PolarHBondContact O-N 3.42Å; P103-M107 PolarHBondContact O-N 2.76Å; P103-M107 VanDerWaalsContact O-N 3.13Å
104	Q	64.3	Low	66.3	Low	119 Å²	119	131.4 Å²	131.4	56%	0.556	67%	0.667	S	S	*	*	H	α-helix	trans	-62.6	-36.8	176.1	-69.6	72.3	26.2	0	0	112.6	Q102 M107 S108	Q102-Q104 PolarHBondContact O-N 3.35Å; Q104-M107 PolarHBondContact O-N 2.79Å; Q104-S108 PolarHBondContact O-N 3.04Å; Q104-S108 VanDerWaalsContact O-N 3.07Å
105	D	60.4	Low	66.1	Low	118 Å²	118	127.7 Å²	127.7	63%	0.631	66%	0.659	S	S	*	*	H	α-helix	trans	-72.2	-34.5	176.8	-78.1	-20.9	0	0	0	111.5	Q102 P103 M107 S108	Q102-D105 PolarHBondContact O-N 3.5Å; P103-D105 VanDerWaalsContact C-N 3.33Å; P103-D105 PolarHBondContact O-N 2.91Å; D105-M107 VanDerWaalsContact C-N 3.29Å; D105-M107 PolarHBondContact O-N 3.19Å; D105-S108 PolarHBondContact O-N 3.01Å
106	A	62.6	Low	65.9	Low	72 Å²	72	130.1 Å²	130.1	60%	0.595	67%	0.674	S	S	*	*	H	α-helix	trans	-65.5	-33.8	175.3	0	0	0	0	0	112.3	P103	P103-A106 PolarHBondContact O-N 3.42Å
107	M	58.5	Low	65.6	Low	147 Å²	147	135.8 Å²	135.8	72%	0.724	69%	0.689	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94.7	3.3	179.3	-64.9	-165.7	-65.9	0	0	114.3	P103 Q104 D105 R109	P103-M107 PolarHBondContact O-N 2.76Å; P103-M107 VanDerWaalsContact O-N 3.13Å; Q104-M107 PolarHBondContact O-N 2.79Å; D105-M107 VanDerWaalsContact C-N 3.29Å; D105-M107 PolarHBondContact O-N 3.19Å; M107-R109 PolarHBondContact O-N 3.11Å
108	S	65	Low	65.8	Low	88 Å²	88	143.8 Å²	143.8	62%	0.615	71%	0.709	S	S	*	*			trans	-74.2	63.4	176	-164.7	0	0	0	0	111.5	Q104 D105 H110	Q104-S108 PolarHBondContact O-N 3.04Å; Q104-S108 VanDerWaalsContact O-N 3.07Å; D105-S108 PolarHBondContact O-N 3.01Å; S108-H110 PolarHBondContact O-N 3.39Å
109	R	62.7	Low	65.3	Low	225 Å²	225	140.8 Å²	140.8	85%	0.849	71%	0.714	S	S	*	*			trans	-94.1	45.2	164.3	-64.9	-175.8	178.5	178.6	0.4	109.6	M107 R111	M107-R109 PolarHBondContact O-N 3.11Å; R109-R111 PolarHBondContact O-N 3.49Å
110	H	64.3	Low	64.9	Low	177 Å²	177	137.3 Å²	137.3	82%	0.819	71%	0.71	S	S	*	*			trans	-95.4	85.4	170	-114.8	53.7	0	0	0	108.4	S108 G112	S108-H110 PolarHBondContact O-N 3.39Å; H110-G112 VanDerWaalsContact C-N 3.35Å; H110-G112 PolarHBondContact O-N 3.38Å
111	R	64.5	Low	64.5	Low	243 Å²	243	136.6 Å²	136.6	92%	0.917	72%	0.72	S	S	*	*			trans	-56.7	105.5	162.7	-67.2	-90.9	-171.7	167.7	1.5	105.4	R109	R109-R111 PolarHBondContact O-N 3.49Å
112	G	67.6	Low	64.2	Low	64 Å²	64	140.7 Å²	140.7	66%	0.66	74%	0.742	S	S	*	*	P	Polyproline II helix	trans	-47.8	145.8	-173.2	0	0	0	0	0	112.6	H110 K114	H110-G112 VanDerWaalsContact C-N 3.35Å; H110-G112 PolarHBondContact O-N 3.38Å; G112-K114 PolarHBondContact O-N 3.32Å; G112-K114 VanDerWaalsContact O-N 3.12Å
113	A	69.4	Low	63.8	Low	102 Å²	102	137.4 Å²	137.4	84%	0.843	74%	0.741	S	S	*	*	P	Polyproline II helix	trans	-49.9	120.1	178.7	0	0	0	0	0	109.9
114	K	71.8	Confident	63.6	Low	176 Å²	176	142.8 Å²	142.8	77%	0.765	76%	0.759	S	S	*	*	P	Polyproline II helix	trans	-69.5	124.4	-177.9	-142.9	155.6	179.4	174.7	0	107.3	G112	G112-K114 PolarHBondContact O-N 3.32Å; G112-K114 VanDerWaalsContact O-N 3.12Å
115	P	66.1	Low	63.4	Low	104 Å²	104	143.7 Å²	143.7	68%	0.675	77%	0.766	S	S	*	*	P	Polyproline II helix	trans	-58.9	139.3	-175.8	20.8	-30.5	0	0	0	109.9	R117	P115-R117 PolarHBondContact O-N 3.19Å
116	P	64.2	Low	63.7	Low	124 Å²	124	143.6 Å²	143.6	81%	0.805	78%	0.775	S	S	*	*			trans	-60.7	113.1	-176.3	23.6	-31.1	0	0	0	108	R118	P116-R118 PolarHBondContact O-N 3.18Å
117	R	65.5	Low	63.8	Low	207 Å²	207	147.1 Å²	147.1	78%	0.781	78%	0.783	S	S	*	*			trans	-62.3	129.3	173.5	-68.2	-165.1	178.4	164	-2.3	106.7	P115 C119	P115-R117 PolarHBondContact O-N 3.19Å; R117-C119 PolarHBondContact O-N 3.05Å
118	R	67.5	Low	64.2	Low	252 Å²	252	147.6 Å²	147.6	95%	0.951	79%	0.788	S	S	*	*			trans	-56.3	88.9	171.4	-73.7	175.4	149.4	-166	-7.3	108.7	P116 G120	P116-R118 PolarHBondContact O-N 3.18Å; R118-G120 PolarHBondContact O-N 3.38Å
119	C	61.1	Low	63.8	Low	120 Å²	120	148.9 Å²	148.9	81%	0.811	80%	0.797	S	S	*	*			trans	-73.2	87.8	163.9	-67.1	0	0	0	0	106	R117 L121	R117-C119 PolarHBondContact O-N 3.05Å; C119-L121 PolarHBondContact O-N 3.23Å; C119-L121 VanDerWaalsContact O-N 3.14Å
120	G	58.8	Low	63.9	Low	62 Å²	62	144.5 Å²	144.5	64%	0.639	80%	0.798	S	S	*	*			trans	-61.6	113.7	164.3	0	0	0	0	0	107.1	R118 L122	R118-G120 PolarHBondContact O-N 3.38Å; G120-L122 PolarHBondContact O-N 3.05Å
121	L	60.3	Low	63.7	Low	175 Å²	175	143.1 Å²	143.1	92%	0.916	83%	0.831	S	S	*	*			trans	-18.3	92.6	167.4	-78.2	146.9	0	0	0	112	C119 G123	C119-L121 PolarHBondContact O-N 3.23Å; C119-L121 VanDerWaalsContact O-N 3.14Å; L121-G123 PolarHBondContact O-N 3.27Å; L121-G123 VanDerWaalsContact O-N 3.08Å
122	L	60.1	Low	63.6	Low	172 Å²	172	138.1 Å²	138.1	90%	0.901	83%	0.827	S	S	*	*			trans	-63.6	111.7	158.6	-75.2	170.4	0	0	0	104.2	G120	G120-L122 PolarHBondContact O-N 3.05Å
123	G	60.7	Low	63.4	Low	56 Å²	56	142 Å²	142	58%	0.577	84%	0.835	S	S	*	*			trans	-48.6	147.7	-176.5	0	0	0	0	0	111.3	L121 I125	L121-G123 PolarHBondContact O-N 3.27Å; L121-G123 VanDerWaalsContact O-N 3.08Å; G123-I125 PolarHBondContact O-N 3.09Å
124	E	60	Low	63.1	Low	195 Å²	195	144.2 Å²	144.2	91%	0.911	84%	0.835	S	S	*	*			trans	-42	102.4	178.2	-65.5	177.2	160.3	0	0	110.7	S126	E124-S126 PolarHBondContact O-N 3.5Å; E124-S126 VanDerWaalsContact O-N 3.13Å
125	I	61.4	Low	62.6	Low	138 Å²	138	142.4 Å²	142.4	71%	0.708	84%	0.839	S	S	*	*			trans	-73.4	105.7	168.2	49.7	166.8	0	0	0	106	G123 L127	G123-I125 PolarHBondContact O-N 3.09Å; I125-L127 HydrophobicContact CD1-CD2 4.25Å; I125-L127 PolarHBondContact O-N 2.74Å
126	S	64.8	Low	62.3	Low	116 Å²	116	144.8 Å²	144.8	81%	0.811	85%	0.849	S	S	*	*			trans	-57	106.4	174	-81.8	0	0	0	0	109.2	E124 L128	E124-S126 PolarHBondContact O-N 3.5Å; E124-S126 VanDerWaalsContact O-N 3.13Å; S126-L128 VanDerWaalsContact C-N 3.25Å; S126-L128 PolarHBondContact O-N 3.2Å
127	L	66.5	Low	62.2	Low	147 Å²	147	146.1 Å²	146.1	77%	0.77	85%	0.852	S	S	*	*			trans	-84.5	6.9	179.9	-72.1	-178.9	0	0	0	113.7	I125	I125-L127 HydrophobicContact CD1-CD2 4.25Å; I125-L127 PolarHBondContact O-N 2.74Å
128	L	66.8	Low	62	Low	156 Å²	156	141.8 Å²	141.8	82%	0.817	86%	0.857	S	S	*	*			trans	-120.5	101.2	-177.7	-61.9	176.2	0	0	0	109.2	S126	S126-L128 VanDerWaalsContact C-N 3.25Å; S126-L128 PolarHBondContact O-N 3.2Å
129	S	56.7	Low	61.6	Low	116 Å²	116	133.3 Å²	133.3	81%	0.811	85%	0.85	S	S	*	*			trans	-62.8	125.1	161.4	-69.7	0	0	0	0	108.4	G131	S129-G131 PolarHBondContact O-N 2.85Å
130	P	64.6	Low	61.6	Low	133 Å²	133	134.4 Å²	134.4	86%	0.864	85%	0.853	S	S	*	*			trans	-70.1	99.8	169.1	27.5	-29	0	0	0	107.7
131	G	58.5	Low	61.9	Low	147 Å²	147	141 Å²	141	100%	1.515	87%	0.873	S	S	*	*			trans	-86.1	0	162.8	0	0	0	0	0	110.6	S129	S129-G131 PolarHBondContact O-N 2.85Å

Retrieved 131 of 131 residues in 20.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).