A0A077ZLQ0_TRITR Loading...

Small heat shock protein

AlphaFold DB , UniProt , Accession A0A077ZLQ0, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 104 aa.

						>A0A077ZLQ0_TRITR|A0A077ZLQ0
MLVRSKTSTMHRSHHTPLWNDELRLPPAPVFRHYFGRHKLQAGKLETTTKDDRLMLHEKHEENKDDHGEVKREITRAYCNRKGSTQKVSSRTCRRMICIILKVR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	38	Very low	35.5	Very low	247 Å²	247	162.5 Å²	162.5	100%	1.217	85%	0.847	S	S	*	*				0	110.1	0	-72.5	-179.4	170.9	0	0	107.8
2	L	35.5	Very low	35.5	Very low	154 Å²	154	166.6 Å²	166.6	81%	0.806	84%	0.843	S	S	*	*			trans	-122	104.6	-179.4	-165.4	78.8	0	0	0	107.6	R4	L2-R4 PolarHBondContact O-N 3.44Å
3	V	34.9	Very low	35.5	Very low	136 Å²	136	160.6 Å²	160.6	82%	0.824	83%	0.826	S	S	*	*			trans	-74.3	106.7	179.1	178.9	0	0	0	0	107.9	S5	V3-S5 PolarHBondContact O-N 3.13Å
4	R	34.1	Very low	35.8	Very low	223 Å²	223	160.4 Å²	160.4	84%	0.842	82%	0.819	S	S	*	*			trans	-85.7	105.5	172.7	-80.2	-177.9	161.7	-175.7	-4.9	109.4	L2 K6	L2-R4 PolarHBondContact O-N 3.44Å; R4-K6 PolarHBondContact O-N 3.2Å
5	S	36.2	Very low	36	Very low	101 Å²	101	160.6 Å²	160.6	71%	0.706	82%	0.815	S	S	*	*			trans	-63.6	121.7	169.6	-44.8	0	0	0	0	109.8	V3 T7	V3-S5 PolarHBondContact O-N 3.13Å; S5-T7 PolarHBondContact O-N 2.91Å
6	K	34.6	Very low	36.2	Very low	213 Å²	213	157.4 Å²	157.4	93%	0.926	81%	0.806	S	S	*	*			trans	-78.2	101.7	171.2	-69.8	-180	178.8	178.6	0	108.6	R4	R4-K6 PolarHBondContact O-N 3.2Å
7	T	37.6	Very low	36	Very low	129 Å²	129	153.4 Å²	153.4	79%	0.791	79%	0.793	S	S	*	*			trans	-81.2	113.5	166.4	35.9	0	0	0	0	108.9	S5 T9	S5-T7 PolarHBondContact O-N 2.91Å; T7-T9 PolarHBondContact O-N 3.1Å
8	S	35.1	Very low	36.3	Very low	112 Å²	112	153.6 Å²	153.6	78%	0.783	79%	0.794	S	S	*	*			trans	-65.9	114	174.2	-177.3	0	0	0	0	109.5	M10	S8-M10 PolarHBondContact O-N 3.08Å; S8-M10 VanDerWaalsContact O-N 3.12Å
9	T	36.8	Very low	36.3	Very low	123 Å²	123	157.5 Å²	157.5	76%	0.755	80%	0.798	S	S	*	*			trans	-71.2	99.2	171.8	-48.3	0	0	0	0	108.3	T7 H11	T7-T9 PolarHBondContact O-N 3.1Å; T9-H11 PolarHBondContact O-N 3.12Å; T9-H11 VanDerWaalsContact O-N 3.08Å
10	M	31.6	Very low	36.2	Very low	172 Å²	172	155.1 Å²	155.1	85%	0.847	79%	0.787	S	S	*	*			trans	-66.3	107.7	168.1	-78.8	-166.7	73.4	0	0	108.8	S8 R12	S8-M10 PolarHBondContact O-N 3.08Å; S8-M10 VanDerWaalsContact O-N 3.12Å; M10-R12 PolarHBondContact O-N 3.26Å; M10-R12 VanDerWaalsContact O-N 3.1Å
11	H	36.2	Very low	36.1	Very low	178 Å²	178	154.3 Å²	154.3	82%	0.824	79%	0.785	S	S	*	*			trans	-56.4	113.8	164.8	-100.3	-77.9	0	0	0	108.9	T9 S13	T9-H11 PolarHBondContact O-N 3.12Å; T9-H11 VanDerWaalsContact O-N 3.08Å; H11-S13 VanDerWaalsContact C-N 3.29Å; H11-S13 PolarHBondContact O-N 3.42Å
12	R	35.3	Very low	36	Very low	211 Å²	211	151.2 Å²	151.2	80%	0.796	77%	0.768	S	S	*	*			trans	-70.4	86.8	173.4	-162.2	-178.6	-160.2	-167.4	4.8	108.3	M10 H14	M10-R12 PolarHBondContact O-N 3.26Å; M10-R12 VanDerWaalsContact O-N 3.1Å; R12-H14 PolarHBondContact O-CD2 3.48Å; R12-H14 PolarHBondContact O-N 3.28Å
13	S	36	Very low	36.1	Very low	89 Å²	89	150 Å²	150	62%	0.622	76%	0.762	S	S	*	*			trans	-63.5	113.8	165.7	175	0	0	0	0	107.9	H11 H15	H11-S13 VanDerWaalsContact C-N 3.29Å; H11-S13 PolarHBondContact O-N 3.42Å; S13-H15 PolarHBondContact O-N 3.4Å
14	H	39.7	Very low	36.3	Very low	158 Å²	158	154.5 Å²	154.5	73%	0.731	76%	0.764	S	S	*	*			trans	-73.3	48.8	171.9	-78.6	-100.2	0	0	0	111.2	R12 T16	R12-H14 PolarHBondContact O-CD2 3.48Å; R12-H14 PolarHBondContact O-N 3.28Å; H14-T16 PolarHBondContact O-N 3.23Å; H14-T16 VanDerWaalsContact O-N 3.13Å
15	H	38.6	Very low	36.6	Very low	163 Å²	163	150.9 Å²	150.9	76%	0.755	76%	0.76	S	S	*	*			trans	-78.4	93.1	163.7	-110.3	-79.4	0	0	0	107.6	S13 P17	S13-H15 PolarHBondContact O-N 3.4Å; H15-P17 WeakPolarHBondContact O-CD 3.39Å
16	T	39.3	Very low	36.9	Very low	109 Å²	109	149.2 Å²	149.2	67%	0.669	75%	0.747	S	S	*	*			trans	-56.4	123.4	160.7	38.3	0	0	0	0	107.9	H14 L18	H14-T16 PolarHBondContact O-N 3.23Å; H14-T16 VanDerWaalsContact O-N 3.13Å; T16-L18 PolarHBondContact O-N 3.26Å
17	P	32.9	Very low	37.8	Very low	89 Å²	89	146.3 Å²	146.3	58%	0.578	75%	0.75	S	S	*	*			trans	-55.7	130.2	170.2	-20.4	30.7	0	0	0	108.4	H15 W19	H15-P17 WeakPolarHBondContact O-CD 3.39Å; P17-W19 HydrophobicContact CB-CB 4.4Å; P17-W19 PolarHBondContact O-N 2.9Å
18	L	40.8	Very low	38.6	Very low	157 Å²	157	141.5 Å²	141.5	82%	0.822	72%	0.723	S	S	*	*	T	Hydrogen-bonded Turn	trans	-71	48.2	176	-142.6	136.9	0	0	0	110.4	T16	T16-L18 PolarHBondContact O-N 3.26Å
19	W	36.5	Very low	40	Very low	228 Å²	228	139.9 Å²	139.9	86%	0.864	71%	0.71	S	S	*	*	T	Hydrogen-bonded Turn	trans	-126.9	3.6	-178.2	-77.7	61	0	0	0	111.1	P17	P17-W19 HydrophobicContact CB-CB 4.4Å; P17-W19 PolarHBondContact O-N 2.9Å
20	N	34.4	Very low	41.5	Very low	109 Å²	109	135.8 Å²	135.8	58%	0.583	69%	0.685	S	S	*	*			trans	-103.5	-6.2	179.3	-78.3	-27.3	0	0	0	114	E22	N20-E22 PolarHBondContact O-N 3.01Å
21	D	34.1	Very low	43.3	Very low	140 Å²	140	133.9 Å²	133.9	75%	0.749	67%	0.672	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.2	116.9	166.2	-73.7	-60.4	0	0	0	107.9
22	E	36.8	Very low	45	Very low	181 Å²	181	132.4 Å²	132.4	85%	0.846	66%	0.659	S	S	*	*	T	Hydrogen-bonded Turn	trans	91.4	35.4	175.9	-133.6	167.1	131.8	0	0	118.2	N20 R24	N20-E22 PolarHBondContact O-N 3.01Å; E22-R24 PolarHBondContact O-N 2.91Å
23	L	36.3	Very low	46.8	Very low	130 Å²	130	125.1 Å²	125.1	68%	0.681	63%	0.634	S	S	*	*			trans	-75.7	46.4	154.4	-76.1	170.9	0	0	0	112.2	L25	L23-L25 PolarHBondContact O-N 2.75Å
24	R	39.6	Very low	48.4	Very low	229 Å²	229	127 Å²	127	86%	0.864	63%	0.628	S	S	*	*			trans	-68.4	93.1	155	-82.8	-173.1	177	-173.6	0.8	105.9	E22 P26	E22-R24 PolarHBondContact O-N 2.91Å; R24-P26 VanDerWaalsContact O-N 3.12Å
25	L	40.3	Very low	49.7	Very low	147 Å²	147	120.3 Å²	120.3	77%	0.77	60%	0.597	S	S	*	*			trans	-47.9	124.7	166.9	-70.8	173.1	0	0	0	106.7	L23	L23-L25 PolarHBondContact O-N 2.75Å
26	P	42.4	Very low	50.9	Low	66 Å²	66	114.7 Å²	114.7	43%	0.429	58%	0.583	S	S	.	*			trans	-54.6	146.4	175.5	20.3	-29.4	0	0	0	108.2	R24 A28 V30	R24-P26 VanDerWaalsContact O-N 3.12Å; P26-A28 WeakPolarHBondContact CG-O 3.49Å; P26-A28 CarbonylContact O-C 3.58Å; P26-A28 PolarHBondContact O-N 3.04Å; P26-V30 HydrophobicContact CB-CG2 3.85Å; P26-V30 HydrophobicContact CG-CB 3.98Å; P26-V30 HydrophobicContact CG-CG2 3.56Å
27	P	52.9	Low	51.8	Low	152 Å²	152	116.4 Å²	116.4	99%	0.987	58%	0.577	S	S	*	*	S	Bend	trans	-60.4	-1.3	-175.1	22.1	-33.1	0	0	0	114.5
28	A	55.3	Low	52.8	Low	28 Å²	28	119.7 Å²	119.7	23%	0.231	59%	0.585	C	S	.	*	S	Bend	trans	-138.1	146.5	173.6	0	0	0	0	0	109.1	P26 V30 V103	P26-A28 WeakPolarHBondContact CG-O 3.49Å; P26-A28 CarbonylContact O-C 3.58Å; P26-A28 PolarHBondContact O-N 3.04Å; A28-V30 WeakPolarHBondContact O-CG2 3.25Å; A28-V30 PolarHBondContact O-N 2.75Å; A28-V103 VanDerWaalsContact CB-O 3.25Å; A28-V103 WeakPolarHBondContact CB-O 3.43Å
29	P	65.1	Low	53.5	Low	79 Å²	79	118 Å²	118	51%	0.513	57%	0.57	S	S	.	*			trans	-61.2	115.5	175.2	23.8	-28.9	0	0	0	109.4	F31 V103	P29-F31 HydrophobicContact CB-CE2 4.08Å; P29-V103 HydrophobicContact CG-CB 4.15Å; P29-V103 HydrophobicContact CG-CG2 4.48Å; P29-V103 PolarHBondContact O-N 2.83Å
30	V	67.1	Low	54.4	Low	36 Å²	36	107.2 Å²	107.2	22%	0.218	53%	0.53	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.1	109.9	175.9	-177.6	0	0	0	0	108.3	P26 A28 R32 I100 L101 K102	P26-V30 HydrophobicContact CB-CG2 3.85Å; P26-V30 HydrophobicContact CG-CB 3.98Å; P26-V30 HydrophobicContact CG-CG2 3.56Å; A28-V30 WeakPolarHBondContact O-CG2 3.25Å; A28-V30 PolarHBondContact O-N 2.75Å; V30-R32 HydrophobicContact CG1-CG 4.34Å; V30-I100 HydrophobicContact CG1-CG2 3.4Å; V30-L101 CarbonylContact C-O 3.56Å; V30-L101 VanDerWaalsContact CA-O 3.28Å; V30-L101 WeakPolarHBondContact CA-O 3.47Å; V30-K102 HydrophobicContact CG1-CG 4.37Å; V30-K102 HydrophobicContact CG2-CD 4.48Å; V30-K102 HydrophobicContact CG2-CG 3.71Å
31	F	69.2	Low	55.5	Low	133 Å²	133	108.7 Å²	108.7	58%	0.583	53%	0.533	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-89	129	172.9	-64.2	-89.8	0	0	0	109.4	P29 I100 L101	P29-F31 HydrophobicContact CB-CE2 4.08Å; F31-I100 WeakPolarHBondContact O-CA 3.25Å; F31-L101 HydrophobicContact CB-CB 4.12Å; F31-L101 PolarHBondContact N-O 2.9Å; F31-L101 PolarHBondContact O-N 3.46Å
32	R	72.8	Confident	56.4	Low	147 Å²	147	104.9 Å²	104.9	56%	0.555	52%	0.521	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-112.5	127.1	173.4	-63.4	-167	-174.3	-158.4	5.7	109.6	V30 Y34 I99 I100	V30-R32 HydrophobicContact CG1-CG 4.34Å; R32-Y34 HydrophobicContact CB-CE2 3.98Å; R32-Y34 WeakPolarHBondContact CD-OH 3.28Å; R32-I99 CarbonylContact C-O 3.52Å; R32-I99 VanDerWaalsContact CA-O 3.31Å; R32-I99 WeakPolarHBondContact CA-O 3.23Å; R32-I100 HydrophobicContact CG-CG1 4.25Å
33	H	71.9	Confident	57.5	Low	57 Å²	57	99.8 Å²	99.8	26%	0.264	52%	0.517	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.9	128.9	173.4	-142.7	72.6	0	0	0	109.7	F35 R76 C98 I99	H33-F35 HydrophobicContact CB-CE2 4.2Å; H33-F35 AromaticContact CD2-CE1 3.97Å; H33-F35 AromaticContact CD2-CE2 3.58Å; H33-F35 AromaticContact CD2-CZ 3.44Å; H33-F35 VanDerWaalsContact CD2-CZ 3.44Å; H33-F35 WeakPolarHBondContact CD2-CZ 3.43Å; H33-R76 PolarHBondContact CE1-NH1 2.93Å; H33-R76 PolarHBondContact NE2-NH1 2.74Å; H33-C98 CarbonylContact O-C 3.57Å; H33-C98 VanDerWaalsContact O-CA 3.31Å; H33-C98 WeakPolarHBondContact O-CA 3.48Å; H33-I99 HydrophobicContact CB-CB 4.47Å; H33-I99 PolarHBondContact N-O 3.05Å; H33-I99 PolarHBondContact O-N 2.71Å
34	Y	69.5	Low	58.9	Low	128 Å²	128	99.4 Å²	99.4	50%	0.502	51%	0.51	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.4	130.8	-179.2	-61	-88	0	0	0	109.7	R32 M96 I97 C98	R32-Y34 HydrophobicContact CB-CE2 3.98Å; R32-Y34 WeakPolarHBondContact CD-OH 3.28Å; Y34-M96 HydrophobicContact CD1-SD 4.42Å; Y34-I97 CarbonylContact C-O 3.58Å; Y34-I97 WeakPolarHBondContact CA-O 3.46Å; Y34-C98 HydrophobicContact CD1-CB 3.78Å; Y34-C98 HydrophobicContact CE1-CB 3.75Å; Y34-C98 WeakPolarHBondContact CE1-SG 3.35Å
35	F	67.6	Low	60.5	Low	19 Å²	19	90.7 Å²	90.7	8%	0.083	48%	0.48	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.7	137.2	173.6	-63.2	-88.7	0	0	0	110	H33 L40 M96 I97 I99	H33-F35 HydrophobicContact CB-CE2 4.2Å; H33-F35 AromaticContact CD2-CE1 3.97Å; H33-F35 AromaticContact CD2-CE2 3.58Å; H33-F35 AromaticContact CD2-CZ 3.44Å; H33-F35 VanDerWaalsContact CD2-CZ 3.44Å; H33-F35 WeakPolarHBondContact CD2-CZ 3.43Å; F35-L40 HydrophobicContact CB-CD1 3.58Å; F35-L40 HydrophobicContact CD1-CD1 3.55Å; F35-L40 HydrophobicContact CD2-CD1 4.24Å; F35-L40 HydrophobicContact CE1-CD1 4.25Å; F35-L40 HydrophobicContact CG-CD1 3.53Å; F35-M96 CarbonylContact O-C 3.59Å; F35-M96 WeakPolarHBondContact O-CA 3.34Å; F35-M96 WeakPolarHBondContact O-CB 3.4Å; F35-I97 HydrophobicContact CB-CB 4.41Å; F35-I97 PolarHBondContact N-O 2.74Å; F35-I97 PolarHBondContact O-N 2.76Å; F35-I99 HydrophobicContact CD2-CD1 4.16Å; F35-I99 HydrophobicContact CD2-CG1 4.25Å; F35-I99 HydrophobicContact CE2-CD1 3.57Å; F35-I99 HydrophobicContact CE2-CG1 3.99Å; F35-I99 HydrophobicContact CZ-CD1 4.49Å
36	G	65.1	Low	62.4	Low	44 Å²	44	89.4 Å²	89.4	45%	0.454	47%	0.47	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-68.5	133.7	169.7	0	0	0	0	0	111.2	H38 K39	G36-H38 PolarHBondContact O-N 2.88Å; G36-K39 PolarHBondContact O-N 3.36Å; G36-K39 VanDerWaalsContact O-N 3.12Å
37	R	57.6	Low	64.1	Low	145 Å²	145	89.2 Å²	89.2	55%	0.547	47%	0.468	S	S	.	.	G	3₁₀ helix	trans	-61.4	-16.2	-178	-168	176.6	-176.2	-172.3	-1.9	113.5	K39 R94 R95	R37-K39 PolarHBondContact O-N 2.81Å; R37-K39 VanDerWaalsContact O-N 3.1Å; R37-R94 WeakPolarHBondContact CD-O 3.34Å; R37-R94 PolarHBondContact NH1-O 2.91Å; R37-R95 VanDerWaalsContact CB-C 3.49Å; R37-R95 WeakPolarHBondContact CB-O 3.24Å; R37-R95 PolarHBondContact N-O 2.74Å
38	H	54.5	Low	65.6	Low	159 Å²	159	85.6 Å²	85.6	74%	0.736	44%	0.443	S	S	*	.	G	3₁₀ helix	trans	-63.7	-8	172.6	-78.3	-81.3	0	0	0	114.1	G36	G36-H38 PolarHBondContact O-N 2.88Å
39	K	54.8	Low	66.7	Low	120 Å²	120	88.9 Å²	88.9	52%	0.522	46%	0.46	S	S	.	.	G	3₁₀ helix	trans	-121.8	-7.8	-179.9	-64.5	-152.2	175.6	-165.6	0	115.4	G36 R37 H60	G36-K39 PolarHBondContact O-N 3.36Å; G36-K39 VanDerWaalsContact O-N 3.12Å; R37-K39 PolarHBondContact O-N 2.81Å; R37-K39 VanDerWaalsContact O-N 3.1Å; K39-H60 WeakPolarHBondContact O-CB 3.44Å; K39-H60 PolarHBondContact O-CD2 2.81Å
40	L	55.5	Low	67.4	Low	2 Å²	2	91.8 Å²	91.8	1%	0.01	47%	0.465	C	S	.	.			trans	-149.1	115.2	-164.2	-74.6	166.6	0	0	0	110.8	F35 E58 H60 I74 I97	F35-L40 HydrophobicContact CB-CD1 3.58Å; F35-L40 HydrophobicContact CD1-CD1 3.55Å; F35-L40 HydrophobicContact CD2-CD1 4.24Å; F35-L40 HydrophobicContact CE1-CD1 4.25Å; F35-L40 HydrophobicContact CG-CD1 3.53Å; L40-E58 WeakPolarHBondContact CB-OE1 3.31Å; L40-E58 WeakPolarHBondContact CD1-OE1 3.4Å; L40-E58 WeakPolarHBondContact CD1-OE2 3.45Å; L40-E58 HydrophobicContact CD2-CB 3.87Å; L40-E58 HydrophobicContact CD2-CG 3.39Å; L40-E58 VanDerWaalsContact CD2-OE1 3.23Å; L40-E58 WeakPolarHBondContact CD2-OE1 3.34Å; L40-E58 WeakPolarHBondContact CD2-OE2 3.43Å; L40-E58 HydrophobicContact CG-CG 4.42Å; L40-E58 WeakPolarHBondContact CG-OE1 3.46Å; L40-H60 HydrophobicContact CD2-CB 4.13Å; L40-I74 HydrophobicContact CD1-CD1 4.28Å; L40-I74 HydrophobicContact CD2-CD1 4.17Å; L40-I74 HydrophobicContact CG-CD1 4.37Å; L40-I97 HydrophobicContact CB-CD1 3.64Å; L40-I97 VanDerWaalsContact O-CD1 3.3Å; L40-I97 WeakPolarHBondContact O-CD1 3.19Å
41	Q	56.4	Low	67.9	Low	141 Å²	141	96 Å²	96	66%	0.659	49%	0.486	S	S	*	.			trans	-81.4	121.6	173.4	-144.8	-177.8	72.5	0	0	107.5	G43 H60	Q41-G43 PolarHBondContact O-N 3.1Å; Q41-H60 PolarHBondContact N-ND1 2.81Å
42	A	53.8	Low	68.4	Low	60 Å²	60	93 Å²	93	50%	0.496	48%	0.476	S	S	.	.	T	Hydrogen-bonded Turn	trans	-63.2	101.1	-178.9	0	0	0	0	0	109.6	T92 I97	A42-T92 HydrophobicContact CB-CG2 4.11Å; A42-T92 WeakPolarHBondContact CB-OG1 3.5Å; A42-I97 HydrophobicContact CB-CD1 4.26Å
43	G	59.5	Low	68.6	Low	73 Å²	73	92.4 Å²	92.4	75%	0.753	47%	0.474	S	S	*	.	T	Hydrogen-bonded Turn	trans	170.1	-30.3	178.1	0	0	0	0	0	116.3	Q41	Q41-G43 PolarHBondContact O-N 3.1Å
44	K	66.9	Low	69.1	Low	123 Å²	123	89.8 Å²	89.8	54%	0.535	46%	0.462	S	S	.	.			trans	-117.8	59.1	-177.8	-72.2	-177.5	-179.3	173.2	0	112.4	E58 K59 E61	K44-E58 WeakPolarHBondContact O-CA 3.44Å; K44-K59 PolarHBondContact O-N 2.76Å; K44-E61 IonicContact NZ-OE2 3.85Å
45	L	73.3	Confident	69.7	Low	45 Å²	45	85.9 Å²	85.9	24%	0.236	45%	0.449	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.2	109.7	170.3	-178.5	71.2	0	0	0	109	T47 L56 E58 I99	L45-T47 HydrophobicContact CG-CG2 4.48Å; L45-L56 HydrophobicContact CD1-CD1 4.11Å; L45-L56 HydrophobicContact CD1-CD2 3.55Å; L45-L56 HydrophobicContact CD1-CG 3.61Å; L45-E58 HydrophobicContact CB-CG 4.43Å; L45-E58 HydrophobicContact CD1-CB 4.04Å; L45-E58 HydrophobicContact CD1-CG 3.85Å; L45-I99 HydrophobicContact CD1-CD1 3.74Å; L45-I99 HydrophobicContact CD2-CD1 3.69Å; L45-I99 HydrophobicContact CD2-CG1 4.2Å; L45-I99 HydrophobicContact CG-CD1 4.39Å
46	E	80	Confident	70.3	Confident	120 Å²	120	85 Å²	85	56%	0.561	45%	0.445	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-102.1	135.1	173.8	-70	179.7	-171.9	0	0	109.8	H57	E46-H57 HydrophobicContact CB-CB 4.3Å; E46-H57 PolarHBondContact N-O 3.3Å; E46-H57 PolarHBondContact O-N 3.09Å; E46-H57 VanDerWaalsContact O-O 3.12Å
47	T	77.9	Confident	71	Confident	63 Å²	63	85.4 Å²	85.4	39%	0.387	44%	0.435	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.9	119.2	177.7	59.4	0	0	0	0	108.9	L45 M55 L56 V88	L45-T47 HydrophobicContact CG-CG2 4.48Å; T47-M55 CarbonylContact C-O 3.5Å; T47-M55 WeakPolarHBondContact CA-O 3.39Å; T47-L56 HydrophobicContact CG2-CD1 3.92Å; T47-L56 HydrophobicContact CG2-CG 4.38Å; T47-V88 HydrophobicContact CG2-CB 3.94Å; T47-V88 HydrophobicContact CG2-CG1 3.78Å; T47-V88 HydrophobicContact CG2-CG2 3.87Å
48	T	83.1	Confident	71.8	Confident	75 Å²	75	78.7 Å²	78.7	46%	0.46	41%	0.41	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116	144	175.6	38.6	0	0	0	0	109.4	M55	T48-M55 PolarHBondContact N-O 3.47Å; T48-M55 WeakPolarHBondContact O-CA 3.31Å; T48-M55 WeakPolarHBondContact O-CB 3.12Å; T48-M55 PolarHBondContact O-N 3.16Å; T48-M55 VanDerWaalsContact O-O 3.12Å; T48-M55 WeakPolarHBondContact OG1-CB 3.11Å
49	T	78.9	Confident	72.5	Confident	97 Å²	97	76.3 Å²	76.3	60%	0.595	40%	0.397	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-112	122.1	173.8	-50	0	0	0	0	107.5	R53	T49-R53 WeakPolarHBondContact CA-O 3.31Å
50	K	79.9	Confident	73.3	Confident	141 Å²	141	71.4 Å²	71.4	61%	0.613	38%	0.376	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-145	135.1	179.7	-162.1	-171.6	174.2	-176.7	0	109.5	D52 R53	K50-D52 PolarHBondContact O-N 2.67Å; K50-R53 PolarHBondContact N-O 3.11Å; K50-R53 WeakPolarHBondContact O-CA 3.12Å; K50-R53 WeakPolarHBondContact O-CB 3.47Å; K50-R53 PolarHBondContact O-N 2.81Å
51	D	78.5	Confident	73.4	Confident	124 Å²	124	75.9 Å²	75.9	66%	0.663	40%	0.397	S	S	*	.	T	Hydrogen-bonded Turn	trans	49.7	51	172.6	-51.9	-38.3	0	0	0	113.8	R53	D51-R53 PolarHBondContact O-N 2.93Å; D51-R53 VanDerWaalsContact O-N 3.16Å
52	D	78.4	Confident	73.7	Confident	70 Å²	70	71.9 Å²	71.9	37%	0.374	38%	0.378	S	S	.	.	T	Hydrogen-bonded Turn	trans	59.2	22.8	-176.2	-55	-52.7	0	0	0	114.5	K50 N80 K82	K50-D52 PolarHBondContact O-N 2.67Å; D52-N80 VanDerWaalsContact O-CA 3.31Å; D52-N80 WeakPolarHBondContact O-CA 3.48Å; D52-N80 WeakPolarHBondContact O-CB 3.45Å; D52-N80 PolarHBondContact O-N 2.9Å; D52-K82 HydrophobicContact CB-CG 4.34Å; D52-K82 WeakPolarHBondContact OD1-CG 2.93Å; D52-K82 WeakPolarHBondContact OD2-CE 3.5Å; D52-K82 WeakPolarHBondContact OD2-CG 3.24Å
53	R	78.3	Confident	74.2	Confident	134 Å²	134	75.8 Å²	75.8	51%	0.506	39%	0.391	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.2	137.5	175.7	-60.9	176.5	-176.9	-173.4	0.2	110.3	T49 K50 D51 Y78	T49-R53 WeakPolarHBondContact CA-O 3.31Å; K50-R53 PolarHBondContact N-O 3.11Å; K50-R53 WeakPolarHBondContact O-CA 3.12Å; K50-R53 WeakPolarHBondContact O-CB 3.47Å; K50-R53 PolarHBondContact O-N 2.81Å; D51-R53 PolarHBondContact O-N 2.93Å; D51-R53 VanDerWaalsContact O-N 3.16Å; R53-Y78 CarbonylContact C-O 3.52Å; R53-Y78 VanDerWaalsContact CA-O 3.31Å; R53-Y78 WeakPolarHBondContact CA-O 3.37Å
54	L	80.7	Confident	74.5	Confident	2 Å²	2	79.4 Å²	79.4	1%	0.01	39%	0.386	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.1	113.4	164.4	-177.9	82.5	0	0	0	108.6	A77 Y78 V88 L101	L54-A77 CarbonylContact O-C 3.46Å; L54-A77 WeakPolarHBondContact O-CA 3.49Å; L54-Y78 HydrophobicContact CD2-CD2 4.46Å; L54-Y78 PolarHBondContact N-O 2.84Å; L54-Y78 PolarHBondContact O-N 2.77Å; L54-V88 HydrophobicContact CD1-CG2 3.77Å; L54-V88 HydrophobicContact CD2-CG2 3.65Å; L54-V88 HydrophobicContact CG-CG2 4.33Å; L54-L101 HydrophobicContact CD2-CD1 3.92Å; L54-L101 HydrophobicContact CD2-CD2 3.11Å; L54-L101 HydrophobicContact CD2-CG 4.15Å
55	M	82.7	Confident	74.9	Confident	46 Å²	46	77 Å²	77	23%	0.227	38%	0.379	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90	127.5	170.8	-66.4	-68.8	-45.6	0	0	108.8	T47 T48 T75 R76 A77	T47-M55 CarbonylContact C-O 3.5Å; T47-M55 WeakPolarHBondContact CA-O 3.39Å; T48-M55 PolarHBondContact N-O 3.47Å; T48-M55 WeakPolarHBondContact O-CA 3.31Å; T48-M55 WeakPolarHBondContact O-CB 3.12Å; T48-M55 PolarHBondContact O-N 3.16Å; T48-M55 VanDerWaalsContact O-O 3.12Å; T48-M55 WeakPolarHBondContact OG1-CB 3.11Å; M55-T75 HydrophobicContact CE-CG2 3.13Å; M55-R76 CarbonylContact C-O 3.55Å; M55-A77 HydrophobicContact SD-CB 3.65Å
56	L	80.3	Confident	75.4	Confident	1 Å²	1	82.9 Å²	82.9	1%	0.005	41%	0.411	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.2	106.7	177	-165.3	123.7	0	0	0	106.6	L45 T47 T75 R76 Y78 V88 I99	L45-L56 HydrophobicContact CD1-CD1 4.11Å; L45-L56 HydrophobicContact CD1-CD2 3.55Å; L45-L56 HydrophobicContact CD1-CG 3.61Å; T47-L56 HydrophobicContact CG2-CD1 3.92Å; T47-L56 HydrophobicContact CG2-CG 4.38Å; L56-T75 CarbonylContact O-C 3.55Å; L56-T75 WeakPolarHBondContact O-CA 3.31Å; L56-R76 PolarHBondContact N-O 2.75Å; L56-R76 PolarHBondContact O-N 2.81Å; L56-Y78 HydrophobicContact CB-CE2 4.29Å; L56-V88 HydrophobicContact CD1-CG1 4.21Å; L56-I99 HydrophobicContact CD1-CD1 3.77Å; L56-I99 HydrophobicContact CD1-CG2 3.78Å; L56-I99 HydrophobicContact CD2-CD1 3.46Å; L56-I99 VanDerWaalsContact CD2-CD1 3.46Å; L56-I99 HydrophobicContact CG-CD1 4.14Å
57	H	79.4	Confident	75.3	Confident	52 Å²	52	85.6 Å²	85.6	24%	0.241	42%	0.423	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.3	124.6	178.1	-107.9	-92.8	0	0	0	108.8	E46 E73 T75	E46-H57 HydrophobicContact CB-CB 4.3Å; E46-H57 PolarHBondContact N-O 3.3Å; E46-H57 PolarHBondContact O-N 3.09Å; E46-H57 VanDerWaalsContact O-O 3.12Å; H57-E73 IonicContact CE1-OE1 3.12Å; H57-E73 PolarHBondContact CE1-OE1 2.78Å; H57-E73 IonicContact ND1-OE1 2.77Å; H57-E73 PolarHBondContact ND1-OE1 2.74Å; H57-T75 VanDerWaalsContact CD2-CG2 3.5Å; H57-T75 WeakPolarHBondContact CD2-CG2 3.47Å; H57-T75 PolarHBondContact CE1-OG1 2.72Å; H57-T75 PolarHBondContact ND1-OG1 3.3Å; H57-T75 WeakPolarHBondContact NE2-CG2 3.39Å; H57-T75 PolarHBondContact NE2-OG1 2.85Å
58	E	75	Confident	75.1	Confident	4 Å²	4	84 Å²	84	2%	0.019	42%	0.42	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128	116.9	177.9	-150.6	175.5	171.1	0	0	109	L40 K44 L45 E73 I74	L40-E58 WeakPolarHBondContact CB-OE1 3.31Å; L40-E58 WeakPolarHBondContact CD1-OE1 3.4Å; L40-E58 WeakPolarHBondContact CD1-OE2 3.45Å; L40-E58 HydrophobicContact CD2-CB 3.87Å; L40-E58 HydrophobicContact CD2-CG 3.39Å; L40-E58 VanDerWaalsContact CD2-OE1 3.23Å; L40-E58 WeakPolarHBondContact CD2-OE1 3.34Å; L40-E58 WeakPolarHBondContact CD2-OE2 3.43Å; L40-E58 HydrophobicContact CG-CG 4.42Å; L40-E58 WeakPolarHBondContact CG-OE1 3.46Å; K44-E58 WeakPolarHBondContact O-CA 3.44Å; L45-E58 HydrophobicContact CB-CG 4.43Å; L45-E58 HydrophobicContact CD1-CB 4.04Å; L45-E58 HydrophobicContact CD1-CG 3.85Å; E58-E73 CarbonylContact O-C 3.6Å; E58-E73 WeakPolarHBondContact O-CA 3.4Å; E58-I74 PolarHBondContact N-O 2.85Å; E58-I74 PolarHBondContact O-N 2.85Å
59	K	70.3	Confident	74.2	Confident	109 Å²	109	85.9 Å²	85.9	47%	0.474	42%	0.423	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-101	120.9	177.8	-75.5	178.7	177.8	174.1	0	109.3	K44 E73	K44-K59 PolarHBondContact O-N 2.76Å; K59-E73 WeakPolarHBondContact CE-OE1 3.38Å; K59-E73 WeakPolarHBondContact CE-OE2 3.32Å; K59-E73 HydrophobicContact CG-CB 4.43Å; K59-E73 HydrophobicContact CG-CG 3.86Å; K59-E73 IonicContact NZ-OE1 3.97Å
60	H	70.5	Confident	73.4	Confident	17 Å²	17	83 Å²	83	8%	0.079	41%	0.405	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115	117.7	176.1	179.9	53.3	0	0	0	110.1	K39 L40 Q41 E62 R72	K39-H60 WeakPolarHBondContact O-CB 3.44Å; K39-H60 PolarHBondContact O-CD2 2.81Å; L40-H60 HydrophobicContact CD2-CB 4.13Å; Q41-H60 PolarHBondContact N-ND1 2.81Å; H60-E62 WeakPolarHBondContact NE2-CA 3.23Å; H60-E62 VanDerWaalsContact NE2-CB 3.34Å; H60-E62 WeakPolarHBondContact NE2-CB 3.3Å; H60-E62 WeakPolarHBondContact NE2-CG 3.04Å; H60-R72 CarbonylContact C-O 3.53Å; H60-R72 WeakPolarHBondContact CA-O 3.21Å; H60-R72 HydrophobicContact CB-CB 4.38Å; H60-R72 PolarHBondContact N-O 2.75Å; H60-R72 PolarHBondContact O-N 2.95Å
61	E	58.7	Low	73	Confident	97 Å²	97	82.3 Å²	82.3	45%	0.453	40%	0.402	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.4	111.6	156.8	-80.4	172.4	140.5	0	0	106.6	K44 K71	K44-E61 IonicContact NZ-OE2 3.85Å; E61-K71 HydrophobicContact CG-CD 3.89Å; E61-K71 HydrophobicContact CG-CG 3.98Å; E61-K71 VanDerWaalsContact OE1-CE 3.23Å; E61-K71 WeakPolarHBondContact OE1-CE 3.42Å; E61-K71 IonicContact OE1-NZ 3.26Å; E61-K71 PolarHBondContact OE1-NZ 2.78Å
62	E	61.9	Low	72.6	Confident	56 Å²	56	80.7 Å²	80.7	26%	0.262	39%	0.387	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.6	148.1	168.1	-152.6	171.2	-138.5	0	0	108.2	H60 V70 R72	H60-E62 WeakPolarHBondContact NE2-CA 3.23Å; H60-E62 VanDerWaalsContact NE2-CB 3.34Å; H60-E62 WeakPolarHBondContact NE2-CB 3.3Å; H60-E62 WeakPolarHBondContact NE2-CG 3.04Å; E62-V70 WeakPolarHBondContact CA-O 3.43Å; E62-V70 HydrophobicContact CB-CB 4.08Å; E62-V70 HydrophobicContact CB-CG1 4.28Å; E62-V70 WeakPolarHBondContact CB-O 3.37Å; E62-V70 PolarHBondContact N-O 2.8Å; E62-V70 WeakPolarHBondContact OE2-CG1 3.36Å; E62-R72 IonicContact OE1-CZ 3.65Å; E62-R72 IonicContact OE1-NH1 2.74Å; E62-R72 PolarHBondContact OE1-NH1 2.79Å; E62-R72 IonicContact OE1-NH2 3.76Å; E62-R72 IonicContact OE2-CZ 2.87Å; E62-R72 IonicContact OE2-NE 3.86Å; E62-R72 IonicContact OE2-NH1 2.76Å; E62-R72 PolarHBondContact OE2-NH1 3.05Å; E62-R72 IonicContact OE2-NH2 2.67Å; E62-R72 PolarHBondContact OE2-NH2 3.12Å
63	N	63.5	Low	72.4	Confident	143 Å²	143	82.2 Å²	82.2	77%	0.765	39%	0.392	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-56	156.5	-178.5	-124.3	12.7	0	0	0	110.6	D65	N63-D65 PolarHBondContact O-N 2.76Å
64	K	66	Low	72.2	Confident	149 Å²	149	78 Å²	78	65%	0.648	38%	0.379	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-55.4	117.3	168.4	-73.4	-177.7	177.8	-177.7	0	108.9	G68 E69	K64-G68 WeakPolarHBondContact CA-O 3.43Å; K64-E69 HydrophobicContact CD-CG 4.17Å; K64-E69 VanDerWaalsContact CE-CG 3.41Å; K64-E69 WeakPolarHBondContact CE-OE1 3.45Å; K64-E69 HydrophobicContact CG-CG 3.59Å; K64-E69 IonicContact NZ-OE1 3.87Å; K64-E69 PolarHBondContact NZ-OE1 3.16Å
65	D	75.8	Confident	72.2	Confident	71 Å²	71	81.1 Å²	81.1	38%	0.38	40%	0.398	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.2	178.4	163.1	65.6	15.1	0	0	0	109	N63 H67 G68	N63-D65 PolarHBondContact O-N 2.76Å; D65-H67 PolarHBondContact O-N 2.93Å; D65-H67 VanDerWaalsContact OD1-C 3.29Å; D65-H67 VanDerWaalsContact OD1-CA 3.25Å; D65-H67 WeakPolarHBondContact OD1-CA 3.32Å; D65-H67 VanDerWaalsContact OD1-CB 3.28Å; D65-H67 WeakPolarHBondContact OD1-CB 3.4Å; D65-H67 PolarHBondContact OD1-N 2.8Å; D65-G68 PolarHBondContact N-O 3.15Å; D65-G68 PolarHBondContact O-N 2.86Å; D65-G68 PolarHBondContact OD1-N 2.85Å; D65-G68 VanDerWaalsContact OD1-O 3.14Å
66	D	82.7	Confident	72	Confident	170 Å²	170	83.9 Å²	83.9	91%	0.909	41%	0.406	S	S	*	.	T	Hydrogen-bonded Turn	trans	-61.3	-7.3	177.3	-65.1	-40.8	0	0	0	112.9
67	H	78.1	Confident	72.1	Confident	176 Å²	176	86.5 Å²	86.5	82%	0.815	43%	0.428	S	S	*	.	T	Hydrogen-bonded Turn	trans	-107.2	0.4	178.3	-52.5	-61.9	0	0	0	113.6	D65	D65-H67 PolarHBondContact O-N 2.93Å; D65-H67 VanDerWaalsContact OD1-C 3.29Å; D65-H67 VanDerWaalsContact OD1-CA 3.25Å; D65-H67 WeakPolarHBondContact OD1-CA 3.32Å; D65-H67 VanDerWaalsContact OD1-CB 3.28Å; D65-H67 WeakPolarHBondContact OD1-CB 3.4Å; D65-H67 PolarHBondContact OD1-N 2.8Å
68	G	73.6	Confident	72	Confident	31 Å²	31	86.5 Å²	86.5	32%	0.32	43%	0.426	S	S	.	.	E	Extended strand (participates in β ladder)	trans	114	-160.1	175.5	0	0	0	0	0	114.1	K64 D65 V70	K64-G68 WeakPolarHBondContact CA-O 3.43Å; D65-G68 PolarHBondContact N-O 3.15Å; D65-G68 PolarHBondContact O-N 2.86Å; D65-G68 PolarHBondContact OD1-N 2.85Å; D65-G68 VanDerWaalsContact OD1-O 3.14Å; G68-V70 PolarHBondContact O-N 3.28Å
69	E	65.5	Low	72	Confident	113 Å²	113	91.5 Å²	91.5	53%	0.528	46%	0.46	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.7	115.6	-179.1	-69.1	-179.2	-170.2	0	0	110.8	K64 K71	K64-E69 HydrophobicContact CD-CG 4.17Å; K64-E69 VanDerWaalsContact CE-CG 3.41Å; K64-E69 WeakPolarHBondContact CE-OE1 3.45Å; K64-E69 HydrophobicContact CG-CG 3.59Å; K64-E69 IonicContact NZ-OE1 3.87Å; K64-E69 PolarHBondContact NZ-OE1 3.16Å; E69-K71 IonicContact OE2-NZ 2.71Å
70	V	61.9	Low	71.9	Confident	36 Å²	36	87.5 Å²	87.5	22%	0.218	44%	0.444	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95	109.2	174.6	178	0	0	0	0	109.6	E62 G68 R72	E62-V70 WeakPolarHBondContact CA-O 3.43Å; E62-V70 HydrophobicContact CB-CB 4.08Å; E62-V70 HydrophobicContact CB-CG1 4.28Å; E62-V70 WeakPolarHBondContact CB-O 3.37Å; E62-V70 PolarHBondContact N-O 2.8Å; E62-V70 WeakPolarHBondContact OE2-CG1 3.36Å; G68-V70 PolarHBondContact O-N 3.28Å; V70-R72 HydrophobicContact CG1-CG 4.14Å
71	K	70.8	Confident	71.9	Confident	128 Å²	128	97 Å²	97	56%	0.557	48%	0.479	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-101.3	132.2	172.1	-50.5	-162.6	-175.3	-162.4	0	109.9	E61 E69	E61-K71 HydrophobicContact CG-CD 3.89Å; E61-K71 HydrophobicContact CG-CG 3.98Å; E61-K71 VanDerWaalsContact OE1-CE 3.23Å; E61-K71 WeakPolarHBondContact OE1-CE 3.42Å; E61-K71 IonicContact OE1-NZ 3.26Å; E61-K71 PolarHBondContact OE1-NZ 2.78Å; E69-K71 IonicContact OE2-NZ 2.71Å
72	R	70.1	Confident	72.5	Confident	89 Å²	89	100.5 Å²	100.5	34%	0.336	49%	0.493	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.6	135.4	176.6	-60.2	-169.5	-175.1	119.7	8.8	110.3	H60 E62 V70	H60-R72 CarbonylContact C-O 3.53Å; H60-R72 WeakPolarHBondContact CA-O 3.21Å; H60-R72 HydrophobicContact CB-CB 4.38Å; H60-R72 PolarHBondContact N-O 2.75Å; H60-R72 PolarHBondContact O-N 2.95Å; E62-R72 IonicContact OE1-CZ 3.65Å; E62-R72 IonicContact OE1-NH1 2.74Å; E62-R72 PolarHBondContact OE1-NH1 2.79Å; E62-R72 IonicContact OE1-NH2 3.76Å; E62-R72 IonicContact OE2-CZ 2.87Å; E62-R72 IonicContact OE2-NE 3.86Å; E62-R72 IonicContact OE2-NH1 2.76Å; E62-R72 PolarHBondContact OE2-NH1 3.05Å; E62-R72 IonicContact OE2-NH2 2.67Å; E62-R72 PolarHBondContact OE2-NH2 3.12Å; V70-R72 HydrophobicContact CG1-CG 4.14Å
73	E	75	Confident	72.9	Confident	103 Å²	103	101.8 Å²	101.8	48%	0.481	52%	0.521	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.7	129.8	172.2	-175	164.4	-168.9	0	0	108.5	H57 E58 K59	H57-E73 IonicContact CE1-OE1 3.12Å; H57-E73 PolarHBondContact CE1-OE1 2.78Å; H57-E73 IonicContact ND1-OE1 2.77Å; H57-E73 PolarHBondContact ND1-OE1 2.74Å; E58-E73 CarbonylContact O-C 3.6Å; E58-E73 WeakPolarHBondContact O-CA 3.4Å; K59-E73 WeakPolarHBondContact CE-OE1 3.38Å; K59-E73 WeakPolarHBondContact CE-OE2 3.32Å; K59-E73 HydrophobicContact CG-CB 4.43Å; K59-E73 HydrophobicContact CG-CG 3.86Å; K59-E73 IonicContact NZ-OE1 3.97Å
74	I	73.6	Confident	73.1	Confident	45 Å²	45	96.2 Å²	96.2	23%	0.231	49%	0.493	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.7	120	178.5	-59.7	178.1	0	0	0	107.7	L40 E58 R76	L40-I74 HydrophobicContact CD1-CD1 4.28Å; L40-I74 HydrophobicContact CD2-CD1 4.17Å; L40-I74 HydrophobicContact CG-CD1 4.37Å; E58-I74 PolarHBondContact N-O 2.85Å; E58-I74 PolarHBondContact O-N 2.85Å; I74-R76 HydrophobicContact CG2-CG 4.28Å
75	T	80.8	Confident	73.2	Confident	68 Å²	68	93.9 Å²	93.9	42%	0.417	49%	0.492	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.1	126.8	173.4	-54.4	0	0	0	0	109.3	M55 L56 H57	M55-T75 HydrophobicContact CE-CG2 3.13Å; L56-T75 CarbonylContact O-C 3.55Å; L56-T75 WeakPolarHBondContact O-CA 3.31Å; H57-T75 VanDerWaalsContact CD2-CG2 3.5Å; H57-T75 WeakPolarHBondContact CD2-CG2 3.47Å; H57-T75 PolarHBondContact CE1-OG1 2.72Å; H57-T75 PolarHBondContact ND1-OG1 3.3Å; H57-T75 WeakPolarHBondContact NE2-CG2 3.39Å; H57-T75 PolarHBondContact NE2-OG1 2.85Å
76	R	79.6	Confident	73.1	Confident	103 Å²	103	92.1 Å²	92.1	39%	0.389	48%	0.481	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.8	131.4	172.1	-71.5	-164.7	171.2	-153.7	4.9	111.4	H33 M55 L56 I74 Y78	H33-R76 PolarHBondContact CE1-NH1 2.93Å; H33-R76 PolarHBondContact NE2-NH1 2.74Å; M55-R76 CarbonylContact C-O 3.55Å; L56-R76 PolarHBondContact N-O 2.75Å; L56-R76 PolarHBondContact O-N 2.81Å; I74-R76 HydrophobicContact CG2-CG 4.28Å; R76-Y78 HydrophobicContact CB-CE2 3.91Å
77	A	80.7	Confident	72.7	Confident	57 Å²	57	90.4 Å²	90.4	47%	0.471	47%	0.466	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.8	130.4	174.6	0	0	0	0	0	109.6	L54 M55	L54-A77 CarbonylContact O-C 3.46Å; L54-A77 WeakPolarHBondContact O-CA 3.49Å; M55-A77 HydrophobicContact SD-CB 3.65Å
78	Y	77.3	Confident	72.6	Confident	51 Å²	51	83.8 Å²	83.8	20%	0.2	44%	0.438	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.4	122.1	172.3	-61.4	-87.3	0	0	0	108.4	R53 L54 L56 R76 N80 L101	R53-Y78 CarbonylContact C-O 3.52Å; R53-Y78 VanDerWaalsContact CA-O 3.31Å; R53-Y78 WeakPolarHBondContact CA-O 3.37Å; L54-Y78 HydrophobicContact CD2-CD2 4.46Å; L54-Y78 PolarHBondContact N-O 2.84Å; L54-Y78 PolarHBondContact O-N 2.77Å; L56-Y78 HydrophobicContact CB-CE2 4.29Å; R76-Y78 HydrophobicContact CB-CE2 3.91Å; Y78-N80 PolarHBondContact O-N 3.1Å; Y78-L101 HydrophobicContact CD1-CD1 4.33Å; Y78-L101 HydrophobicContact CD2-CD1 4.01Å; Y78-L101 HydrophobicContact CE2-CD1 4.2Å; Y78-L101 HydrophobicContact CG-CD1 4.08Å
79	C	75.2	Confident	72.8	Confident	109 Å²	109	85 Å²	85	74%	0.736	44%	0.441	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-64.1	124.8	173.4	-66.3	0	0	0	0	109.2
80	N	69.9	Low	73.2	Confident	26 Å²	26	82.8 Å²	82.8	14%	0.139	44%	0.438	C	S	.	.	P	Polyproline II helix	trans	-96.8	154.9	173.2	-157.1	18.2	0	0	0	110.8	D52 Y78 S84 Q86	D52-N80 VanDerWaalsContact O-CA 3.31Å; D52-N80 WeakPolarHBondContact O-CA 3.48Å; D52-N80 WeakPolarHBondContact O-CB 3.45Å; D52-N80 PolarHBondContact O-N 2.9Å; Y78-N80 PolarHBondContact O-N 3.1Å; N80-S84 PolarHBondContact ND2-O 2.81Å; N80-S84 PolarHBondContact ND2-OG 2.8Å; N80-S84 VanDerWaalsContact ND2-OG 3.16Å; N80-S84 PolarHBondContact OD1-OG 2.81Å; N80-Q86 PolarHBondContact ND2-NE2 3.12Å; N80-Q86 PolarHBondContact OD1-NE2 2.85Å; N80-Q86 VanDerWaalsContact OD1-NE2 3.1Å
81	R	69.7	Low	73.7	Confident	215 Å²	215	89.7 Å²	89.7	81%	0.811	46%	0.46	S	S	*	.	P	Polyproline II helix	trans	-76.2	131.7	166.8	-141.4	178	-172.9	-167.7	1.2	108.3	G83 S84	R81-G83 PolarHBondContact O-N 3.47Å; R81-S84 PolarHBondContact O-N 2.96Å; R81-S84 VanDerWaalsContact O-N 3.11Å; R81-S84 PolarHBondContact O-OG 3.03Å
82	K	70.3	Confident	73.6	Confident	172 Å²	172	86.9 Å²	86.9	75%	0.748	45%	0.454	S	S	*	.	T	Hydrogen-bonded Turn	trans	-46.1	128.9	175.7	-86.7	179.9	173.9	-173.8	0	111.1	D52 S84	D52-K82 HydrophobicContact CB-CG 4.34Å; D52-K82 WeakPolarHBondContact OD1-CG 2.93Å; D52-K82 WeakPolarHBondContact OD2-CE 3.5Å; D52-K82 WeakPolarHBondContact OD2-CG 3.24Å; K82-S84 VanDerWaalsContact C-N 3.35Å; K82-S84 PolarHBondContact O-N 3.3Å
83	G	70.2	Confident	72.8	Confident	82 Å²	82	87 Å²	87	85%	0.845	47%	0.468	S	S	*	.	T	Hydrogen-bonded Turn	trans	79.8	3.1	176.7	0	0	0	0	0	116.5	R81	R81-G83 PolarHBondContact O-N 3.47Å
84	S	68.8	Low	72.6	Confident	26 Å²	26	93 Å²	93	18%	0.182	49%	0.486	C	S	.	.			trans	-92.7	137.7	178.8	61.9	0	0	0	0	112.6	N80 R81 K82 V103	N80-S84 PolarHBondContact ND2-O 2.81Å; N80-S84 PolarHBondContact ND2-OG 2.8Å; N80-S84 VanDerWaalsContact ND2-OG 3.16Å; N80-S84 PolarHBondContact OD1-OG 2.81Å; R81-S84 PolarHBondContact O-N 2.96Å; R81-S84 VanDerWaalsContact O-N 3.11Å; R81-S84 PolarHBondContact O-OG 3.03Å; K82-S84 VanDerWaalsContact C-N 3.35Å; K82-S84 PolarHBondContact O-N 3.3Å; S84-V103 VanDerWaalsContact CB-CG1 3.47Å; S84-V103 WeakPolarHBondContact OG-CG1 2.81Å
85	T	67.9	Low	72.3	Confident	101 Å²	101	100.1 Å²	100.1	62%	0.62	51%	0.51	S	S	*	.			trans	-90.2	115	-174.9	-46.9	0	0	0	0	109.2	R104	T85-R104 PolarHBondContact N-O 2.96Å; T85-R104 PolarHBondContact O-N 3.02Å
86	Q	73.4	Confident	71.6	Confident	34 Å²	34	101.5 Å²	101.5	16%	0.159	51%	0.513	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.8	131.6	178.6	-77.6	-169.3	72.6	0	0	112.3	N80 K102 V103	N80-Q86 PolarHBondContact ND2-NE2 3.12Å; N80-Q86 PolarHBondContact OD1-NE2 2.85Å; N80-Q86 VanDerWaalsContact OD1-NE2 3.1Å; Q86-K102 WeakPolarHBondContact CA-O 3.28Å; Q86-V103 HydrophobicContact CG-CG2 4.12Å
87	K	74.8	Confident	71.1	Confident	133 Å²	133	96.8 Å²	96.8	58%	0.578	50%	0.495	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-112.6	114.2	170	-143	173.4	-172.6	177.2	0	108.6	K102	K87-K102 HydrophobicContact CB-CB 4.4Å; K87-K102 PolarHBondContact N-O 3.26Å; K87-K102 PolarHBondContact O-N 3.47Å
88	V	75.9	Confident	70.6	Confident	38 Å²	38	94.7 Å²	94.7	23%	0.23	48%	0.477	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.9	134.5	174.3	-165.3	0	0	0	0	108.9	T47 L54 L56 I99 L101	T47-V88 HydrophobicContact CG2-CB 3.94Å; T47-V88 HydrophobicContact CG2-CG1 3.78Å; T47-V88 HydrophobicContact CG2-CG2 3.87Å; L54-V88 HydrophobicContact CD1-CG2 3.77Å; L54-V88 HydrophobicContact CD2-CG2 3.65Å; L54-V88 HydrophobicContact CG-CG2 4.33Å; L56-V88 HydrophobicContact CD1-CG1 4.21Å; V88-I99 HydrophobicContact CG1-CG2 3.74Å; V88-L101 HydrophobicContact CB-CD2 3.92Å; V88-L101 HydrophobicContact CG1-CD2 3.67Å; V88-L101 HydrophobicContact CG2-CD2 3.44Å; V88-L101 VanDerWaalsContact CG2-CD2 3.44Å
89	S	77.9	Confident	70.4	Confident	56 Å²	56	92.3 Å²	92.3	39%	0.392	47%	0.468	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-136.8	141.5	168.1	56.8	0	0	0	0	108.7	I100	S89-I100 PolarHBondContact N-O 3.04Å; S89-I100 PolarHBondContact O-N 2.88Å; S89-I100 PolarHBondContact OG-O 2.77Å
90	S	73.9	Confident	70.3	Confident	66 Å²	66	87.8 Å²	87.8	46%	0.462	44%	0.436	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.4	146.3	173.6	58	0	0	0	0	110	C98	S90-C98 CarbonylContact C-O 3.53Å; S90-C98 WeakPolarHBondContact CA-O 2.92Å
91	R	72.9	Confident	70.3	Confident	181 Å²	181	86.8 Å²	86.8	68%	0.683	43%	0.431	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-133.6	123.6	172	-79.3	-171.8	178.4	-168	-1.1	109.2	C98	R91-C98 PolarHBondContact N-O 3.06Å; R91-C98 PolarHBondContact O-N 2.75Å
92	T	66.9	Low	70.4	Confident	69 Å²	69	81.7 Å²	81.7	42%	0.423	41%	0.414	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.9	128.9	172.9	-47.9	0	0	0	0	109	A42 M96 I97	A42-T92 HydrophobicContact CB-CG2 4.11Å; A42-T92 WeakPolarHBondContact CB-OG1 3.5Å; T92-M96 CarbonylContact C-O 3.54Å; T92-M96 WeakPolarHBondContact CA-O 3.38Å; T92-I97 HydrophobicContact CG2-CG1 3.98Å
93	C	54.4	Low	70.3	Confident	93 Å²	93	74.5 Å²	74.5	63%	0.628	39%	0.385	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-136.8	118.2	177.5	-160.1	0	0	0	0	111.4	R95 M96	C93-R95 VanDerWaalsContact C-N 3.31Å; C93-R95 PolarHBondContact O-N 2.81Å; C93-M96 PolarHBondContact N-O 3.28Å; C93-M96 PolarHBondContact O-N 2.67Å
94	R	70.1	Confident	70	Confident	228 Å²	228	81.2 Å²	81.2	86%	0.86	39%	0.385	S	S	*	.	T	Hydrogen-bonded Turn	trans	43.5	-78.1	-174.1	-72	-172.7	-176	-179.4	2.1	115.3	R37	R37-R94 WeakPolarHBondContact CD-O 3.34Å; R37-R94 PolarHBondContact NH1-O 2.91Å
95	R	68.4	Low	70.1	Confident	194 Å²	194	84 Å²	84	73%	0.732	40%	0.395	S	S	*	.	T	Hydrogen-bonded Turn	trans	-125.7	10.9	-175.2	-66.6	-173.8	-175.9	163.7	0.3	113.5	R37 C93	R37-R95 VanDerWaalsContact CB-C 3.49Å; R37-R95 WeakPolarHBondContact CB-O 3.24Å; R37-R95 PolarHBondContact N-O 2.74Å; C93-R95 VanDerWaalsContact C-N 3.31Å; C93-R95 PolarHBondContact O-N 2.81Å
96	M	65.5	Low	70.2	Confident	98 Å²	98	83.1 Å²	83.1	48%	0.483	38%	0.383	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.3	145.7	178.3	-77.9	-176	-84	0	0	112.6	Y34 F35 T92 C93	Y34-M96 HydrophobicContact CD1-SD 4.42Å; F35-M96 CarbonylContact O-C 3.59Å; F35-M96 WeakPolarHBondContact O-CA 3.34Å; F35-M96 WeakPolarHBondContact O-CB 3.4Å; T92-M96 CarbonylContact C-O 3.54Å; T92-M96 WeakPolarHBondContact CA-O 3.38Å; C93-M96 PolarHBondContact N-O 3.28Å; C93-M96 PolarHBondContact O-N 2.67Å
97	I	68.9	Low	70	Confident	4 Å²	4	85.8 Å²	85.8	2%	0.021	40%	0.395	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.4	122.1	164	-67.2	166	0	0	0	106.7	Y34 F35 L40 A42 T92 I99	Y34-I97 CarbonylContact C-O 3.58Å; Y34-I97 WeakPolarHBondContact CA-O 3.46Å; F35-I97 HydrophobicContact CB-CB 4.41Å; F35-I97 PolarHBondContact N-O 2.74Å; F35-I97 PolarHBondContact O-N 2.76Å; L40-I97 HydrophobicContact CB-CD1 3.64Å; L40-I97 VanDerWaalsContact O-CD1 3.3Å; L40-I97 WeakPolarHBondContact O-CD1 3.19Å; A42-I97 HydrophobicContact CB-CD1 4.26Å; T92-I97 HydrophobicContact CG2-CG1 3.98Å; I97-I99 HydrophobicContact CG2-CG1 4.19Å
98	C	70.7	Confident	69.8	Low	12 Å²	12	83.1 Å²	83.1	8%	0.081	39%	0.385	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.1	113.4	174.8	-172.6	0	0	0	0	108.5	H33 Y34 S90 R91	H33-C98 CarbonylContact O-C 3.57Å; H33-C98 VanDerWaalsContact O-CA 3.31Å; H33-C98 WeakPolarHBondContact O-CA 3.48Å; Y34-C98 HydrophobicContact CD1-CB 3.78Å; Y34-C98 HydrophobicContact CE1-CB 3.75Å; Y34-C98 WeakPolarHBondContact CE1-SG 3.35Å; S90-C98 CarbonylContact C-O 3.53Å; S90-C98 WeakPolarHBondContact CA-O 2.92Å; R91-C98 PolarHBondContact N-O 3.06Å; R91-C98 PolarHBondContact O-N 2.75Å
99	I	72.7	Confident	69.4	Low	1 Å²	1	85.9 Å²	85.9	1%	0.005	39%	0.394	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.3	125.8	170.7	-54.9	-171	0	0	0	107.8	R32 H33 F35 L45 L56 V88 I97	R32-I99 CarbonylContact C-O 3.52Å; R32-I99 VanDerWaalsContact CA-O 3.31Å; R32-I99 WeakPolarHBondContact CA-O 3.23Å; H33-I99 HydrophobicContact CB-CB 4.47Å; H33-I99 PolarHBondContact N-O 3.05Å; H33-I99 PolarHBondContact O-N 2.71Å; F35-I99 HydrophobicContact CD2-CD1 4.16Å; F35-I99 HydrophobicContact CD2-CG1 4.25Å; F35-I99 HydrophobicContact CE2-CD1 3.57Å; F35-I99 HydrophobicContact CE2-CG1 3.99Å; F35-I99 HydrophobicContact CZ-CD1 4.49Å; L45-I99 HydrophobicContact CD1-CD1 3.74Å; L45-I99 HydrophobicContact CD2-CD1 3.69Å; L45-I99 HydrophobicContact CD2-CG1 4.2Å; L45-I99 HydrophobicContact CG-CD1 4.39Å; L56-I99 HydrophobicContact CD1-CD1 3.77Å; L56-I99 HydrophobicContact CD1-CG2 3.78Å; L56-I99 HydrophobicContact CD2-CD1 3.46Å; L56-I99 VanDerWaalsContact CD2-CD1 3.46Å; L56-I99 HydrophobicContact CG-CD1 4.14Å; V88-I99 HydrophobicContact CG1-CG2 3.74Å; I97-I99 HydrophobicContact CG2-CG1 4.19Å
100	I	73.3	Confident	68.8	Low	15 Å²	15	87.9 Å²	87.9	8%	0.077	40%	0.395	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.9	115.6	-179.4	-53.3	177.1	0	0	0	107.6	V30 F31 R32 S89	V30-I100 HydrophobicContact CG1-CG2 3.4Å; F31-I100 WeakPolarHBondContact O-CA 3.25Å; R32-I100 HydrophobicContact CG-CG1 4.25Å; S89-I100 PolarHBondContact N-O 3.04Å; S89-I100 PolarHBondContact O-N 2.88Å; S89-I100 PolarHBondContact OG-O 2.77Å
101	L	70.8	Confident	68.4	Low	4 Å²	4	89.4 Å²	89.4	2%	0.021	39%	0.39	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.7	119.3	174.8	-66.3	172.3	0	0	0	109.2	V30 F31 L54 Y78 V88	V30-L101 CarbonylContact C-O 3.56Å; V30-L101 VanDerWaalsContact CA-O 3.28Å; V30-L101 WeakPolarHBondContact CA-O 3.47Å; F31-L101 HydrophobicContact CB-CB 4.12Å; F31-L101 PolarHBondContact N-O 2.9Å; F31-L101 PolarHBondContact O-N 3.46Å; L54-L101 HydrophobicContact CD2-CD1 3.92Å; L54-L101 HydrophobicContact CD2-CD2 3.11Å; L54-L101 HydrophobicContact CD2-CG 4.15Å; Y78-L101 HydrophobicContact CD1-CD1 4.33Å; Y78-L101 HydrophobicContact CD2-CD1 4.01Å; Y78-L101 HydrophobicContact CE2-CD1 4.2Å; Y78-L101 HydrophobicContact CG-CD1 4.08Å; V88-L101 HydrophobicContact CB-CD2 3.92Å; V88-L101 HydrophobicContact CG1-CD2 3.67Å; V88-L101 HydrophobicContact CG2-CD2 3.44Å; V88-L101 VanDerWaalsContact CG2-CD2 3.44Å
102	K	71.9	Confident	68.1	Low	108 Å²	108	82.4 Å²	82.4	47%	0.47	37%	0.367	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.7	116.3	172	-95.7	170.9	177.4	174.7	0	109.1	V30 Q86 K87	V30-K102 HydrophobicContact CG1-CG 4.37Å; V30-K102 HydrophobicContact CG2-CD 4.48Å; V30-K102 HydrophobicContact CG2-CG 3.71Å; Q86-K102 WeakPolarHBondContact CA-O 3.28Å; K87-K102 HydrophobicContact CB-CB 4.4Å; K87-K102 PolarHBondContact N-O 3.26Å; K87-K102 PolarHBondContact O-N 3.47Å
103	V	66.8	Low	68.2	Low	21 Å²	21	83.5 Å²	83.5	13%	0.127	36%	0.363	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.3	120.8	171	-171.6	0	0	0	0	107.8	A28 P29 S84 Q86	A28-V103 VanDerWaalsContact CB-O 3.25Å; A28-V103 WeakPolarHBondContact CB-O 3.43Å; P29-V103 HydrophobicContact CG-CB 4.15Å; P29-V103 HydrophobicContact CG-CG2 4.48Å; P29-V103 PolarHBondContact O-N 2.83Å; S84-V103 VanDerWaalsContact CB-CG1 3.47Å; S84-V103 WeakPolarHBondContact OG-CG1 2.81Å; Q86-V103 HydrophobicContact CG-CG2 4.12Å
104	R	64.9	Low	69.4	Low	224 Å²	224	82.6 Å²	82.6	85%	0.845	34%	0.338	S	S	*	.			trans	-101.4	0	171.8	-74.1	-174.1	177.4	-177.3	-4.4	110.9	T85	T85-R104 PolarHBondContact N-O 2.96Å; T85-R104 PolarHBondContact O-N 3.02Å

Retrieved 104 of 104 residues in 27.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).