A0A077ZLV4_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZLV4, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 142 aa.

						>A0A077ZLV4_TRITR|A0A077ZLV4
MREVELLTDSATVHRWIEDGLSGRTRLRTKAANGMLIRLRVETVLSLVKEYNLKLAVTLVRSAMNKADALTRVPTKWLAAEPVHQLTCAAVDDPSNKRFITQVHHDAGHPGVRRTLYFVRRRGEGAPTEGYGGEEIHAVSVE
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	77.9	Confident	93.3	Very high	152 Å²	152	92 Å²	92	75%	0.749	47%	0.467	S	S	*	.				0	122.4	0	-173.2	173.4	-127.2	0	0	107.3	N52 K54	M1-N52 WeakPolarHBondContact CA-O 3.46Å; M1-K54 HydrophobicContact CE-CB 4.11Å; M1-K54 HydrophobicContact CG-CB 3.93Å; M1-K54 HydrophobicContact SD-CB 3.88Å; M1-K54 HydrophobicContact SD-CD 4.27Å
2	R	91	Very high	93.2	Very high	203 Å²	203	90.8 Å²	90.8	77%	0.766	47%	0.467	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-94.6	132.9	176.7	-67	-179.3	179.8	-179.4	0.2	108.4	L53 K54	R2-L53 HydrophobicContact CB-CD2 3.94Å; R2-L53 WeakPolarHBondContact O-CA 3.49Å; R2-K54 PolarHBondContact O-N 3.09Å
3	E	94.9	Very high	93.1	Very high	144 Å²	144	87.6 Å²	87.6	67%	0.673	46%	0.455	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-88.2	130.4	175.7	-55.2	-162.2	147.1	0	0	109.1	K54	E3-K54 HydrophobicContact CG-CB 4.32Å; E3-K54 HydrophobicContact CG-CD 4.2Å; E3-K54 WeakPolarHBondContact OE1-CD 3.48Å; E3-K54 IonicContact OE1-NZ 2.76Å; E3-K54 PolarHBondContact OE1-NZ 3.4Å
4	V	95.7	Very high	93.2	Very high	62 Å²	62	84.7 Å²	84.7	38%	0.376	44%	0.438	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.6	130.9	-179.2	-179.7	0	0	0	0	108.1	L53 K54 L55 A56	V4-L53 HydrophobicContact CG2-CD1 4.43Å; V4-L53 HydrophobicContact CG2-CD2 4.15Å; V4-K54 PolarHBondContact N-O 3.42Å; V4-L55 HydrophobicContact CB-CD1 4.2Å; V4-L55 HydrophobicContact CG1-CD1 4.03Å; V4-L55 WeakPolarHBondContact O-CA 3.32Å; V4-A56 PolarHBondContact O-N 2.98Å
5	E	95.4	Very high	93.1	Very high	120 Å²	120	88.5 Å²	88.5	56%	0.561	44%	0.444	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-109	123.5	173.6	-169.9	179.7	-164.6	0	0	109.7	L7 A56 T58	E5-L7 HydrophobicContact CG-CD2 3.95Å; E5-A56 WeakPolarHBondContact CA-O 3.29Å; E5-T58 PolarHBondContact OE1-OG1 3.36Å
6	L	94.5	Very high	93	Very high	72 Å²	72	85.9 Å²	85.9	38%	0.377	43%	0.428	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.9	116.7	174.3	-178.5	69.5	0	0	0	109.4	L55 A56 V57 T58	L6-L55 HydrophobicContact CB-CD1 4.01Å; L6-A56 PolarHBondContact N-O 3.3Å; L6-V57 HydrophobicContact CB-CG1 4.46Å; L6-V57 HydrophobicContact CD2-CG1 4.3Å; L6-V57 CarbonylContact O-C 3.54Å; L6-V57 WeakPolarHBondContact O-CA 3.3Å; L6-T58 PolarHBondContact O-N 3.35Å
7	L	95.8	Very high	93	Very high	86 Å²	86	81.4 Å²	81.4	45%	0.45	41%	0.405	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.2	127.5	175.6	-54	178.6	0	0	0	109.4	E5 T58 V60	E5-L7 HydrophobicContact CG-CD2 3.95Å; L7-T58 HydrophobicContact CD2-CG2 4.29Å; L7-V60 HydrophobicContact CB-CG1 4.22Å; L7-V60 HydrophobicContact CB-CG2 4.37Å; L7-V60 HydrophobicContact CD2-CG1 4.09Å
8	T	95.7	Very high	93	Very high	18 Å²	18	80.9 Å²	80.9	11%	0.11	40%	0.401	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.1	145.3	175.6	-173.2	0	0	0	0	110.5	S10 H14 V57 T58 L59 V60	T8-S10 PolarHBondContact OG1-N 3.44Å; T8-H14 HydrophobicContact CG2-CB 3.79Å; T8-V57 HydrophobicContact CG2-CG1 4.13Å; T8-T58 PolarHBondContact N-O 2.83Å; T8-L59 CarbonylContact O-C 3.58Å; T8-L59 VanDerWaalsContact O-CA 3.3Å; T8-L59 WeakPolarHBondContact O-CA 3.3Å; T8-L59 WeakPolarHBondContact O-CD1 3.46Å; T8-V60 PolarHBondContact O-N 3.26Å
9	D	96.2	Very high	92.9	Very high	53 Å²	53	78.2 Å²	78.2	28%	0.283	39%	0.389	S	S	.	.	S	Bend	trans	-97.1	-2.2	171.5	65.6	-24.4	0	0	0	113.3	A11 V60 S62 N65	D9-A11 PolarHBondContact O-N 3.21Å; D9-V60 VanDerWaalsContact CA-O 3.25Å; D9-V60 WeakPolarHBondContact CA-O 3.39Å; D9-V60 HydrophobicContact CB-CG2 4.42Å; D9-V60 WeakPolarHBondContact CB-O 3.25Å; D9-S62 WeakPolarHBondContact OD2-CA 3.48Å; D9-S62 VanDerWaalsContact OD2-CB 3.25Å; D9-S62 WeakPolarHBondContact OD2-CB 3.24Å; D9-S62 PolarHBondContact OD2-OG 3.05Å; D9-N65 HydrophobicContact CB-CB 4.17Å; D9-N65 PolarHBondContact OD1-ND2 3.03Å
10	S	94.4	Very high	92.8	Very high	42 Å²	42	75.2 Å²	75.2	29%	0.294	38%	0.378	S	S	.	.			trans	-90.6	105.8	175.5	178	0	0	0	0	110.5	T8 T12 V13 H14	T8-S10 PolarHBondContact OG1-N 3.44Å; S10-T12 PolarHBondContact O-N 2.83Å; S10-V13 PolarHBondContact O-N 2.94Å; S10-V13 VanDerWaalsContact O-N 3.09Å; S10-V13 WeakPolarHBondContact OG-CG2 3.46Å; S10-V13 PolarHBondContact OG-N 3.25Å; S10-H14 WeakPolarHBondContact O-CB 3.5Å; S10-H14 PolarHBondContact O-N 2.82Å
11	A	94.6	Very high	92.7	Very high	60 Å²	60	74.4 Å²	74.4	50%	0.496	38%	0.375	S	S	.	.	H	α-helix	trans	-55.5	-35	175.4	0	0	0	0	0	112.4	D9 R15 L59	D9-A11 PolarHBondContact O-N 3.21Å; A11-R15 WeakPolarHBondContact O-CB 3.34Å; A11-R15 PolarHBondContact O-N 3.27Å; A11-L59 HydrophobicContact CB-CD1 4.32Å; A11-L59 HydrophobicContact CB-CD2 4.16Å
12	T	92	Very high	93.2	Very high	77 Å²	77	69.2 Å²	69.2	47%	0.472	35%	0.354	S	S	.	.	H	α-helix	trans	-66.9	-45.1	177.2	-55.9	0	0	0	0	111.7	S10 R15 W16	S10-T12 PolarHBondContact O-N 2.83Å; T12-R15 PolarHBondContact O-N 3.48Å; T12-W16 HydrophobicContact CG2-CD2 4.06Å; T12-W16 HydrophobicContact CG2-CE3 4.36Å; T12-W16 HydrophobicContact CG2-CH2 3.68Å; T12-W16 HydrophobicContact CG2-CZ2 3.33Å; T12-W16 HydrophobicContact CG2-CZ3 4.19Å; T12-W16 VanDerWaalsContact O-CG 3.3Å; T12-W16 PolarHBondContact O-N 2.92Å
13	V	92.4	Very high	92.9	Very high	50 Å²	50	62.7 Å²	62.7	30%	0.303	35%	0.349	S	S	.	.	H	α-helix	trans	-67.8	-44.2	178.3	173.3	0	0	0	0	110.5	S10 R15 W16 I17	S10-V13 PolarHBondContact O-N 2.94Å; S10-V13 VanDerWaalsContact O-N 3.09Å; S10-V13 WeakPolarHBondContact OG-CG2 3.46Å; S10-V13 PolarHBondContact OG-N 3.25Å; V13-R15 VanDerWaalsContact C-N 3.3Å; V13-R15 PolarHBondContact O-N 2.86Å; V13-W16 HydrophobicContact CG2-CE3 4.38Å; V13-W16 HydrophobicContact CG2-CZ3 4.45Å; V13-W16 PolarHBondContact O-N 3.34Å; V13-W16 VanDerWaalsContact O-N 3.09Å; V13-I17 HydrophobicContact CG1-CG1 4.28Å; V13-I17 WeakPolarHBondContact O-CG1 3.23Å; V13-I17 PolarHBondContact O-N 3.45Å
14	H	94.2	Very high	91.8	Very high	47 Å²	47	64.9 Å²	64.9	22%	0.218	35%	0.351	C	S	.	.	H	α-helix	trans	-50.2	-53.1	173.2	176.9	-84.2	0	0	0	110.7	T8 S10 W16 I17 E18 V57 L59	T8-H14 HydrophobicContact CG2-CB 3.79Å; S10-H14 WeakPolarHBondContact O-CB 3.5Å; S10-H14 PolarHBondContact O-N 2.82Å; H14-W16 VanDerWaalsContact C-N 3.34Å; H14-W16 PolarHBondContact O-N 3.44Å; H14-I17 PolarHBondContact O-N 3.43Å; H14-E18 VanDerWaalsContact O-CB 3.22Å; H14-E18 WeakPolarHBondContact O-CB 3.22Å; H14-E18 PolarHBondContact O-N 3.09Å; H14-V57 PolarHBondContact NE2-O 2.97Å; H14-L59 HydrophobicContact CB-CD1 4.31Å; H14-L59 PolarHBondContact CD2-N 3.16Å
15	R	91.8	Very high	90.5	Very high	142 Å²	142	65.2 Å²	65.2	54%	0.536	35%	0.354	S	S	.	.	H	α-helix	trans	-58.8	-43	178.3	-162.9	-174.7	88.5	175.2	2.4	112.4	A11 T12 V13 D19	A11-R15 WeakPolarHBondContact O-CB 3.34Å; A11-R15 PolarHBondContact O-N 3.27Å; T12-R15 PolarHBondContact O-N 3.48Å; V13-R15 VanDerWaalsContact C-N 3.3Å; V13-R15 PolarHBondContact O-N 2.86Å; R15-D19 IonicContact NE-OD2 3.71Å; R15-D19 VanDerWaalsContact O-CB 3.23Å; R15-D19 WeakPolarHBondContact O-CB 3.48Å; R15-D19 PolarHBondContact O-N 3.09Å
16	W	91.8	Very high	89.4	Confident	47 Å²	47	69.7 Å²	69.7	18%	0.178	37%	0.366	C	S	.	.	H	α-helix	trans	-64.5	-41.8	-178.7	-69.2	-19.3	0	0	0	113.5	T12 V13 H14 G20 L27 I37 V41	T12-W16 HydrophobicContact CG2-CD2 4.06Å; T12-W16 HydrophobicContact CG2-CE3 4.36Å; T12-W16 HydrophobicContact CG2-CH2 3.68Å; T12-W16 HydrophobicContact CG2-CZ2 3.33Å; T12-W16 HydrophobicContact CG2-CZ3 4.19Å; T12-W16 VanDerWaalsContact O-CG 3.3Å; T12-W16 PolarHBondContact O-N 2.92Å; V13-W16 HydrophobicContact CG2-CE3 4.38Å; V13-W16 HydrophobicContact CG2-CZ3 4.45Å; V13-W16 PolarHBondContact O-N 3.34Å; V13-W16 VanDerWaalsContact O-N 3.09Å; H14-W16 VanDerWaalsContact C-N 3.34Å; H14-W16 PolarHBondContact O-N 3.44Å; W16-G20 PolarHBondContact O-N 3.43Å; W16-G20 VanDerWaalsContact O-N 3.09Å; W16-L27 HydrophobicContact CB-CD2 3.65Å; W16-L27 VanDerWaalsContact CD1-CD2 3.46Å; W16-L27 HydrophobicContact CG-CD2 3.7Å; W16-I37 HydrophobicContact CD2-CG2 3.88Å; W16-I37 HydrophobicContact CE3-CG2 3.5Å; W16-I37 HydrophobicContact CH2-CD1 3.58Å; W16-I37 HydrophobicContact CH2-CG1 4.1Å; W16-I37 HydrophobicContact CH2-CG2 3.68Å; W16-I37 HydrophobicContact CZ2-CD1 4.2Å; W16-I37 HydrophobicContact CZ2-CG2 4.02Å; W16-I37 HydrophobicContact CZ3-CB 4.43Å; W16-I37 HydrophobicContact CZ3-CD1 4.16Å; W16-I37 HydrophobicContact CZ3-CG1 4.16Å; W16-I37 HydrophobicContact CZ3-CG2 3.41Å; W16-I37 VanDerWaalsContact CZ3-CG2 3.41Å; W16-V41 HydrophobicContact CB-CG2 4.21Å
17	I	93.5	Very high	88.5	Confident	8 Å²	8	67.2 Å²	67.2	4%	0.041	35%	0.353	C	S	.	.	H	α-helix	trans	-72.8	-42.6	178.3	-54.6	-59.1	0	0	0	110.2	V13 H14 D19 G20 L21 V41 V44 L55 V57	V13-I17 HydrophobicContact CG1-CG1 4.28Å; V13-I17 WeakPolarHBondContact O-CG1 3.23Å; V13-I17 PolarHBondContact O-N 3.45Å; H14-I17 PolarHBondContact O-N 3.43Å; I17-D19 PolarHBondContact O-N 3.05Å; I17-G20 PolarHBondContact O-N 3.02Å; I17-G20 VanDerWaalsContact O-N 3.16Å; I17-L21 HydrophobicContact CG2-CD1 3.84Å; I17-L21 HydrophobicContact CG2-CG 4.1Å; I17-L21 WeakPolarHBondContact O-CB 3.34Å; I17-L21 WeakPolarHBondContact O-CG 3.41Å; I17-L21 PolarHBondContact O-N 2.92Å; I17-V41 HydrophobicContact CD1-CB 4.39Å; I17-V41 HydrophobicContact CD1-CG1 3.92Å; I17-V41 HydrophobicContact CD1-CG2 3.97Å; I17-V44 HydrophobicContact CD1-CB 4.4Å; I17-V44 HydrophobicContact CD1-CG1 4.34Å; I17-V44 HydrophobicContact CD1-CG2 4.4Å; I17-L55 HydrophobicContact CG2-CD2 4.32Å; I17-V57 HydrophobicContact CB-CG2 4.05Å; I17-V57 HydrophobicContact CG2-CG2 3.5Å
18	E	93.2	Very high	87.3	Confident	73 Å²	73	73.7 Å²	73.7	34%	0.341	37%	0.371	S	S	.	.	H	α-helix	trans	-59.4	-46.3	176.6	-170.1	70.3	-159.8	0	0	111.9	H14 G20 L21 S22	H14-E18 VanDerWaalsContact O-CB 3.22Å; H14-E18 WeakPolarHBondContact O-CB 3.22Å; H14-E18 PolarHBondContact O-N 3.09Å; E18-G20 VanDerWaalsContact C-N 3.3Å; E18-G20 PolarHBondContact O-N 3.35Å; E18-L21 PolarHBondContact O-N 2.9Å; E18-S22 VanDerWaalsContact O-CB 3.24Å; E18-S22 WeakPolarHBondContact O-CB 3.45Å; E18-S22 PolarHBondContact O-N 3.36Å; E18-S22 PolarHBondContact O-OG 3.37Å
19	D	90.6	Very high	86.2	Confident	30 Å²	30	74.1 Å²	74.1	16%	0.16	37%	0.374	C	S	.	.	H	α-helix	trans	-61.9	-39.5	175.4	-74.7	-19.4	0	0	0	111.3	R15 I17 S22 G23	R15-D19 IonicContact NE-OD2 3.71Å; R15-D19 VanDerWaalsContact O-CB 3.23Å; R15-D19 WeakPolarHBondContact O-CB 3.48Å; R15-D19 PolarHBondContact O-N 3.09Å; I17-D19 PolarHBondContact O-N 3.05Å; D19-S22 PolarHBondContact O-OG 3.4Å; D19-G23 PolarHBondContact O-N 3.36Å
20	G	90.1	Very high	85.3	Confident	18 Å²	18	82 Å²	82	19%	0.186	41%	0.406	C	S	.	.	H	α-helix	trans	-67	-45.7	178	0	0	0	0	0	113.2	W16 I17 E18 G23	W16-G20 PolarHBondContact O-N 3.43Å; W16-G20 VanDerWaalsContact O-N 3.09Å; I17-G20 PolarHBondContact O-N 3.02Å; I17-G20 VanDerWaalsContact O-N 3.16Å; E18-G20 VanDerWaalsContact C-N 3.3Å; E18-G20 PolarHBondContact O-N 3.35Å; G20-G23 PolarHBondContact O-N 2.91Å
21	L	91.4	Very high	84.4	Confident	59 Å²	59	82.4 Å²	82.4	31%	0.309	41%	0.411	S	S	.	.	H	α-helix	trans	-69.3	-39.8	179.1	-71.6	173.7	0	0	0	112	I17 E18 G23 L45 V48 L55 V57	I17-L21 HydrophobicContact CG2-CD1 3.84Å; I17-L21 HydrophobicContact CG2-CG 4.1Å; I17-L21 WeakPolarHBondContact O-CB 3.34Å; I17-L21 WeakPolarHBondContact O-CG 3.41Å; I17-L21 PolarHBondContact O-N 2.92Å; E18-L21 PolarHBondContact O-N 2.9Å; L21-G23 PolarHBondContact O-N 2.76Å; L21-L45 HydrophobicContact CD2-CD2 3.66Å; L21-L45 HydrophobicContact CG-CD2 4.05Å; L21-V48 HydrophobicContact CD2-CG1 4.3Å; L21-V48 HydrophobicContact CD2-CG2 4.42Å; L21-L55 HydrophobicContact CD1-CB 4.31Å; L21-L55 HydrophobicContact CD1-CD2 4.06Å; L21-L55 HydrophobicContact CD1-CG 4.12Å; L21-L55 HydrophobicContact CD2-CB 4.46Å; L21-L55 HydrophobicContact CD2-CD2 4.33Å; L21-V57 HydrophobicContact CD1-CG2 3.92Å
22	S	88.6	Confident	83.6	Confident	43 Å²	43	84.7 Å²	84.7	30%	0.301	43%	0.43	S	S	.	.	H	α-helix	trans	-73	-13.8	179.4	65	0	0	0	0	113.4	E18 D19 R24	E18-S22 VanDerWaalsContact O-CB 3.24Å; E18-S22 WeakPolarHBondContact O-CB 3.45Å; E18-S22 PolarHBondContact O-N 3.36Å; E18-S22 PolarHBondContact O-OG 3.37Å; D19-S22 PolarHBondContact O-OG 3.4Å; S22-R24 PolarHBondContact O-N 2.84Å; S22-R24 WeakPolarHBondContact OG-CG 3.3Å
23	G	84.2	Confident	83.2	Confident	65 Å²	65	86.1 Å²	86.1	67%	0.67	44%	0.435	S	S	*	.			trans	64.5	5.3	-176.2	0	0	0	0	0	114.2	D19 G20 L21 T25	D19-G23 PolarHBondContact O-N 3.36Å; G20-G23 PolarHBondContact O-N 2.91Å; L21-G23 PolarHBondContact O-N 2.76Å; G23-T25 PolarHBondContact O-N 3.49Å
24	R	72.2	Confident	82.9	Confident	190 Å²	190	83.8 Å²	83.8	72%	0.717	42%	0.421	S	S	*	.	S	Bend	trans	-69.6	-32.9	-171.8	-69.2	179.1	-163.1	146.9	5.7	112.5	S22	S22-R24 PolarHBondContact O-N 2.84Å; S22-R24 WeakPolarHBondContact OG-CG 3.3Å
25	T	67	Low	82.6	Confident	70 Å²	70	88.9 Å²	88.9	43%	0.429	45%	0.447	S	S	.	.			trans	-146.1	125	-172.9	-49.6	0	0	0	0	111.4	G23 L27	G23-T25 PolarHBondContact O-N 3.49Å; T25-L27 PolarHBondContact O-N 2.7Å
26	R	72.5	Confident	82.5	Confident	213 Å²	213	86.7 Å²	86.7	80%	0.804	45%	0.445	S	S	*	.			trans	-61.2	123.4	164.1	-173.4	177.3	-179	-164.6	0.8	108.6	R28	R26-R28 PolarHBondContact O-N 3.25Å
27	L	75.9	Confident	82.4	Confident	20 Å²	20	86 Å²	86	11%	0.105	45%	0.445	C	S	.	.			trans	-49.3	106.3	-177.3	-75.1	166.1	0	0	0	113.3	W16 T25 R38 V41	W16-L27 HydrophobicContact CB-CD2 3.65Å; W16-L27 VanDerWaalsContact CD1-CD2 3.46Å; W16-L27 HydrophobicContact CG-CD2 3.7Å; T25-L27 PolarHBondContact O-N 2.7Å; L27-R38 HydrophobicContact CB-CG 4.04Å; L27-R38 PolarHBondContact O-NH1 2.81Å; L27-R38 VanDerWaalsContact O-NH1 3.1Å; L27-V41 HydrophobicContact CD1-CB 3.48Å; L27-V41 VanDerWaalsContact CD1-CB 3.48Å; L27-V41 HydrophobicContact CD1-CG1 3.58Å; L27-V41 HydrophobicContact CD1-CG2 3.65Å
28	R	70.8	Confident	82.2	Confident	223 Å²	223	89.2 Å²	89.2	84%	0.842	46%	0.456	S	S	*	.			trans	-98	98.6	172.5	-72.2	-175.3	171.1	-168.1	-2.7	109.3	R26	R26-R28 PolarHBondContact O-N 3.25Å
29	T	72.3	Confident	82.1	Confident	26 Å²	26	90.6 Å²	90.6	16%	0.16	47%	0.465	C	S	.	.			trans	-117	136.1	170	175.6	0	0	0	0	110.2	A31 G34 I37	T29-A31 WeakPolarHBondContact OG1-CB 3.47Å; T29-A31 PolarHBondContact OG1-N 3.1Å; T29-G34 VanDerWaalsContact CG2-CA 3.49Å; T29-I37 HydrophobicContact CG2-CB 4.48Å
30	K	77.4	Confident	82.2	Confident	220 Å²	220	98 Å²	98	96%	0.957	49%	0.491	S	S	*	.			trans	-94.5	6.2	174.9	-66.9	-173.5	177.4	-178.1	0	112.7
31	A	76.8	Confident	82.3	Confident	50 Å²	50	97.5 Å²	97.5	41%	0.413	48%	0.484	S	S	.	.	S	Bend	trans	-63.5	146.6	178.9	0	0	0	0	0	110.8	T29 N33 G34 I37	T29-A31 WeakPolarHBondContact OG1-CB 3.47Å; T29-A31 PolarHBondContact OG1-N 3.1Å; A31-N33 PolarHBondContact O-N 3.21Å; A31-N33 VanDerWaalsContact O-N 3.15Å; A31-G34 WeakPolarHBondContact O-CA 3.41Å; A31-G34 PolarHBondContact O-N 2.95Å; A31-I37 HydrophobicContact CB-CD1 4.11Å
32	A	77.8	Confident	82.4	Confident	108 Å²	108	99.7 Å²	99.7	89%	0.893	49%	0.493	S	S	*	.	T	Hydrogen-bonded Turn	trans	-52.4	-37.7	175.5	0	0	0	0	0	111.8	G34	A32-G34 VanDerWaalsContact C-N 3.34Å; A32-G34 PolarHBondContact O-N 3.01Å
33	N	82.1	Confident	82.7	Confident	107 Å²	107	101 Å²	101	57%	0.572	50%	0.5	S	S	*	.	T	Hydrogen-bonded Turn	trans	-95	24.2	177	-62.9	-18.1	0	0	0	113.1	A31 M35 L36 I37	A31-N33 PolarHBondContact O-N 3.21Å; A31-N33 VanDerWaalsContact O-N 3.15Å; N33-M35 PolarHBondContact O-N 3.31Å; N33-L36 HydrophobicContact CB-CD1 4.25Å; N33-L36 WeakPolarHBondContact O-CB 3.44Å; N33-L36 PolarHBondContact O-N 3.34Å; N33-I37 PolarHBondContact O-N 3.2Å
34	G	85.9	Confident	83.2	Confident	1 Å²	1	100.1 Å²	100.1	1%	0.01	48%	0.481	C	S	.	.	H	α-helix	trans	-60.6	-30.1	-173	0	0	0	0	0	114.3	T29 A31 A32 R38	T29-G34 VanDerWaalsContact CG2-CA 3.49Å; A31-G34 WeakPolarHBondContact O-CA 3.41Å; A31-G34 PolarHBondContact O-N 2.95Å; A32-G34 VanDerWaalsContact C-N 3.34Å; A32-G34 PolarHBondContact O-N 3.01Å; G34-R38 PolarHBondContact O-N 3.09Å; G34-R38 VanDerWaalsContact O-N 3.14Å
35	M	87.9	Confident	84.2	Confident	154 Å²	154	93.6 Å²	93.6	76%	0.759	46%	0.46	S	S	*	.	H	α-helix	trans	-65.2	-42.2	173.6	-171	-179.8	-71.3	0	0	111.9	N33 I37 R38 L39	N33-M35 PolarHBondContact O-N 3.31Å; M35-I37 VanDerWaalsContact C-N 3.34Å; M35-I37 PolarHBondContact O-N 2.87Å; M35-R38 PolarHBondContact O-N 3.27Å; M35-L39 PolarHBondContact O-N 3.14Å
36	L	91	Very high	85.6	Confident	96 Å²	96	93.5 Å²	93.5	50%	0.503	46%	0.462	S	S	.	.	H	α-helix	trans	-65.4	-38.2	177.7	-65.1	176.5	0	0	0	111.9	N33 L39 R40	N33-L36 HydrophobicContact CB-CD1 4.25Å; N33-L36 WeakPolarHBondContact O-CB 3.44Å; N33-L36 PolarHBondContact O-N 3.34Å; L36-L39 PolarHBondContact O-N 3.12Å; L36-R40 VanDerWaalsContact O-CG 3.32Å; L36-R40 WeakPolarHBondContact O-CG 3.37Å; L36-R40 PolarHBondContact O-N 3.14Å
37	I	89.2	Confident	86.7	Confident	33 Å²	33	86.7 Å²	86.7	17%	0.169	44%	0.441	C	S	.	.	H	α-helix	trans	-62.5	-46.1	176.1	-67.3	161	0	0	0	110.3	W16 T29 A31 N33 M35 L39 R40 V41	W16-I37 HydrophobicContact CD2-CG2 3.88Å; W16-I37 HydrophobicContact CE3-CG2 3.5Å; W16-I37 HydrophobicContact CH2-CD1 3.58Å; W16-I37 HydrophobicContact CH2-CG1 4.1Å; W16-I37 HydrophobicContact CH2-CG2 3.68Å; W16-I37 HydrophobicContact CZ2-CD1 4.2Å; W16-I37 HydrophobicContact CZ2-CG2 4.02Å; W16-I37 HydrophobicContact CZ3-CB 4.43Å; W16-I37 HydrophobicContact CZ3-CD1 4.16Å; W16-I37 HydrophobicContact CZ3-CG1 4.16Å; W16-I37 HydrophobicContact CZ3-CG2 3.41Å; W16-I37 VanDerWaalsContact CZ3-CG2 3.41Å; T29-I37 HydrophobicContact CG2-CB 4.48Å; A31-I37 HydrophobicContact CB-CD1 4.11Å; N33-I37 PolarHBondContact O-N 3.2Å; M35-I37 VanDerWaalsContact C-N 3.34Å; M35-I37 PolarHBondContact O-N 2.87Å; I37-L39 PolarHBondContact O-N 3.36Å; I37-R40 PolarHBondContact O-N 3.48Å; I37-V41 WeakPolarHBondContact O-CG2 3.46Å; I37-V41 PolarHBondContact O-N 2.88Å; I37-V41 VanDerWaalsContact O-N 3.08Å
38	R	89.1	Confident	87.6	Confident	75 Å²	75	86.9 Å²	86.9	28%	0.283	44%	0.443	S	S	.	.	H	α-helix	trans	-58.4	-48.2	176.9	-78.2	-175.5	-87.4	-101.5	-0.2	111.8	L27 G34 M35 R40 V41 E42	L27-R38 HydrophobicContact CB-CG 4.04Å; L27-R38 PolarHBondContact O-NH1 2.81Å; L27-R38 VanDerWaalsContact O-NH1 3.1Å; G34-R38 PolarHBondContact O-N 3.09Å; G34-R38 VanDerWaalsContact O-N 3.14Å; M35-R38 PolarHBondContact O-N 3.27Å; R38-R40 VanDerWaalsContact C-N 3.32Å; R38-R40 PolarHBondContact O-N 2.81Å; R38-V41 PolarHBondContact O-N 2.94Å; R38-E42 WeakPolarHBondContact O-CG 3.49Å; R38-E42 PolarHBondContact O-N 3.05Å
39	L	91.4	Very high	88.7	Confident	101 Å²	101	85 Å²	85	53%	0.529	44%	0.441	S	S	.	.	H	α-helix	trans	-57.9	-44.7	178.2	-175	66.6	0	0	0	111.8	M35 L36 I37 V41 E42 T43	M35-L39 PolarHBondContact O-N 3.14Å; L36-L39 PolarHBondContact O-N 3.12Å; I37-L39 PolarHBondContact O-N 3.36Å; L39-V41 PolarHBondContact O-N 2.99Å; L39-E42 PolarHBondContact O-N 3.15Å; L39-T43 PolarHBondContact O-N 2.82Å; L39-T43 PolarHBondContact O-OG1 3.2Å
40	R	93.6	Very high	89.9	Confident	186 Å²	186	90.2 Å²	90.2	70%	0.702	46%	0.464	S	S	*	.	H	α-helix	trans	-63.1	-40.2	178.9	-73.2	176.8	-179.1	-144.8	0.2	112.7	L36 I37 R38 T43 V44	L36-R40 VanDerWaalsContact O-CG 3.32Å; L36-R40 WeakPolarHBondContact O-CG 3.37Å; L36-R40 PolarHBondContact O-N 3.14Å; I37-R40 PolarHBondContact O-N 3.48Å; R38-R40 VanDerWaalsContact C-N 3.32Å; R38-R40 PolarHBondContact O-N 2.81Å; R40-T43 WeakPolarHBondContact O-CB 3.48Å; R40-T43 PolarHBondContact O-N 2.9Å; R40-V44 PolarHBondContact O-N 3.47Å
41	V	92.1	Very high	90.8	Very high	8 Å²	8	86.7 Å²	86.7	5%	0.048	45%	0.445	C	S	.	.	H	α-helix	trans	-69.9	-40.5	176.3	179.8	0	0	0	0	110.9	W16 I17 L27 I37 R38 L39 T43 V44 L45	W16-V41 HydrophobicContact CB-CG2 4.21Å; I17-V41 HydrophobicContact CD1-CB 4.39Å; I17-V41 HydrophobicContact CD1-CG1 3.92Å; I17-V41 HydrophobicContact CD1-CG2 3.97Å; L27-V41 HydrophobicContact CD1-CB 3.48Å; L27-V41 VanDerWaalsContact CD1-CB 3.48Å; L27-V41 HydrophobicContact CD1-CG1 3.58Å; L27-V41 HydrophobicContact CD1-CG2 3.65Å; I37-V41 WeakPolarHBondContact O-CG2 3.46Å; I37-V41 PolarHBondContact O-N 2.88Å; I37-V41 VanDerWaalsContact O-N 3.08Å; R38-V41 PolarHBondContact O-N 2.94Å; L39-V41 PolarHBondContact O-N 2.99Å; V41-T43 VanDerWaalsContact C-N 3.26Å; V41-T43 PolarHBondContact O-N 3.22Å; V41-V44 WeakPolarHBondContact O-CB 3.44Å; V41-V44 PolarHBondContact O-N 3.04Å; V41-V44 VanDerWaalsContact O-N 3.08Å; V41-L45 HydrophobicContact CG1-CD1 4.28Å; V41-L45 HydrophobicContact CG1-CG 4.3Å; V41-L45 WeakPolarHBondContact O-CG 3.25Å; V41-L45 PolarHBondContact O-N 3.44Å
42	E	93.1	Very high	91.6	Very high	104 Å²	104	89 Å²	89	49%	0.486	45%	0.451	S	S	.	.	H	α-helix	trans	-58.5	-38.5	174.5	-75.6	171.4	-172.2	0	0	111.9	R38 L39 L45 S46	R38-E42 WeakPolarHBondContact O-CG 3.49Å; R38-E42 PolarHBondContact O-N 3.05Å; L39-E42 PolarHBondContact O-N 3.15Å; E42-L45 PolarHBondContact O-N 3.48Å; E42-S46 WeakPolarHBondContact O-CB 3.42Å; E42-S46 PolarHBondContact O-N 3.38Å; E42-S46 PolarHBondContact O-OG 3.36Å
43	T	95.4	Very high	92.4	Very high	72 Å²	72	85.7 Å²	85.7	44%	0.442	42%	0.418	S	S	.	.	H	α-helix	trans	-58.6	-49.2	171.9	-54	0	0	0	0	111.4	L39 R40 V41 L45 S46 L47	L39-T43 PolarHBondContact O-N 2.82Å; L39-T43 PolarHBondContact O-OG1 3.2Å; R40-T43 WeakPolarHBondContact O-CB 3.48Å; R40-T43 PolarHBondContact O-N 2.9Å; V41-T43 VanDerWaalsContact C-N 3.26Å; V41-T43 PolarHBondContact O-N 3.22Å; T43-L45 VanDerWaalsContact C-N 3.34Å; T43-L45 PolarHBondContact O-N 2.94Å; T43-S46 WeakPolarHBondContact O-CB 3.43Å; T43-S46 PolarHBondContact O-N 2.74Å; T43-L47 HydrophobicContact CG2-CD1 4.16Å; T43-L47 HydrophobicContact CG2-CG 4.47Å; T43-L47 VanDerWaalsContact O-CG 3.29Å; T43-L47 WeakPolarHBondContact O-CG 3.49Å; T43-L47 PolarHBondContact O-N 3.3Å
44	V	94	Very high	93	Very high	46 Å²	46	86 Å²	86	28%	0.279	41%	0.414	S	S	.	.	H	α-helix	trans	-57.9	-46.5	177.9	176.4	0	0	0	0	111.1	I17 R40 V41 S46 L47 V48 L55	I17-V44 HydrophobicContact CD1-CB 4.4Å; I17-V44 HydrophobicContact CD1-CG1 4.34Å; I17-V44 HydrophobicContact CD1-CG2 4.4Å; R40-V44 PolarHBondContact O-N 3.47Å; V41-V44 WeakPolarHBondContact O-CB 3.44Å; V41-V44 PolarHBondContact O-N 3.04Å; V41-V44 VanDerWaalsContact O-N 3.08Å; V44-S46 VanDerWaalsContact C-N 3.31Å; V44-S46 PolarHBondContact O-N 2.87Å; V44-L47 PolarHBondContact O-N 3.47Å; V44-V48 VanDerWaalsContact O-CG2 3.32Å; V44-V48 WeakPolarHBondContact O-CG2 3.39Å; V44-V48 PolarHBondContact O-N 3.04Å; V44-L55 HydrophobicContact CG1-CD2 4.03Å
45	L	93.7	Very high	93.5	Very high	52 Å²	52	87.4 Å²	87.4	27%	0.272	42%	0.421	S	S	.	.	H	α-helix	trans	-63.6	-37.2	178.6	-62.2	178.2	0	0	0	112.5	L21 V41 E42 T43 V48 K49	L21-L45 HydrophobicContact CD2-CD2 3.66Å; L21-L45 HydrophobicContact CG-CD2 4.05Å; V41-L45 HydrophobicContact CG1-CD1 4.28Å; V41-L45 HydrophobicContact CG1-CG 4.3Å; V41-L45 WeakPolarHBondContact O-CG 3.25Å; V41-L45 PolarHBondContact O-N 3.44Å; E42-L45 PolarHBondContact O-N 3.48Å; T43-L45 VanDerWaalsContact C-N 3.34Å; T43-L45 PolarHBondContact O-N 2.94Å; L45-V48 PolarHBondContact O-N 3.27Å; L45-K49 PolarHBondContact O-N 3.45Å; L45-K49 VanDerWaalsContact O-N 3.09Å
46	S	95.3	Very high	93.9	Very high	68 Å²	68	82.5 Å²	82.5	48%	0.476	41%	0.405	S	S	.	.	H	α-helix	trans	-64.9	-44	177.2	-58.1	0	0	0	0	110.9	E42 T43 V44 K49 E50	E42-S46 WeakPolarHBondContact O-CB 3.42Å; E42-S46 PolarHBondContact O-N 3.38Å; E42-S46 PolarHBondContact O-OG 3.36Å; T43-S46 WeakPolarHBondContact O-CB 3.43Å; T43-S46 PolarHBondContact O-N 2.74Å; V44-S46 VanDerWaalsContact C-N 3.31Å; V44-S46 PolarHBondContact O-N 2.87Å; S46-K49 PolarHBondContact O-N 3.34Å; S46-E50 VanDerWaalsContact O-CB 3.3Å; S46-E50 WeakPolarHBondContact O-CB 3.46Å; S46-E50 PolarHBondContact O-N 2.97Å
47	L	96.1	Very high	94.1	Very high	70 Å²	70	78.6 Å²	78.6	37%	0.366	39%	0.385	S	S	.	.	H	α-helix	trans	-64.2	-42	176	-63.7	169.6	0	0	0	111.9	T43 V44 K49 E50 Y51	T43-L47 HydrophobicContact CG2-CD1 4.16Å; T43-L47 HydrophobicContact CG2-CG 4.47Å; T43-L47 VanDerWaalsContact O-CG 3.29Å; T43-L47 WeakPolarHBondContact O-CG 3.49Å; T43-L47 PolarHBondContact O-N 3.3Å; V44-L47 PolarHBondContact O-N 3.47Å; L47-K49 VanDerWaalsContact C-N 3.26Å; L47-K49 PolarHBondContact O-N 3.44Å; L47-E50 PolarHBondContact O-N 3.08Å; L47-Y51 HydrophobicContact CB-CD2 4.24Å; L47-Y51 HydrophobicContact CB-CE2 4.49Å; L47-Y51 HydrophobicContact CD2-CD2 4.29Å; L47-Y51 HydrophobicContact CD2-CE2 3.7Å; L47-Y51 WeakPolarHBondContact O-CB 3.4Å; L47-Y51 VanDerWaalsContact O-CD2 3.3Å; L47-Y51 WeakPolarHBondContact O-CD2 3.39Å; L47-Y51 PolarHBondContact O-N 3.22Å
48	V	94.7	Very high	94.4	Very high	24 Å²	24	79.4 Å²	79.4	15%	0.145	39%	0.392	C	S	.	.	H	α-helix	trans	-57.4	-43.2	175.7	170.2	0	0	0	0	110.9	L21 V44 L45 N52 L53 L55	L21-V48 HydrophobicContact CD2-CG1 4.3Å; L21-V48 HydrophobicContact CD2-CG2 4.42Å; V44-V48 VanDerWaalsContact O-CG2 3.32Å; V44-V48 WeakPolarHBondContact O-CG2 3.39Å; V44-V48 PolarHBondContact O-N 3.04Å; L45-V48 PolarHBondContact O-N 3.27Å; V48-N52 WeakPolarHBondContact O-CA 3.36Å; V48-N52 PolarHBondContact O-N 3.29Å; V48-L53 HydrophobicContact CG1-CB 4.41Å; V48-L53 WeakPolarHBondContact CG1-O 3.5Å; V48-L53 PolarHBondContact O-N 3.08Å; V48-L55 HydrophobicContact CG1-CB 4.4Å; V48-L55 HydrophobicContact CG2-CB 3.83Å; V48-L55 HydrophobicContact CG2-CD2 3.54Å; V48-L55 HydrophobicContact CG2-CG 4.3Å
49	K	94.3	Very high	94.8	Very high	183 Å²	183	79.9 Å²	79.9	80%	0.796	40%	0.4	S	S	*	.	H	α-helix	trans	-69.1	-47.8	177.4	-175.2	-179.7	178.2	-177.1	0	112.3	L45 S46 L47 N52	L45-K49 PolarHBondContact O-N 3.45Å; L45-K49 VanDerWaalsContact O-N 3.09Å; S46-K49 PolarHBondContact O-N 3.34Å; L47-K49 VanDerWaalsContact C-N 3.26Å; L47-K49 PolarHBondContact O-N 3.44Å; K49-N52 PolarHBondContact O-N 3.25Å
50	E	96.3	Very high	95.1	Very high	137 Å²	137	76.1 Å²	76.1	64%	0.64	38%	0.381	S	S	*	.	H	α-helix	trans	-62.5	-46.4	-176.5	-175.5	179	166	0	0	111.9	S46 L47 N52	S46-E50 VanDerWaalsContact O-CB 3.3Å; S46-E50 WeakPolarHBondContact O-CB 3.46Å; S46-E50 PolarHBondContact O-N 2.97Å; L47-E50 PolarHBondContact O-N 3.08Å; E50-N52 VanDerWaalsContact C-N 3.3Å; E50-N52 PolarHBondContact O-N 3.42Å
51	Y	96	Very high	95.3	Very high	145 Å²	145	76.9 Å²	76.9	57%	0.569	38%	0.384	S	S	*	.	T	Hydrogen-bonded Turn	trans	-87.9	4.3	-179.6	-66	-69.9	0	0	0	113.8	L47 L53	L47-Y51 HydrophobicContact CB-CD2 4.24Å; L47-Y51 HydrophobicContact CB-CE2 4.49Å; L47-Y51 HydrophobicContact CD2-CD2 4.29Å; L47-Y51 HydrophobicContact CD2-CE2 3.7Å; L47-Y51 WeakPolarHBondContact O-CB 3.4Å; L47-Y51 VanDerWaalsContact O-CD2 3.3Å; L47-Y51 WeakPolarHBondContact O-CD2 3.39Å; L47-Y51 PolarHBondContact O-N 3.22Å; Y51-L53 VanDerWaalsContact C-N 3.31Å; Y51-L53 PolarHBondContact O-N 3.18Å
52	N	94.4	Very high	95.3	Very high	98 Å²	98	80 Å²	80	52%	0.524	41%	0.406	S	S	.	.	T	Hydrogen-bonded Turn	trans	47.9	52.9	-177.6	-169.6	22.7	0	0	0	112.2	M1 V48 K49 E50	M1-N52 WeakPolarHBondContact CA-O 3.46Å; V48-N52 WeakPolarHBondContact O-CA 3.36Å; V48-N52 PolarHBondContact O-N 3.29Å; K49-N52 PolarHBondContact O-N 3.25Å; E50-N52 VanDerWaalsContact C-N 3.3Å; E50-N52 PolarHBondContact O-N 3.42Å
53	L	95.3	Very high	95.3	Very high	39 Å²	39	80.2 Å²	80.2	20%	0.204	43%	0.425	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90	143.8	-178.2	-55	177.5	0	0	0	110.5	R2 V4 V48 Y51	R2-L53 HydrophobicContact CB-CD2 3.94Å; R2-L53 WeakPolarHBondContact O-CA 3.49Å; V4-L53 HydrophobicContact CG2-CD1 4.43Å; V4-L53 HydrophobicContact CG2-CD2 4.15Å; V48-L53 HydrophobicContact CG1-CB 4.41Å; V48-L53 WeakPolarHBondContact CG1-O 3.5Å; V48-L53 PolarHBondContact O-N 3.08Å; Y51-L53 VanDerWaalsContact C-N 3.31Å; Y51-L53 PolarHBondContact O-N 3.18Å
54	K	95.2	Very high	95.2	Very high	114 Å²	114	82.6 Å²	82.6	50%	0.496	43%	0.433	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.5	94.5	161.9	-175.7	176.5	166.7	-161.3	0	107.4	M1 R2 E3 V4	M1-K54 HydrophobicContact CE-CB 4.11Å; M1-K54 HydrophobicContact CG-CB 3.93Å; M1-K54 HydrophobicContact SD-CB 3.88Å; M1-K54 HydrophobicContact SD-CD 4.27Å; R2-K54 PolarHBondContact O-N 3.09Å; E3-K54 HydrophobicContact CG-CB 4.32Å; E3-K54 HydrophobicContact CG-CD 4.2Å; E3-K54 WeakPolarHBondContact OE1-CD 3.48Å; E3-K54 IonicContact OE1-NZ 2.76Å; E3-K54 PolarHBondContact OE1-NZ 3.4Å; V4-K54 PolarHBondContact N-O 3.42Å
55	L	95.4	Very high	95.2	Very high	30 Å²	30	81.8 Å²	81.8	16%	0.157	43%	0.427	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.6	124.4	-178.6	-177	63.4	0	0	0	110.4	V4 L6 I17 L21 V44 V48 V57	V4-L55 HydrophobicContact CB-CD1 4.2Å; V4-L55 HydrophobicContact CG1-CD1 4.03Å; V4-L55 WeakPolarHBondContact O-CA 3.32Å; L6-L55 HydrophobicContact CB-CD1 4.01Å; I17-L55 HydrophobicContact CG2-CD2 4.32Å; L21-L55 HydrophobicContact CD1-CB 4.31Å; L21-L55 HydrophobicContact CD1-CD2 4.06Å; L21-L55 HydrophobicContact CD1-CG 4.12Å; L21-L55 HydrophobicContact CD2-CB 4.46Å; L21-L55 HydrophobicContact CD2-CD2 4.33Å; V44-L55 HydrophobicContact CG1-CD2 4.03Å; V48-L55 HydrophobicContact CG1-CB 4.4Å; V48-L55 HydrophobicContact CG2-CB 3.83Å; V48-L55 HydrophobicContact CG2-CD2 3.54Å; V48-L55 HydrophobicContact CG2-CG 4.3Å; L55-V57 HydrophobicContact CG-CG2 4.48Å
56	A	95.4	Very high	95.1	Very high	52 Å²	52	88 Å²	88	43%	0.43	45%	0.452	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.1	147.1	165.3	0	0	0	0	0	109.5	V4 E5 L6	V4-A56 PolarHBondContact O-N 2.98Å; E5-A56 WeakPolarHBondContact CA-O 3.29Å; L6-A56 PolarHBondContact N-O 3.3Å
57	V	95.4	Very high	95	Very high	13 Å²	13	87 Å²	87	8%	0.079	45%	0.448	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.5	128.1	177.3	-164.7	0	0	0	0	108.8	L6 T8 H14 I17 L21 L55	L6-V57 HydrophobicContact CB-CG1 4.46Å; L6-V57 HydrophobicContact CD2-CG1 4.3Å; L6-V57 CarbonylContact O-C 3.54Å; L6-V57 WeakPolarHBondContact O-CA 3.3Å; T8-V57 HydrophobicContact CG2-CG1 4.13Å; H14-V57 PolarHBondContact NE2-O 2.97Å; I17-V57 HydrophobicContact CB-CG2 4.05Å; I17-V57 HydrophobicContact CG2-CG2 3.5Å; L21-V57 HydrophobicContact CD1-CG2 3.92Å; L55-V57 HydrophobicContact CG-CG2 4.48Å
58	T	96.9	Very high	94.7	Very high	51 Å²	51	86.1 Å²	86.1	31%	0.313	44%	0.443	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.2	126	-177.2	-54.9	0	0	0	0	109.6	E5 L6 L7 T8 V60	E5-T58 PolarHBondContact OE1-OG1 3.36Å; L6-T58 PolarHBondContact O-N 3.35Å; L7-T58 HydrophobicContact CD2-CG2 4.29Å; T8-T58 PolarHBondContact N-O 2.83Å; T58-V60 HydrophobicContact CG2-CG1 4.42Å; T58-V60 PolarHBondContact O-N 2.94Å
59	L	97.7	Very high	94.3	Very high	85 Å²	85	88.5 Å²	88.5	45%	0.445	47%	0.466	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.1	119.1	173.2	-175.5	62.8	0	0	0	110	T8 A11 H14	T8-L59 CarbonylContact O-C 3.58Å; T8-L59 VanDerWaalsContact O-CA 3.3Å; T8-L59 WeakPolarHBondContact O-CA 3.3Å; T8-L59 WeakPolarHBondContact O-CD1 3.46Å; A11-L59 HydrophobicContact CB-CD1 4.32Å; A11-L59 HydrophobicContact CB-CD2 4.16Å; H14-L59 HydrophobicContact CB-CD1 4.31Å; H14-L59 PolarHBondContact CD2-N 3.16Å
60	V	97.1	Very high	94	Very high	21 Å²	21	87.2 Å²	87.2	13%	0.127	47%	0.467	C	S	.	.			trans	-113	159.3	178.2	-62.1	0	0	0	0	111.2	L7 T8 D9 T58 M64 N65	L7-V60 HydrophobicContact CB-CG1 4.22Å; L7-V60 HydrophobicContact CB-CG2 4.37Å; L7-V60 HydrophobicContact CD2-CG1 4.09Å; T8-V60 PolarHBondContact O-N 3.26Å; D9-V60 VanDerWaalsContact CA-O 3.25Å; D9-V60 WeakPolarHBondContact CA-O 3.39Å; D9-V60 HydrophobicContact CB-CG2 4.42Å; D9-V60 WeakPolarHBondContact CB-O 3.25Å; T58-V60 HydrophobicContact CG2-CG1 4.42Å; T58-V60 PolarHBondContact O-N 2.94Å; V60-M64 HydrophobicContact CB-CB 4.37Å; V60-N65 HydrophobicContact CG2-CB 4.49Å
61	R	96.6	Very high	93.6	Very high	203 Å²	203	85.8 Å²	85.8	77%	0.766	47%	0.467	S	S	*	.			trans	-68	146.1	170.4	-63.6	-178.2	-176	170	1.9	109.2	A63 M64 N65	R61-A63 PolarHBondContact O-N 3.31Å; R61-A63 VanDerWaalsContact O-N 3.12Å; R61-M64 WeakPolarHBondContact O-CA 3.37Å; R61-M64 WeakPolarHBondContact O-CB 3.3Å; R61-M64 PolarHBondContact O-N 2.75Å; R61-N65 PolarHBondContact O-N 3.46Å
62	S	93.5	Very high	93.2	Very high	74 Å²	74	86.6 Å²	86.6	52%	0.517	47%	0.469	S	S	.	.	G	3₁₀ helix	trans	-54.3	-35.3	178.5	-61.6	0	0	0	0	113.7	D9 M64 N65	D9-S62 WeakPolarHBondContact OD2-CA 3.48Å; D9-S62 VanDerWaalsContact OD2-CB 3.25Å; D9-S62 WeakPolarHBondContact OD2-CB 3.24Å; D9-S62 PolarHBondContact OD2-OG 3.05Å; S62-M64 PolarHBondContact O-N 3.11Å; S62-M64 VanDerWaalsContact O-N 3.14Å; S62-N65 WeakPolarHBondContact O-CB 3.26Å; S62-N65 PolarHBondContact O-N 3.07Å
63	A	92.4	Very high	92.8	Very high	107 Å²	107	85.6 Å²	85.6	88%	0.884	47%	0.467	S	S	*	.	G	3₁₀ helix	trans	-62.5	-19.3	174.9	0	0	0	0	0	114.2	R61	R61-A63 PolarHBondContact O-N 3.31Å; R61-A63 VanDerWaalsContact O-N 3.12Å
64	M	93.7	Very high	92.4	Very high	122 Å²	122	86.3 Å²	86.3	60%	0.601	47%	0.473	S	S	*	.	G	3₁₀ helix	trans	-100.9	-4.3	177.1	-65.3	177.1	50.6	0	0	112.9	V60 R61 S62 K66	V60-M64 HydrophobicContact CB-CB 4.37Å; R61-M64 WeakPolarHBondContact O-CA 3.37Å; R61-M64 WeakPolarHBondContact O-CB 3.3Å; R61-M64 PolarHBondContact O-N 2.75Å; S62-M64 PolarHBondContact O-N 3.11Å; S62-M64 VanDerWaalsContact O-N 3.14Å; M64-K66 PolarHBondContact O-N 3.03Å
65	N	93.4	Very high	91.9	Very high	30 Å²	30	86.4 Å²	86.4	16%	0.16	48%	0.484	C	S	.	.			trans	-74.6	92.9	178.1	-177.4	5.8	0	0	0	110.1	D9 V60 R61 S62 A67 D68	D9-N65 HydrophobicContact CB-CB 4.17Å; D9-N65 PolarHBondContact OD1-ND2 3.03Å; V60-N65 HydrophobicContact CG2-CB 4.49Å; R61-N65 PolarHBondContact O-N 3.46Å; S62-N65 WeakPolarHBondContact O-CB 3.26Å; S62-N65 PolarHBondContact O-N 3.07Å; N65-A67 PolarHBondContact O-N 3.15Å; N65-A67 VanDerWaalsContact O-N 3.15Å; N65-A67 VanDerWaalsContact OD1-CB 3.3Å; N65-A67 WeakPolarHBondContact OD1-CB 3.32Å; N65-A67 PolarHBondContact OD1-N 3.02Å; N65-A67 VanDerWaalsContact OD1-N 3.11Å; N65-D68 HydrophobicContact CB-CB 4.47Å; N65-D68 VanDerWaalsContact O-CB 3.26Å; N65-D68 WeakPolarHBondContact O-CB 3.43Å; N65-D68 PolarHBondContact O-N 3.05Å; N65-D68 VanDerWaalsContact O-N 3.07Å
66	K	91.6	Very high	91.5	Very high	183 Å²	183	92.7 Å²	92.7	80%	0.796	51%	0.51	S	S	*	.	H	α-helix	trans	-59.5	-25.4	179.1	-64.3	-178.2	-178.8	177.1	0	113.2	M64 D68	M64-K66 PolarHBondContact O-N 3.03Å; K66-D68 PolarHBondContact O-N 3.2Å
67	A	92.7	Very high	91	Very high	47 Å²	47	99 Å²	99	39%	0.388	52%	0.523	S	S	.	.	H	α-helix	trans	-68	-28	178.9	0	0	0	0	0	111.9	N65 A69 L70 T71	N65-A67 PolarHBondContact O-N 3.15Å; N65-A67 VanDerWaalsContact O-N 3.15Å; N65-A67 VanDerWaalsContact OD1-CB 3.3Å; N65-A67 WeakPolarHBondContact OD1-CB 3.32Å; N65-A67 PolarHBondContact OD1-N 3.02Å; N65-A67 VanDerWaalsContact OD1-N 3.11Å; A67-A69 VanDerWaalsContact C-N 3.31Å; A67-A69 PolarHBondContact O-N 2.72Å; A67-L70 CarbonylContact O-C 3.59Å; A67-L70 WeakPolarHBondContact O-CA 3.41Å; A67-L70 WeakPolarHBondContact O-CB 3.4Å; A67-L70 PolarHBondContact O-N 3.21Å; A67-T71 WeakPolarHBondContact O-CG2 3.31Å; A67-T71 PolarHBondContact O-N 3.04Å; A67-T71 PolarHBondContact O-OG1 3.34Å
68	D	89.9	Confident	90.4	Very high	51 Å²	51	104.1 Å²	104.1	27%	0.273	55%	0.549	S	S	.	.	H	α-helix	trans	-56.7	-46.1	179.6	-179.5	62.6	0	0	0	111.2	N65 K66 L70 T71 R72	N65-D68 HydrophobicContact CB-CB 4.47Å; N65-D68 VanDerWaalsContact O-CB 3.26Å; N65-D68 WeakPolarHBondContact O-CB 3.43Å; N65-D68 PolarHBondContact O-N 3.05Å; N65-D68 VanDerWaalsContact O-N 3.07Å; K66-D68 PolarHBondContact O-N 3.2Å; D68-L70 PolarHBondContact O-N 2.96Å; D68-T71 WeakPolarHBondContact CA-OG1 3.45Å; D68-T71 PolarHBondContact O-N 2.67Å; D68-T71 VanDerWaalsContact O-N 3.07Å; D68-T71 PolarHBondContact O-OG1 2.99Å; D68-R72 VanDerWaalsContact O-CG 3.31Å; D68-R72 WeakPolarHBondContact O-CG 3.49Å; D68-R72 PolarHBondContact O-N 3.41Å; D68-R72 IonicContact OD1-CZ 3.74Å; D68-R72 IonicContact OD1-NE 3.65Å; D68-R72 IonicContact OD1-NH2 3.41Å; D68-R72 PolarHBondContact OD1-NH2 3.42Å; D68-R72 IonicContact OD2-CZ 3.08Å; D68-R72 IonicContact OD2-NE 2.72Å; D68-R72 PolarHBondContact OD2-NE 3.07Å; D68-R72 IonicContact OD2-NH2 2.67Å; D68-R72 PolarHBondContact OD2-NH2 2.92Å
69	A	86.9	Confident	89.7	Confident	74 Å²	74	104.6 Å²	104.6	61%	0.612	56%	0.558	S	S	*	*	H	α-helix	trans	-59	-31.6	175.7	0	0	0	0	0	113.5	A67	A67-A69 VanDerWaalsContact C-N 3.31Å; A67-A69 PolarHBondContact O-N 2.72Å
70	L	87.9	Confident	88.5	Confident	156 Å²	156	104.8 Å²	104.8	82%	0.817	57%	0.572	S	S	*	*	H	α-helix	trans	-82.9	-25	178.4	-58.5	177.3	0	0	0	112.7	A67 D68	A67-L70 CarbonylContact O-C 3.59Å; A67-L70 WeakPolarHBondContact O-CA 3.41Å; A67-L70 WeakPolarHBondContact O-CB 3.4Å; A67-L70 PolarHBondContact O-N 3.21Å; D68-L70 PolarHBondContact O-N 2.96Å
71	T	88.1	Confident	87.2	Confident	107 Å²	107	111.2 Å²	111.2	66%	0.656	60%	0.6	S	S	*	*	H	α-helix	trans	-93.2	-11.4	-179.7	58.7	0	0	0	0	113.8	A67 D68	A67-T71 WeakPolarHBondContact O-CG2 3.31Å; A67-T71 PolarHBondContact O-N 3.04Å; A67-T71 PolarHBondContact O-OG1 3.34Å; D68-T71 WeakPolarHBondContact CA-OG1 3.45Å; D68-T71 PolarHBondContact O-N 2.67Å; D68-T71 VanDerWaalsContact O-N 3.07Å; D68-T71 PolarHBondContact O-OG1 2.99Å
72	R	88.1	Confident	85.5	Confident	162 Å²	162	106.1 Å²	106.1	61%	0.611	59%	0.594	S	S	*	*	S	Bend	trans	-68.2	136.2	178	-81.7	174.5	-172.2	-75.6	-7.1	111.1	D68 P74	D68-R72 VanDerWaalsContact O-CG 3.31Å; D68-R72 WeakPolarHBondContact O-CG 3.49Å; D68-R72 PolarHBondContact O-N 3.41Å; D68-R72 IonicContact OD1-CZ 3.74Å; D68-R72 IonicContact OD1-NE 3.65Å; D68-R72 IonicContact OD1-NH2 3.41Å; D68-R72 PolarHBondContact OD1-NH2 3.42Å; D68-R72 IonicContact OD2-CZ 3.08Å; D68-R72 IonicContact OD2-NE 2.72Å; D68-R72 PolarHBondContact OD2-NE 3.07Å; D68-R72 IonicContact OD2-NH2 2.67Å; D68-R72 PolarHBondContact OD2-NH2 2.92Å; R72-P74 WeakPolarHBondContact O-CD 3.47Å
73	V	86.5	Confident	83.8	Confident	77 Å²	77	108.7 Å²	108.7	47%	0.467	61%	0.606	S	S	.	*	P	Polyproline II helix	trans	-61.5	126.3	170.2	-179.5	0	0	0	0	108.3	T75 W77 L78	V73-T75 PolarHBondContact O-N 2.98Å; V73-W77 HydrophobicContact CG1-CB 3.89Å; V73-W77 HydrophobicContact CG1-CE3 4.07Å; V73-L78 HydrophobicContact CB-CD1 4.43Å; V73-L78 HydrophobicContact CB-CD2 4.24Å; V73-L78 HydrophobicContact CB-CG 4.27Å; V73-L78 HydrophobicContact CG1-CD2 3.79Å; V73-L78 HydrophobicContact CG1-CG 3.84Å
74	P	86.2	Confident	82	Confident	53 Å²	53	111 Å²	111	34%	0.344	60%	0.598	S	S	.	*	P	Polyproline II helix	trans	-53.1	132	175.4	-27.3	34.6	0	0	0	111	R72 K76 W77 L78	R72-P74 WeakPolarHBondContact O-CD 3.47Å; P74-K76 HydrophobicContact CB-CG 3.92Å; P74-K76 PolarHBondContact O-N 3.39Å; P74-K76 VanDerWaalsContact O-N 3.08Å; P74-W77 HydrophobicContact CB-CD2 4.24Å; P74-W77 HydrophobicContact CB-CG 4.16Å; P74-W77 HydrophobicContact CG-CD2 3.93Å; P74-W77 HydrophobicContact CG-CE3 4.18Å; P74-W77 HydrophobicContact CG-CG 4.38Å; P74-W77 HydrophobicContact CG-CZ2 4.37Å; P74-W77 HydrophobicContact CG-CZ3 4.48Å; P74-W77 WeakPolarHBondContact O-CA 3.5Å; P74-W77 WeakPolarHBondContact O-CB 3.46Å; P74-W77 PolarHBondContact O-N 2.81Å; P74-L78 PolarHBondContact O-N 3.19Å
75	T	84.9	Confident	79.8	Confident	117 Å²	117	113.1 Å²	113.1	72%	0.718	61%	0.607	S	S	*	*	H	α-helix	trans	-56.5	-32.4	-177.6	-46.9	0	0	0	0	112.6	V73 W77 L78 A79	V73-T75 PolarHBondContact O-N 2.98Å; T75-W77 PolarHBondContact O-N 3.08Å; T75-L78 CarbonylContact O-C 3.48Å; T75-L78 WeakPolarHBondContact O-CA 3.34Å; T75-L78 WeakPolarHBondContact O-CB 3.47Å; T75-L78 PolarHBondContact O-N 3.24Å; T75-A79 PolarHBondContact O-N 3.33Å
76	K	85.9	Confident	77.8	Confident	161 Å²	161	118.7 Å²	118.7	70%	0.7	64%	0.636	S	S	*	*	H	α-helix	trans	-60.1	-26.4	173.7	62.6	173.2	-176.8	178.4	0	113.9	P74	P74-K76 HydrophobicContact CB-CG 3.92Å; P74-K76 PolarHBondContact O-N 3.39Å; P74-K76 VanDerWaalsContact O-N 3.08Å
77	W	85.6	Confident	75.4	Confident	185 Å²	185	115.7 Å²	115.7	70%	0.701	63%	0.633	S	S	*	*	H	α-helix	trans	-84.5	-22	174.5	-61.8	-6.2	0	0	0	112.1	V73 P74 T75	V73-W77 HydrophobicContact CG1-CB 3.89Å; V73-W77 HydrophobicContact CG1-CE3 4.07Å; P74-W77 HydrophobicContact CB-CD2 4.24Å; P74-W77 HydrophobicContact CB-CG 4.16Å; P74-W77 HydrophobicContact CG-CD2 3.93Å; P74-W77 HydrophobicContact CG-CE3 4.18Å; P74-W77 HydrophobicContact CG-CG 4.38Å; P74-W77 HydrophobicContact CG-CZ2 4.37Å; P74-W77 HydrophobicContact CG-CZ3 4.48Å; P74-W77 WeakPolarHBondContact O-CA 3.5Å; P74-W77 WeakPolarHBondContact O-CB 3.46Å; P74-W77 PolarHBondContact O-N 2.81Å; T75-W77 PolarHBondContact O-N 3.08Å
78	L	83.9	Confident	73.3	Confident	121 Å²	121	118 Å²	118	63%	0.634	65%	0.645	S	S	*	*	H	α-helix	trans	-86.2	-15	172.6	-61.8	177.4	0	0	0	112.4	V73 P74 T75 A80	V73-L78 HydrophobicContact CB-CD1 4.43Å; V73-L78 HydrophobicContact CB-CD2 4.24Å; V73-L78 HydrophobicContact CB-CG 4.27Å; V73-L78 HydrophobicContact CG1-CD2 3.79Å; V73-L78 HydrophobicContact CG1-CG 3.84Å; P74-L78 PolarHBondContact O-N 3.19Å; T75-L78 CarbonylContact O-C 3.48Å; T75-L78 WeakPolarHBondContact O-CA 3.34Å; T75-L78 WeakPolarHBondContact O-CB 3.47Å; T75-L78 PolarHBondContact O-N 3.24Å; L78-A80 PolarHBondContact O-N 2.89Å
79	A	80.8	Confident	71.3	Confident	61 Å²	61	120 Å²	120	50%	0.504	67%	0.669	S	S	.	*	S	Bend	trans	-58.1	123.6	169.8	0	0	0	0	0	107.1	T75 E81	T75-A79 PolarHBondContact O-N 3.33Å; A79-E81 PolarHBondContact O-N 3Å
80	A	72.8	Confident	69.7	Low	89 Å²	89	120 Å²	120	74%	0.736	67%	0.669	S	S	*	*			trans	-54.9	118	166	0	0	0	0	0	106	L78	L78-A80 PolarHBondContact O-N 2.89Å
81	E	69.4	Low	67.8	Low	155 Å²	155	118.4 Å²	118.4	72%	0.724	67%	0.665	S	S	*	*			trans	-45.7	130.3	159.4	-80.1	-70.2	138.6	0	0	105.6	A79 V83	A79-E81 PolarHBondContact O-N 3Å; E81-V83 VanDerWaalsContact C-N 3.32Å; E81-V83 PolarHBondContact O-N 2.91Å
82	P	60.7	Low	66.5	Low	97 Å²	97	119.7 Å²	119.7	63%	0.63	67%	0.668	S	S	*	*			trans	-53.8	112.5	171.8	22.4	-28.4	0	0	0	104.1	H84	P82-H84 PolarHBondContact O-N 3.37Å
83	V	58.6	Low	65.5	Low	128 Å²	128	114.9 Å²	114.9	78%	0.776	66%	0.655	S	S	*	*			trans	-57.4	97	168.8	-178.7	0	0	0	0	101.8	E81 Q85	E81-V83 VanDerWaalsContact C-N 3.32Å; E81-V83 PolarHBondContact O-N 2.91Å; V83-Q85 PolarHBondContact O-N 3.29Å
84	H	54.6	Low	65	Low	154 Å²	154	115.1 Å²	115.1	71%	0.713	66%	0.658	S	S	*	*			trans	-51.4	110.1	151	-90.3	26.9	0	0	0	100.5	P82 L86	P82-H84 PolarHBondContact O-N 3.37Å; H84-L86 PolarHBondContact O-N 3.22Å
85	Q	48.1	Very low	64.6	Low	168 Å²	168	115.4 Å²	115.4	79%	0.785	66%	0.661	S	S	*	*			trans	-51.9	91.8	153.4	-82.2	175.7	-47.6	0	0	102.2	V83 T87	V83-Q85 PolarHBondContact O-N 3.29Å; Q85-T87 PolarHBondContact O-N 3.24Å
86	L	50.3	Low	64.5	Low	147 Å²	147	113.8 Å²	113.8	77%	0.77	65%	0.648	S	S	*	*			trans	-53.7	92.7	143.4	-81.2	158.2	0	0	0	100.3	H84 C88	H84-L86 PolarHBondContact O-N 3.22Å; L86-C88 PolarHBondContact O-N 2.91Å
87	T	42.7	Very low	64.4	Low	120 Å²	120	112.6 Å²	112.6	74%	0.736	64%	0.643	S	S	*	*			trans	-62	70.9	161.6	-56.7	0	0	0	0	103.6	Q85 A89	Q85-T87 PolarHBondContact O-N 3.24Å; T87-A89 PolarHBondContact O-N 3Å
88	C	47.6	Very low	64.5	Low	96 Å²	96	113 Å²	113	65%	0.649	64%	0.644	S	S	*	*			trans	-61.7	103.2	154.2	-66.9	0	0	0	0	101.5	L86 A90	L86-C88 PolarHBondContact O-N 2.91Å; C88-A90 PolarHBondContact O-N 3.12Å
89	A	47.8	Very low	64.8	Low	92 Å²	92	110.5 Å²	110.5	76%	0.76	63%	0.628	S	S	*	*			trans	-64.2	53.7	159	0	0	0	0	0	108.5	T87 V91	T87-A89 PolarHBondContact O-N 3Å; A89-V91 VanDerWaalsContact C-N 3.28Å; A89-V91 PolarHBondContact O-N 2.86Å
90	A	53.2	Low	65.2	Low	75 Å²	75	111.4 Å²	111.4	62%	0.62	62%	0.624	S	S	*	*			trans	-73.4	102.3	150.6	0	0	0	0	0	102.4	C88 D92	C88-A90 PolarHBondContact O-N 3.12Å; A90-D92 PolarHBondContact O-N 3.02Å
91	V	48.5	Very low	66.1	Low	122 Å²	122	110.3 Å²	110.3	74%	0.739	61%	0.608	S	S	*	*			trans	-35.8	110.1	160.7	-179.6	0	0	0	0	105.7	A89 D93	A89-V91 VanDerWaalsContact C-N 3.28Å; A89-V91 PolarHBondContact O-N 2.86Å; V91-D93 HydrophobicContact CG1-CB 4.29Å; V91-D93 PolarHBondContact O-N 3.21Å
92	D	61.5	Low	67.2	Low	134 Å²	134	108.2 Å²	108.2	72%	0.717	60%	0.598	S	S	*	*			trans	-71	64.4	177.7	-171.9	28.9	0	0	0	106.8	A90 P94	A90-D92 PolarHBondContact O-N 3.02Å; D92-P94 WeakPolarHBondContact O-CD 3.41Å
93	D	66.7	Low	68.7	Low	61 Å²	61	103.7 Å²	103.7	33%	0.326	57%	0.569	S	S	.	*			trans	-71.5	112.3	174.9	-177.4	-2.3	0	0	0	105.5	V91 S95 N96 K97	V91-D93 HydrophobicContact CG1-CB 4.29Å; V91-D93 PolarHBondContact O-N 3.21Å; D93-S95 PolarHBondContact O-N 3.45Å; D93-S95 WeakPolarHBondContact OD1-CB 3.2Å; D93-S95 PolarHBondContact OD1-N 3.04Å; D93-S95 PolarHBondContact OD1-OG 3.22Å; D93-S95 WeakPolarHBondContact OD2-CB 3.49Å; D93-S95 PolarHBondContact OD2-OG 3.33Å; D93-N96 HydrophobicContact CB-CB 4.39Å; D93-N96 WeakPolarHBondContact O-CB 3.43Å; D93-N96 PolarHBondContact O-N 3.22Å; D93-K97 PolarHBondContact O-N 2.85Å
94	P	75.1	Confident	70.4	Confident	82 Å²	82	100.1 Å²	100.1	53%	0.532	54%	0.544	S	S	.	.	H	α-helix	trans	-56	-21	176.9	23.3	-33.5	0	0	0	111.9	D92 R98	D92-P94 WeakPolarHBondContact O-CD 3.41Å; P94-R98 WeakPolarHBondContact O-CG 3.11Å; P94-R98 PolarHBondContact O-N 2.99Å; P94-R98 VanDerWaalsContact O-N 3.12Å
95	S	78.5	Confident	72.2	Confident	59 Å²	59	98 Å²	98	41%	0.413	53%	0.534	S	S	.	.	H	α-helix	trans	-64.7	-45.9	172.9	94.1	0	0	0	0	112.3	D93 K97 R98 F99	D93-S95 PolarHBondContact O-N 3.45Å; D93-S95 WeakPolarHBondContact OD1-CB 3.2Å; D93-S95 PolarHBondContact OD1-N 3.04Å; D93-S95 PolarHBondContact OD1-OG 3.22Å; D93-S95 WeakPolarHBondContact OD2-CB 3.49Å; D93-S95 PolarHBondContact OD2-OG 3.33Å; S95-K97 PolarHBondContact O-N 3.48Å; S95-R98 PolarHBondContact O-N 3.31Å; S95-F99 WeakPolarHBondContact O-CB 3.49Å; S95-F99 PolarHBondContact O-N 2.85Å
96	N	81.9	Confident	74.3	Confident	82 Å²	82	94.3 Å²	94.3	44%	0.439	52%	0.52	S	S	.	.	H	α-helix	trans	-64.4	-42.2	178.8	-74.9	-23.3	0	0	0	111.1	D93 F99 I100	D93-N96 HydrophobicContact CB-CB 4.39Å; D93-N96 WeakPolarHBondContact O-CB 3.43Å; D93-N96 PolarHBondContact O-N 3.22Å; N96-F99 PolarHBondContact O-N 2.88Å; N96-I100 WeakPolarHBondContact O-CB 3.3Å; N96-I100 WeakPolarHBondContact O-CD1 3.39Å; N96-I100 WeakPolarHBondContact O-CG1 3.41Å; N96-I100 PolarHBondContact O-N 2.76Å
97	K	84.5	Confident	76.2	Confident	137 Å²	137	89.1 Å²	89.1	60%	0.596	50%	0.498	S	S	*	.	H	α-helix	trans	-60.6	-47.8	176.8	-171.5	173.7	-176.5	172.9	0	111.3	D93 S95 F99 I100 T101	D93-K97 PolarHBondContact O-N 2.85Å; S95-K97 PolarHBondContact O-N 3.48Å; K97-F99 VanDerWaalsContact C-N 3.34Å; K97-F99 PolarHBondContact O-N 2.7Å; K97-I100 PolarHBondContact O-N 3.04Å; K97-T101 WeakPolarHBondContact O-CB 3.42Å; K97-T101 PolarHBondContact O-N 2.76Å; K97-T101 PolarHBondContact O-OG1 3.31Å
98	R	88.1	Confident	78.6	Confident	193 Å²	193	86 Å²	86	73%	0.728	49%	0.49	S	S	*	.	H	α-helix	trans	-60.7	-43.1	176.1	-74.9	176.7	-178.6	170.8	2.2	111.8	P94 S95 T101 Q102	P94-R98 WeakPolarHBondContact O-CG 3.11Å; P94-R98 PolarHBondContact O-N 2.99Å; P94-R98 VanDerWaalsContact O-N 3.12Å; S95-R98 PolarHBondContact O-N 3.31Å; R98-T101 PolarHBondContact O-N 3.24Å; R98-Q102 WeakPolarHBondContact O-CB 3.35Å; R98-Q102 PolarHBondContact O-N 3.33Å
99	F	88.9	Confident	80.6	Confident	68 Å²	68	86.5 Å²	86.5	30%	0.298	48%	0.482	S	S	.	.	H	α-helix	trans	-62.5	-48.6	178	-178.7	-110.5	0	0	0	112.1	S95 N96 K97 T101 Q102 V103 V119 R122	S95-F99 WeakPolarHBondContact O-CB 3.49Å; S95-F99 PolarHBondContact O-N 2.85Å; N96-F99 PolarHBondContact O-N 2.88Å; K97-F99 VanDerWaalsContact C-N 3.34Å; K97-F99 PolarHBondContact O-N 2.7Å; F99-T101 VanDerWaalsContact C-N 3.33Å; F99-T101 PolarHBondContact O-N 3Å; F99-Q102 PolarHBondContact O-N 3.2Å; F99-V103 HydrophobicContact CD1-CG2 4.49Å; F99-V103 HydrophobicContact CD2-CG2 4.45Å; F99-V103 HydrophobicContact CE1-CG2 4.2Å; F99-V103 HydrophobicContact CE2-CG2 4.15Å; F99-V103 HydrophobicContact CZ-CG2 4.03Å; F99-V103 WeakPolarHBondContact O-CG2 3.28Å; F99-V103 PolarHBondContact O-N 2.96Å; F99-V119 HydrophobicContact CD1-CG1 4.16Å; F99-V119 HydrophobicContact CE1-CB 4.47Å; F99-V119 HydrophobicContact CE1-CG1 3.93Å; F99-R122 HydrophobicContact CE2-CB 4.5Å; F99-R122 HydrophobicContact CZ-CB 3.71Å
100	I	90.5	Very high	82.6	Confident	80 Å²	80	84.6 Å²	84.6	41%	0.41	46%	0.462	S	S	.	.	H	α-helix	trans	-59.8	-45.6	177.1	-66	164.7	0	0	0	110.3	N96 K97 Q102 V103 H104 T115 V119	N96-I100 WeakPolarHBondContact O-CB 3.3Å; N96-I100 WeakPolarHBondContact O-CD1 3.39Å; N96-I100 WeakPolarHBondContact O-CG1 3.41Å; N96-I100 PolarHBondContact O-N 2.76Å; K97-I100 PolarHBondContact O-N 3.04Å; I100-Q102 VanDerWaalsContact C-N 3.35Å; I100-Q102 PolarHBondContact O-N 2.9Å; I100-V103 PolarHBondContact O-N 3.48Å; I100-H104 VanDerWaalsContact O-CB 3.3Å; I100-H104 WeakPolarHBondContact O-CB 3.33Å; I100-H104 PolarHBondContact O-N 3.39Å; I100-T115 HydrophobicContact CG2-CG2 4.12Å; I100-V119 HydrophobicContact CB-CG2 4.35Å; I100-V119 HydrophobicContact CG1-CG1 4.17Å; I100-V119 HydrophobicContact CG1-CG2 4Å; I100-V119 HydrophobicContact CG2-CG2 4.4Å
101	T	90.4	Very high	84.4	Confident	67 Å²	67	82.6 Å²	82.6	41%	0.411	45%	0.449	S	S	.	.	H	α-helix	trans	-61.6	-42.3	177.4	-63.2	0	0	0	0	111.7	K97 R98 F99 H104 H105	K97-T101 WeakPolarHBondContact O-CB 3.42Å; K97-T101 PolarHBondContact O-N 2.76Å; K97-T101 PolarHBondContact O-OG1 3.31Å; R98-T101 PolarHBondContact O-N 3.24Å; F99-T101 VanDerWaalsContact C-N 3.33Å; F99-T101 PolarHBondContact O-N 3Å; T101-H104 WeakPolarHBondContact O-CB 3.35Å; T101-H104 PolarHBondContact O-N 3.03Å; T101-H105 PolarHBondContact O-CD2 3.47Å; T101-H105 VanDerWaalsContact O-CD2 3.24Å; T101-H105 PolarHBondContact O-N 3.08Å
102	Q	92.6	Very high	86.3	Confident	111 Å²	111	82.9 Å²	82.9	52%	0.519	45%	0.45	S	S	.	.	H	α-helix	trans	-63.5	-48	176.9	-173.9	176.1	7.6	0	0	111.5	R98 F99 I100 H104 H105 D106	R98-Q102 WeakPolarHBondContact O-CB 3.35Å; R98-Q102 PolarHBondContact O-N 3.33Å; F99-Q102 PolarHBondContact O-N 3.2Å; I100-Q102 VanDerWaalsContact C-N 3.35Å; I100-Q102 PolarHBondContact O-N 2.9Å; Q102-H104 VanDerWaalsContact C-N 3.26Å; Q102-H104 PolarHBondContact O-N 3.39Å; Q102-H105 PolarHBondContact O-N 3.43Å; Q102-D106 WeakPolarHBondContact O-CB 3.49Å; Q102-D106 VanDerWaalsContact O-CG 3.25Å; Q102-D106 PolarHBondContact O-N 3.12Å
103	V	92.1	Very high	87.5	Confident	2 Å²	2	87.6 Å²	87.6	1%	0.012	46%	0.458	C	S	.	.	H	α-helix	trans	-59.9	-38.7	175.8	174.5	0	0	0	0	111.5	F99 I100 A107 F118 V119	F99-V103 HydrophobicContact CD1-CG2 4.49Å; F99-V103 HydrophobicContact CD2-CG2 4.45Å; F99-V103 HydrophobicContact CE1-CG2 4.2Å; F99-V103 HydrophobicContact CE2-CG2 4.15Å; F99-V103 HydrophobicContact CZ-CG2 4.03Å; F99-V103 WeakPolarHBondContact O-CG2 3.28Å; F99-V103 PolarHBondContact O-N 2.96Å; I100-V103 PolarHBondContact O-N 3.48Å; V103-A107 WeakPolarHBondContact O-CB 3.2Å; V103-A107 PolarHBondContact O-N 3.46Å; V103-F118 HydrophobicContact CG1-CB 3.41Å; V103-F118 VanDerWaalsContact CG1-CB 3.41Å; V103-V119 HydrophobicContact CB-CG2 3.9Å; V103-V119 HydrophobicContact CG1-CG2 3.85Å; V103-V119 HydrophobicContact CG2-CG2 4.19Å
104	H	94.1	Very high	88.5	Confident	53 Å²	53	91.5 Å²	91.5	25%	0.245	47%	0.468	C	S	.	.	H	α-helix	trans	-63.3	-43.5	177.3	-174.2	68.3	0	0	0	112.6	I100 T101 Q102 G108 H109 T115	I100-H104 VanDerWaalsContact O-CB 3.3Å; I100-H104 WeakPolarHBondContact O-CB 3.33Å; I100-H104 PolarHBondContact O-N 3.39Å; T101-H104 WeakPolarHBondContact O-CB 3.35Å; T101-H104 PolarHBondContact O-N 3.03Å; Q102-H104 VanDerWaalsContact C-N 3.26Å; Q102-H104 PolarHBondContact O-N 3.39Å; H104-G108 PolarHBondContact O-N 3.32Å; H104-H109 AromaticContact CD2-CE1 3.74Å; H104-H109 AromaticContact CD2-ND1 3.12Å; H104-H109 PolarHBondContact CD2-ND1 2.7Å; H104-H109 AromaticContact CE1-ND1 3.88Å; H104-H109 AromaticContact NE2-CE1 3.91Å; H104-H109 AromaticContact NE2-CG 3.77Å; H104-H109 AromaticContact NE2-ND1 2.91Å; H104-H109 PolarHBondContact NE2-ND1 2.89Å; H104-H109 PolarHBondContact O-N 2.82Å; H104-T115 HydrophobicContact CB-CG2 3.74Å; H104-T115 PolarHBondContact ND1-OG1 2.94Å
105	H	93.6	Very high	89.3	Confident	109 Å²	109	88 Å²	88	51%	0.505	45%	0.445	S	S	.	.	H	α-helix	trans	-68.6	-48.8	175.9	-83.5	-70.7	0	0	0	112	T101 Q102 A107 G108 H109	T101-H105 PolarHBondContact O-CD2 3.47Å; T101-H105 VanDerWaalsContact O-CD2 3.24Å; T101-H105 PolarHBondContact O-N 3.08Å; Q102-H105 PolarHBondContact O-N 3.43Å; H105-A107 PolarHBondContact O-N 3.42Å; H105-G108 PolarHBondContact O-N 2.87Å; H105-H109 AromaticContact CE1-CE1 3.37Å; H105-H109 PolarHBondContact CE1-CE1 3.3Å; H105-H109 AromaticContact CE1-NE2 3.71Å; H105-H109 AromaticContact CG-CE1 3.99Å; H105-H109 AromaticContact ND1-CE1 3.22Å; H105-H109 PolarHBondContact ND1-CE1 3.29Å; H105-H109 AromaticContact ND1-NE2 3.29Å; H105-H109 PolarHBondContact ND1-NE2 2.9Å
106	D	91.8	Very high	89.8	Confident	91 Å²	91	89.2 Å²	89.2	49%	0.487	45%	0.447	S	S	.	.	H	α-helix	trans	-58.1	-34.2	179.5	-72.3	-1.1	0	0	0	112.3	Q102 G108 R122	Q102-D106 WeakPolarHBondContact O-CB 3.49Å; Q102-D106 VanDerWaalsContact O-CG 3.25Å; Q102-D106 PolarHBondContact O-N 3.12Å; D106-G108 VanDerWaalsContact C-N 3.35Å; D106-R122 IonicContact OD2-CZ 3.38Å; D106-R122 IonicContact OD2-NH1 2.76Å; D106-R122 PolarHBondContact OD2-NH1 2.67Å; D106-R122 IonicContact OD2-NH2 3.04Å; D106-R122 PolarHBondContact OD2-NH2 2.62Å
107	A	90.8	Very high	90.2	Very high	38 Å²	38	90.3 Å²	90.3	31%	0.314	45%	0.446	S	S	.	.	T	Hydrogen-bonded Turn	trans	-86.9	0.7	-179.9	0	0	0	0	0	114.2	V103 H105 P110 F118	V103-A107 WeakPolarHBondContact O-CB 3.2Å; V103-A107 PolarHBondContact O-N 3.46Å; H105-A107 PolarHBondContact O-N 3.42Å; A107-P110 HydrophobicContact CB-CG 3.93Å; A107-F118 HydrophobicContact CB-CD2 3.56Å; A107-F118 HydrophobicContact CB-CE2 3.64Å
108	G	92	Very high	90.4	Very high	55 Å²	55	86.3 Å²	86.3	57%	0.567	43%	0.428	S	S	*	.	T	Hydrogen-bonded Turn	trans	75.7	41	176.4	0	0	0	0	0	114.9	H104 H105 D106	H104-G108 PolarHBondContact O-N 3.32Å; H105-G108 PolarHBondContact O-N 2.87Å; D106-G108 VanDerWaalsContact C-N 3.35Å
109	H	91	Very high	90.5	Very high	105 Å²	105	78.3 Å²	78.3	49%	0.486	40%	0.401	S	S	.	.	S	Bend	trans	55.5	46.9	176	-57	-73.1	0	0	0	116.1	H104 H105 G111	H104-H109 AromaticContact CD2-CE1 3.74Å; H104-H109 AromaticContact CD2-ND1 3.12Å; H104-H109 PolarHBondContact CD2-ND1 2.7Å; H104-H109 AromaticContact CE1-ND1 3.88Å; H104-H109 AromaticContact NE2-CE1 3.91Å; H104-H109 AromaticContact NE2-CG 3.77Å; H104-H109 AromaticContact NE2-ND1 2.91Å; H104-H109 PolarHBondContact NE2-ND1 2.89Å; H104-H109 PolarHBondContact O-N 2.82Å; H105-H109 AromaticContact CE1-CE1 3.37Å; H105-H109 PolarHBondContact CE1-CE1 3.3Å; H105-H109 AromaticContact CE1-NE2 3.71Å; H105-H109 AromaticContact CG-CE1 3.99Å; H105-H109 AromaticContact ND1-CE1 3.22Å; H105-H109 PolarHBondContact ND1-CE1 3.29Å; H105-H109 AromaticContact ND1-NE2 3.29Å; H105-H109 PolarHBondContact ND1-NE2 2.9Å; H109-G111 PolarHBondContact O-N 2.64Å
110	P	89.7	Confident	90.4	Very high	52 Å²	52	82.8 Å²	82.8	34%	0.338	42%	0.416	S	S	.	.			trans	-77	14.4	-169.8	36.4	-41	0	0	0	114.5	A107 R114 F118	A107-P110 HydrophobicContact CB-CG 3.93Å; P110-R114 HydrophobicContact CB-CB 3.7Å; P110-R114 HydrophobicContact CB-CG 3.77Å; P110-R114 HydrophobicContact CG-CB 3.77Å; P110-R114 HydrophobicContact CG-CG 3.95Å; P110-R114 WeakPolarHBondContact O-CB 3.46Å; P110-F118 HydrophobicContact CG-CD2 4.38Å; P110-F118 HydrophobicContact CG-CE2 4.07Å
111	G	89.4	Confident	90.3	Very high	33 Å²	33	85.5 Å²	85.5	34%	0.34	42%	0.421	S	S	.	.			trans	81.4	173	-173.6	0	0	0	0	0	114.5	H109 T115	H109-G111 PolarHBondContact O-N 2.64Å; G111-T115 WeakPolarHBondContact O-CB 3.45Å; G111-T115 PolarHBondContact O-N 3.36Å; G111-T115 PolarHBondContact O-OG1 3.49Å
112	V	88.8	Confident	89.8	Confident	128 Å²	128	88.8 Å²	88.8	78%	0.776	43%	0.426	S	S	*	.	H	α-helix	trans	-62.7	-51.4	-168.3	-179.2	0	0	0	0	112.6	R114 T115 L116	V112-R114 VanDerWaalsContact C-N 3.32Å; V112-R114 PolarHBondContact O-N 3.33Å; V112-T115 PolarHBondContact O-N 2.89Å; V112-L116 PolarHBondContact O-N 3.14Å
113	R	87.6	Confident	88.5	Confident	233 Å²	233	86 Å²	86	88%	0.879	43%	0.427	S	S	*	.	H	α-helix	trans	-59.3	-42.1	-177.2	-69.8	-176.2	67.9	-179.5	1.8	112.4	Y117	R113-Y117 PolarHBondContact O-N 3.32Å
114	R	87.3	Confident	86.7	Confident	144 Å²	144	92.1 Å²	92.1	54%	0.543	46%	0.455	S	S	.	.	H	α-helix	trans	-73.3	-37.6	-179.2	-157	101.8	-168.4	162.6	3.4	111.6	P110 V112 Y117 F118	P110-R114 HydrophobicContact CB-CB 3.7Å; P110-R114 HydrophobicContact CB-CG 3.77Å; P110-R114 HydrophobicContact CG-CB 3.77Å; P110-R114 HydrophobicContact CG-CG 3.95Å; P110-R114 WeakPolarHBondContact O-CB 3.46Å; V112-R114 VanDerWaalsContact C-N 3.32Å; V112-R114 PolarHBondContact O-N 3.33Å; R114-Y117 WeakPolarHBondContact O-CB 3.42Å; R114-Y117 PolarHBondContact O-N 3.43Å; R114-F118 HydrophobicContact CB-CE2 4.46Å; R114-F118 HydrophobicContact CG-CD2 4.13Å; R114-F118 HydrophobicContact CG-CE2 3.45Å; R114-F118 VanDerWaalsContact CG-CE2 3.45Å; R114-F118 HydrophobicContact CG-CZ 3.94Å; R114-F118 WeakPolarHBondContact O-CD2 3.41Å; R114-F118 WeakPolarHBondContact O-CG 3.44Å; R114-F118 PolarHBondContact O-N 3.04Å; R114-F118 VanDerWaalsContact O-N 3.08Å
115	T	90.9	Very high	83.9	Confident	7 Å²	7	92.9 Å²	92.9	4%	0.043	48%	0.477	C	S	.	.	H	α-helix	trans	-60	-47.5	173.9	-54.7	0	0	0	0	110.6	I100 H104 G111 V112 Y117 F118 V119	I100-T115 HydrophobicContact CG2-CG2 4.12Å; H104-T115 HydrophobicContact CB-CG2 3.74Å; H104-T115 PolarHBondContact ND1-OG1 2.94Å; G111-T115 WeakPolarHBondContact O-CB 3.45Å; G111-T115 PolarHBondContact O-N 3.36Å; G111-T115 PolarHBondContact O-OG1 3.49Å; V112-T115 PolarHBondContact O-N 2.89Å; T115-Y117 VanDerWaalsContact C-N 3.31Å; T115-Y117 PolarHBondContact O-N 3.35Å; T115-F118 PolarHBondContact O-N 2.98Å; T115-F118 VanDerWaalsContact O-N 3.14Å; T115-V119 HydrophobicContact CG2-CG2 4.3Å; T115-V119 VanDerWaalsContact O-CG2 3.28Å; T115-V119 WeakPolarHBondContact O-CG2 3.2Å; T115-V119 PolarHBondContact O-N 2.96Å
116	L	89.5	Confident	81.3	Confident	86 Å²	86	91.6 Å²	91.6	45%	0.45	49%	0.485	S	S	.	.	H	α-helix	trans	-58.1	-42.5	176.9	180	63.3	0	0	0	112.4	V112 F118 V119 R120	V112-L116 PolarHBondContact O-N 3.14Å; L116-F118 PolarHBondContact O-N 3.07Å; L116-V119 PolarHBondContact O-N 3.17Å; L116-R120 HydrophobicContact CD1-CG 4.45Å; L116-R120 WeakPolarHBondContact O-CG 3.44Å; L116-R120 PolarHBondContact O-N 2.58Å
117	Y	90.1	Very high	78.8	Confident	105 Å²	105	93 Å²	93	41%	0.412	50%	0.499	S	S	.	.	H	α-helix	trans	-58.8	-45.3	175.4	172.4	-99.8	0	0	0	112.4	R113 R114 T115 R121	R113-Y117 PolarHBondContact O-N 3.32Å; R114-Y117 WeakPolarHBondContact O-CB 3.42Å; R114-Y117 PolarHBondContact O-N 3.43Å; T115-Y117 VanDerWaalsContact C-N 3.31Å; T115-Y117 PolarHBondContact O-N 3.35Å; Y117-R121 WeakPolarHBondContact O-CB 3.5Å; Y117-R121 PolarHBondContact O-N 2.94Å; Y117-R121 PolarHBondContact OH-NH2 2.98Å
118	F	89.5	Confident	76.6	Confident	52 Å²	52	97 Å²	97	23%	0.228	52%	0.52	C	S	.	.	H	α-helix	trans	-70.1	-35.8	178.2	-65.4	-48.6	0	0	0	113.1	V103 A107 P110 R114 T115 L116 R121 R122	V103-F118 HydrophobicContact CG1-CB 3.41Å; V103-F118 VanDerWaalsContact CG1-CB 3.41Å; A107-F118 HydrophobicContact CB-CD2 3.56Å; A107-F118 HydrophobicContact CB-CE2 3.64Å; P110-F118 HydrophobicContact CG-CD2 4.38Å; P110-F118 HydrophobicContact CG-CE2 4.07Å; R114-F118 HydrophobicContact CB-CE2 4.46Å; R114-F118 HydrophobicContact CG-CD2 4.13Å; R114-F118 HydrophobicContact CG-CE2 3.45Å; R114-F118 VanDerWaalsContact CG-CE2 3.45Å; R114-F118 HydrophobicContact CG-CZ 3.94Å; R114-F118 WeakPolarHBondContact O-CD2 3.41Å; R114-F118 WeakPolarHBondContact O-CG 3.44Å; R114-F118 PolarHBondContact O-N 3.04Å; R114-F118 VanDerWaalsContact O-N 3.08Å; T115-F118 PolarHBondContact O-N 2.98Å; T115-F118 VanDerWaalsContact O-N 3.14Å; L116-F118 PolarHBondContact O-N 3.07Å; F118-R121 PolarHBondContact O-N 2.91Å; F118-R122 WeakPolarHBondContact O-CB 3.14Å; F118-R122 PolarHBondContact O-N 2.68Å
119	V	88.9	Confident	74	Confident	25 Å²	25	103.6 Å²	103.6	15%	0.152	54%	0.536	C	S	.	.	H	α-helix	trans	-61.7	-48	175	167.7	0	0	0	0	110.1	F99 I100 V103 T115 L116 R122 G123	F99-V119 HydrophobicContact CD1-CG1 4.16Å; F99-V119 HydrophobicContact CE1-CB 4.47Å; F99-V119 HydrophobicContact CE1-CG1 3.93Å; I100-V119 HydrophobicContact CB-CG2 4.35Å; I100-V119 HydrophobicContact CG1-CG1 4.17Å; I100-V119 HydrophobicContact CG1-CG2 4Å; I100-V119 HydrophobicContact CG2-CG2 4.4Å; V103-V119 HydrophobicContact CB-CG2 3.9Å; V103-V119 HydrophobicContact CG1-CG2 3.85Å; V103-V119 HydrophobicContact CG2-CG2 4.19Å; T115-V119 HydrophobicContact CG2-CG2 4.3Å; T115-V119 VanDerWaalsContact O-CG2 3.28Å; T115-V119 WeakPolarHBondContact O-CG2 3.2Å; T115-V119 PolarHBondContact O-N 2.96Å; L116-V119 PolarHBondContact O-N 3.17Å; V119-R122 PolarHBondContact O-N 2.86Å; V119-G123 PolarHBondContact O-N 2.74Å
120	R	87.5	Confident	71.2	Confident	163 Å²	163	102.1 Å²	102.1	62%	0.615	55%	0.549	S	S	*	.	H	α-helix	trans	-59.1	-49.7	176	-72	178.3	-179.6	-171.7	-1.6	111.1	L116 R122 G123 E124	L116-R120 HydrophobicContact CD1-CG 4.45Å; L116-R120 WeakPolarHBondContact O-CG 3.44Å; L116-R120 PolarHBondContact O-N 2.58Å; R120-R122 VanDerWaalsContact C-N 3.33Å; R120-R122 PolarHBondContact O-N 2.73Å; R120-G123 PolarHBondContact O-N 2.89Å; R120-G123 VanDerWaalsContact O-N 3.17Å; R120-E124 VanDerWaalsContact O-CG 3.24Å; R120-E124 WeakPolarHBondContact O-CG 3.24Å; R120-E124 PolarHBondContact O-N 3.17Å
121	R	87.6	Confident	68.8	Low	136 Å²	136	111 Å²	111	51%	0.513	58%	0.577	S	S	.	*	H	α-helix	trans	-59.5	-37.6	178.2	-179.4	179.8	-81.2	179.7	-17.2	114	Y117 F118 E124	Y117-R121 WeakPolarHBondContact O-CB 3.5Å; Y117-R121 PolarHBondContact O-N 2.94Å; Y117-R121 PolarHBondContact OH-NH2 2.98Å; F118-R121 PolarHBondContact O-N 2.91Å; R121-E124 WeakPolarHBondContact CA-OE1 3.49Å
122	R	80.6	Confident	66.4	Low	137 Å²	137	112.9 Å²	112.9	52%	0.517	60%	0.597	S	S	.	*	H	α-helix	trans	-81.8	-24.5	178	-76.1	-163.8	-175.6	-179.8	1.5	113.1	F99 D106 F118 V119 R120	F99-R122 HydrophobicContact CE2-CB 4.5Å; F99-R122 HydrophobicContact CZ-CB 3.71Å; D106-R122 IonicContact OD2-CZ 3.38Å; D106-R122 IonicContact OD2-NH1 2.76Å; D106-R122 PolarHBondContact OD2-NH1 2.67Å; D106-R122 IonicContact OD2-NH2 3.04Å; D106-R122 PolarHBondContact OD2-NH2 2.62Å; F118-R122 WeakPolarHBondContact O-CB 3.14Å; F118-R122 PolarHBondContact O-N 2.68Å; V119-R122 PolarHBondContact O-N 2.86Å; R120-R122 VanDerWaalsContact C-N 3.33Å; R120-R122 PolarHBondContact O-N 2.73Å
123	G	66.1	Low	63.6	Low	52 Å²	52	110.7 Å²	110.7	54%	0.536	60%	0.6	S	S	.	*	S	Bend	trans	-91.8	6.8	178.8	0	0	0	0	0	114.7	V119 R120 G125	V119-G123 PolarHBondContact O-N 2.74Å; R120-G123 PolarHBondContact O-N 2.89Å; R120-G123 VanDerWaalsContact O-N 3.17Å; G123-G125 PolarHBondContact O-N 3.18Å
124	E	52.8	Low	61.2	Low	131 Å²	131	108.2 Å²	108.2	61%	0.612	60%	0.599	S	S	*	*			trans	-72.8	89.4	-174	-94.4	158.7	-150.7	0	0	112.8	R120 R121 A126	R120-E124 VanDerWaalsContact O-CG 3.24Å; R120-E124 WeakPolarHBondContact O-CG 3.24Å; R120-E124 PolarHBondContact O-N 3.17Å; R121-E124 WeakPolarHBondContact CA-OE1 3.49Å; E124-A126 HydrophobicContact CG-CB 4.46Å
125	G	37.1	Very low	58.6	Low	69 Å²	69	109.5 Å²	109.5	71%	0.711	61%	0.611	S	S	*	*				-102.1	91.8	115.9	0	0	0	0	0	107.5	G123 P127	G123-G125 PolarHBondContact O-N 3.18Å; G125-P127 WeakPolarHBondContact O-CD 3.43Å
126	A	37.5	Very low	56.6	Low	81 Å²	81	116.9 Å²	116.9	67%	0.669	65%	0.648	S	S	*	*	P	Polyproline II helix	trans	-65	132	178.2	0	0	0	0	0	110.8	E124	E124-A126 HydrophobicContact CG-CB 4.46Å
127	P	40.3	Very low	54.1	Low	121 Å²	121	119.9 Å²	119.9	79%	0.786	66%	0.659	S	S	*	*	P	Polyproline II helix	trans	-90.6	116.6	149.4	13.9	4.7	0	0	0	108.2	G125	G125-P127 WeakPolarHBondContact O-CD 3.43Å
128	T	43.7	Very low	51.9	Low	121 Å²	121	119.1 Å²	119.1	74%	0.742	68%	0.675	S	S	*	*	P	Polyproline II helix	trans	-50.2	136.2	149.8	45	0	0	0	0	109.8
129	E	38.2	Very low	49.9	Very low	195 Å²	195	122.4 Å²	122.4	91%	0.911	70%	0.699	S	S	*	*			trans	139.8	126.6	148.4	-76.2	176.6	-175.8	0	0	113.7
130	G	32.4	Very low	47.6	Very low	73 Å²	73	126.3 Å²	126.3	75%	0.753	73%	0.728	S	S	*	*			trans	109.3	42.9	148.6	0	0	0	0	0	119.8
131	Y	40	Very low	45.9	Very low	239 Å²	239	124.9 Å²	124.9	94%	0.937	74%	0.737	S	S	*	*			trans	-95.1	91.1	153.1	-84.5	-80.8	0	0	0	109
132	G	37.2	Very low	43.8	Very low	73 Å²	73	131 Å²	131	75%	0.753	77%	0.771	S	S	*	*			trans	-54.8	133.4	159.5	0	0	0	0	0	109
133	G	31.3	Very low	42	Very low	81 Å²	81	130.7 Å²	130.7	84%	0.835	78%	0.784	S	S	*	*			trans	-63.4	133.9	-173	0	0	0	0	0	112.4
134	E	37	Very low	40.7	Very low	182 Å²	182	134.8 Å²	134.8	85%	0.85	80%	0.797	S	S	*	*			trans	-133.6	107.6	146.1	-146.6	169.3	176.5	0	0	105.9	I136	E134-I136 PolarHBondContact O-N 3Å
135	E	33	Very low	40	Very low	171 Å²	171	135 Å²	135	80%	0.799	81%	0.807	S	S	*	*			trans	-55.6	105.6	174.3	-76.5	-179.8	134.5	0	0	109	H137	E135-H137 VanDerWaalsContact C-N 3.27Å; E135-H137 PolarHBondContact O-N 3.08Å; E135-H137 VanDerWaalsContact O-N 3.08Å
136	I	47.3	Very low	40.2	Very low	162 Å²	162	138.9 Å²	138.9	83%	0.831	81%	0.812	S	S	*	*			trans	-82.5	89.1	162.6	-42.7	-180	0	0	0	106	E134 A138	E134-I136 PolarHBondContact O-N 3Å; I136-A138 PolarHBondContact O-N 3.22Å
137	H	38	Very low	40.4	Very low	148 Å²	148	142.5 Å²	142.5	69%	0.685	82%	0.821	S	S	*	*			trans	-48.6	109.7	166.9	-112.9	-99	0	0	0	108.7	E135 V139	E135-H137 VanDerWaalsContact C-N 3.27Å; E135-H137 PolarHBondContact O-N 3.08Å; E135-H137 VanDerWaalsContact O-N 3.08Å; H137-V139 PolarHBondContact O-N 2.95Å
138	A	43	Very low	40.4	Very low	90 Å²	90	143.9 Å²	143.9	74%	0.744	82%	0.824	S	S	*	*			trans	-67.7	96.4	169.1	0	0	0	0	0	108	I136 S140	I136-A138 PolarHBondContact O-N 3.22Å; A138-S140 PolarHBondContact O-N 2.96Å; A138-S140 VanDerWaalsContact O-N 3.07Å
139	V	48.3	Very low	40.1	Very low	120 Å²	120	145.6 Å²	145.6	73%	0.727	83%	0.83	S	S	*	*			trans	-72.7	99.1	165.2	-179	0	0	0	0	106.7	H137 V141	H137-V139 PolarHBondContact O-N 2.95Å; V139-V141 HydrophobicContact CG1-CG2 4.37Å; V139-V141 PolarHBondContact O-N 3.03Å
140	S	41.8	Very low	40.3	Very low	108 Å²	108	141.8 Å²	141.8	76%	0.755	82%	0.823	S	S	*	*			trans	-66.4	123.9	161.8	-66.1	0	0	0	0	107.7	A138	A138-S140 PolarHBondContact O-N 2.96Å; A138-S140 VanDerWaalsContact O-N 3.07Å
141	V	50.1	Low	40.9	Very low	132 Å²	132	147.5 Å²	147.5	80%	0.8	83%	0.829	S	S	*	*			trans	-99.8	102	167.8	-176.5	0	0	0	0	106.1	V139	V139-V141 HydrophobicContact CG1-CG2 4.37Å; V139-V141 PolarHBondContact O-N 3.03Å
142	E	44.4	Very low	41	Very low	264 Å²	264	139.2 Å²	139.2	100%	1.234	82%	0.819	S	S	*	*			trans	-103.5	0	151.3	-85.6	-173.5	146	0	0	108.4

Retrieved 142 of 142 residues in 195.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).