A0A077ZLW1_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZLW1, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 64 aa.

						>A0A077ZLW1_TRITR|A0A077ZLW1
MRVRSSRRRNEYGEYNDVQRRPSDQANIRVLPLPLSNMQSGRKSGNLPEHFLDVSVMFTACIYA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	49.7	Very low	63.2	Low	245 Å²	245	162.7 Å²	162.7	100%	1.207	74%	0.739	S	S	*	*				0	114.4	0	-143.1	172.3	-168.3	0	0	108.1
2	R	61.4	Low	64.2	Low	248 Å²	248	165.2 Å²	165.2	94%	0.936	74%	0.74	S	S	*	*			trans	-85.4	122.3	174.9	-85	-178.1	-176.5	140.3	0.7	108.7	R4	R2-R4 PolarHBondContact O-N 3.08Å
3	V	60.6	Low	65	Low	142 Å²	142	154.8 Å²	154.8	86%	0.861	71%	0.708	S	S	*	*			trans	-69.1	114.3	173.3	179.2	0	0	0	0	108	S5	V3-S5 PolarHBondContact O-N 3.01Å
4	R	58.7	Low	65.4	Low	234 Å²	234	152.5 Å²	152.5	88%	0.883	70%	0.698	S	S	*	*			trans	-71	108.4	170.1	-76.3	-179.3	166.6	-175.7	-3.9	107.9	R2 S6	R2-R4 PolarHBondContact O-N 3.08Å; R4-S6 PolarHBondContact O-N 3.46Å
5	S	61.7	Low	65.7	Low	86 Å²	86	151.5 Å²	151.5	60%	0.601	69%	0.687	S	S	*	*			trans	-66.9	108.9	166.8	50	0	0	0	0	108.8	V3 R7	V3-S5 PolarHBondContact O-N 3.01Å; S5-R7 PolarHBondContact O-N 3.16Å
6	S	63.1	Low	65.5	Low	78 Å²	78	147.5 Å²	147.5	55%	0.545	67%	0.674	S	S	.	*			trans	-77	101.9	170.3	-65.7	0	0	0	0	108.7	R4 R8	R4-S6 PolarHBondContact O-N 3.46Å; S6-R8 PolarHBondContact O-N 3.12Å
7	R	60.1	Low	65.6	Low	161 Å²	161	144 Å²	144	61%	0.608	66%	0.662	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-71.2	122.4	167.5	-77.2	-179.7	174.9	179.5	0.6	108.9	S5 Y15 D17	S5-R7 PolarHBondContact O-N 3.16Å; R7-Y15 HydrophobicContact CB-CD1 3.95Å; R7-D17 VanDerWaalsContact CG-OD1 3.27Å; R7-D17 WeakPolarHBondContact CG-OD1 3.47Å; R7-D17 IonicContact NE-OD1 3.35Å; R7-D17 PolarHBondContact NE-OD1 3.35Å
8	R	64.4	Low	65.7	Low	190 Å²	190	139.9 Å²	139.9	72%	0.717	65%	0.649	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-102.2	135.6	166.8	-83.6	-166.7	169.5	-162.7	-1.9	109	S6 N16 V18	S6-R8 PolarHBondContact O-N 3.12Å; R8-N16 PolarHBondContact N-O 3.25Å; R8-N16 PolarHBondContact O-N 2.91Å; R8-N16 VanDerWaalsContact O-N 3.09Å; R8-V18 HydrophobicContact CB-CG2 3.92Å; R8-V18 HydrophobicContact CG-CG2 4.1Å
9	R	66.7	Low	65.3	Low	173 Å²	173	141.9 Å²	141.9	65%	0.653	66%	0.658	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-80	128.2	172.3	-159.2	-177.8	-151	-170.9	5.2	108.5	G13 E14	R9-G13 PolarHBondContact NE-O 3.1Å; R9-E14 CarbonylContact C-O 3.58Å; R9-E14 WeakPolarHBondContact CA-O 3.27Å
10	N	71.1	Confident	64.7	Low	43 Å²	43	145.8 Å²	145.8	23%	0.23	67%	0.667	C	S	.	*	P	Polyproline II helix	trans	-82.3	173.6	172.5	68.3	6.8	0	0	0	110.9	Y12 G13 E14 N16	N10-Y12 PolarHBondContact O-N 2.79Å; N10-Y12 VanDerWaalsContact O-N 3.12Å; N10-Y12 WeakPolarHBondContact OD1-CA 3.34Å; N10-Y12 PolarHBondContact OD1-N 3.09Å; N10-Y12 VanDerWaalsContact OD1-N 3.16Å; N10-G13 PolarHBondContact O-N 3.31Å; N10-G13 PolarHBondContact OD1-N 3.35Å; N10-G13 VanDerWaalsContact OD1-N 3.08Å; N10-E14 PolarHBondContact N-O 3.22Å; N10-E14 WeakPolarHBondContact OD1-CA 3.48Å; N10-E14 WeakPolarHBondContact OD1-CB 3.45Å; N10-E14 PolarHBondContact OD1-N 2.82Å; N10-E14 PolarHBondContact OD1-O 3.19Å; N10-N16 PolarHBondContact ND2-ND2 3.4Å
11	E	77.2	Confident	64.3	Low	190 Å²	190	148.8 Å²	148.8	89%	0.888	67%	0.672	S	S	*	*	T	Hydrogen-bonded Turn	trans	-60.6	-18	178.1	-63.8	172.4	177.2	0	0	113
12	Y	76	Confident	64.6	Low	192 Å²	192	142.8 Å²	142.8	75%	0.753	65%	0.652	S	S	*	*	T	Hydrogen-bonded Turn	trans	-93.5	3.5	177.6	-53.9	-78.2	0	0	0	113.4	N10 E14	N10-Y12 PolarHBondContact O-N 2.79Å; N10-Y12 VanDerWaalsContact O-N 3.12Å; N10-Y12 WeakPolarHBondContact OD1-CA 3.34Å; N10-Y12 PolarHBondContact OD1-N 3.09Å; N10-Y12 VanDerWaalsContact OD1-N 3.16Å; Y12-E14 VanDerWaalsContact C-N 3.32Å; Y12-E14 PolarHBondContact O-N 3.47Å
13	G	73.6	Confident	64.3	Low	31 Å²	31	135.5 Å²	135.5	32%	0.32	64%	0.639	S	S	.	*	S	Bend	trans	81.9	1.7	178.3	0	0	0	0	0	115.5	R9 N10	R9-G13 PolarHBondContact NE-O 3.1Å; N10-G13 PolarHBondContact O-N 3.31Å; N10-G13 PolarHBondContact OD1-N 3.35Å; N10-G13 VanDerWaalsContact OD1-N 3.08Å
14	E	71	Confident	63.8	Low	122 Å²	122	136 Å²	136	57%	0.57	64%	0.637	S	S	*	*			trans	-85.2	145.8	178.3	-61.1	-174.8	131.5	0	0	112.5	R9 N10 Y12	R9-E14 CarbonylContact C-O 3.58Å; R9-E14 WeakPolarHBondContact CA-O 3.27Å; N10-E14 PolarHBondContact N-O 3.22Å; N10-E14 WeakPolarHBondContact OD1-CA 3.48Å; N10-E14 WeakPolarHBondContact OD1-CB 3.45Å; N10-E14 PolarHBondContact OD1-N 2.82Å; N10-E14 PolarHBondContact OD1-O 3.19Å; Y12-E14 VanDerWaalsContact C-N 3.32Å; Y12-E14 PolarHBondContact O-N 3.47Å
15	Y	69.7	Low	63.2	Low	138 Å²	138	133 Å²	133	54%	0.541	63%	0.633	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-90.8	108.9	174.4	-65.9	-81.5	0	0	0	109.8	R7	R7-Y15 HydrophobicContact CB-CD1 3.95Å
16	N	63.3	Low	62.8	Low	87 Å²	87	132.4 Å²	132.4	47%	0.465	63%	0.633	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-92	126	168.2	-72.8	-52.7	0	0	0	109.1	R8 N10 V18	R8-N16 PolarHBondContact N-O 3.25Å; R8-N16 PolarHBondContact O-N 2.91Å; R8-N16 VanDerWaalsContact O-N 3.09Å; N10-N16 PolarHBondContact ND2-ND2 3.4Å; N16-V18 PolarHBondContact O-N 2.91Å; N16-V18 VanDerWaalsContact O-N 3.1Å
17	D	67.5	Low	62	Low	88 Å²	88	134.7 Å²	134.7	47%	0.471	64%	0.639	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-66.1	109.3	167.7	-74.2	-40.3	0	0	0	107.4	R7 Q19	R7-D17 VanDerWaalsContact CG-OD1 3.27Å; R7-D17 WeakPolarHBondContact CG-OD1 3.47Å; R7-D17 IonicContact NE-OD1 3.35Å; R7-D17 PolarHBondContact NE-OD1 3.35Å; D17-Q19 PolarHBondContact O-N 2.88Å
18	V	66.2	Low	61.9	Low	71 Å²	71	133.4 Å²	133.4	43%	0.43	64%	0.643	S	S	.	*			trans	-71.9	87.1	174.9	-176	0	0	0	0	107	R8 N16 R20	R8-V18 HydrophobicContact CB-CG2 3.92Å; R8-V18 HydrophobicContact CG-CG2 4.1Å; N16-V18 PolarHBondContact O-N 2.91Å; N16-V18 VanDerWaalsContact O-N 3.1Å; V18-R20 HydrophobicContact CG1-CG 4.32Å; V18-R20 PolarHBondContact O-N 3.43Å
19	Q	58.2	Low	61.4	Low	177 Å²	177	133.6 Å²	133.6	83%	0.827	64%	0.643	S	S	*	*			trans	-65.1	93.1	163.9	-69.1	-168.9	22.9	0	0	107	D17 R21	D17-Q19 PolarHBondContact O-N 2.88Å; Q19-R21 VanDerWaalsContact C-N 3.33Å; Q19-R21 PolarHBondContact O-N 3.23Å
20	R	54.2	Low	61.1	Low	219 Å²	219	131.1 Å²	131.1	83%	0.826	65%	0.648	S	S	*	*			trans	-60.6	102.3	164.8	-73.4	-173.7	176.9	-144.8	-0.3	106.3	V18	V18-R20 HydrophobicContact CG1-CG 4.32Å; V18-R20 PolarHBondContact O-N 3.43Å
21	R	55.7	Low	60.9	Low	209 Å²	209	135.7 Å²	135.7	79%	0.789	67%	0.671	S	S	*	*			trans	-56	139	165.6	-68.5	-168.3	179.5	-169.2	0.9	107	Q19 S23	Q19-R21 VanDerWaalsContact C-N 3.33Å; Q19-R21 PolarHBondContact O-N 3.23Å; R21-S23 PolarHBondContact O-N 3.25Å; R21-S23 PolarHBondContact O-OG 2.76Å
22	P	56.3	Low	60.1	Low	120 Å²	120	132 Å²	132	78%	0.779	66%	0.663	S	S	*	*			trans	-71.5	62.7	167.8	31.2	-32.9	0	0	0	108.6	D24	P22-D24 VanDerWaalsContact C-N 3.33Å
23	S	54.9	Low	59.5	Low	95 Å²	95	130.3 Å²	130.3	66%	0.664	67%	0.667	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.1	-2.7	-179.5	44.4	0	0	0	0	113.4	R21	R21-S23 PolarHBondContact O-N 3.25Å; R21-S23 PolarHBondContact O-OG 2.76Å
24	D	50.1	Low	58.9	Low	153 Å²	153	133.5 Å²	133.5	82%	0.818	68%	0.682	S	S	*	*	T	Hydrogen-bonded Turn	trans	-108.7	37.4	170.2	-59.2	-30.3	0	0	0	110.8	P22 A26	P22-D24 VanDerWaalsContact C-N 3.33Å; D24-A26 PolarHBondContact O-N 2.74Å
25	Q	45.3	Very low	58.4	Low	171 Å²	171	136.6 Å²	136.6	80%	0.799	70%	0.702	S	S	*	*			trans	-66.2	82.8	156.1	-163.6	169.3	26.2	0	0	105.4	N27	Q25-N27 VanDerWaalsContact C-N 3.34Å; Q25-N27 PolarHBondContact O-N 2.73Å
26	A	54.7	Low	57.7	Low	72 Å²	72	134 Å²	134	60%	0.595	70%	0.704	S	S	*	*			trans	-45.7	106.5	173.7	0	0	0	0	0	105.7	D24 I28	D24-A26 PolarHBondContact O-N 2.74Å; A26-I28 HydrophobicContact CB-CG1 4.08Å; A26-I28 PolarHBondContact O-N 2.8Å
27	N	46.3	Very low	56.9	Low	127 Å²	127	136.7 Å²	136.7	68%	0.679	72%	0.718	S	S	*	*			trans	-70.7	80.5	173.2	-169.2	-14.5	0	0	0	104.5	Q25 R29	Q25-N27 VanDerWaalsContact C-N 3.34Å; Q25-N27 PolarHBondContact O-N 2.73Å; N27-R29 PolarHBondContact O-N 2.76Å; N27-R29 WeakPolarHBondContact OD1-CG 3.39Å
28	I	57.7	Low	56	Low	134 Å²	134	141.4 Å²	141.4	69%	0.687	74%	0.739	S	S	*	*			trans	-70.1	80.4	172.2	-57.6	167.4	0	0	0	104	A26 V30	A26-I28 HydrophobicContact CB-CG1 4.08Å; A26-I28 PolarHBondContact O-N 2.8Å; I28-V30 HydrophobicContact CG2-CG2 3.97Å; I28-V30 PolarHBondContact O-N 2.92Å
29	R	53.9	Low	55	Low	193 Å²	193	146.3 Å²	146.3	73%	0.728	76%	0.758	S	S	*	*			trans	-65.3	95.5	159.6	-70.2	-171.8	173.9	-153.9	-1.5	104.7	N27 L31	N27-R29 PolarHBondContact O-N 2.76Å; N27-R29 WeakPolarHBondContact OD1-CG 3.39Å; R29-L31 PolarHBondContact O-N 2.84Å
30	V	59.5	Low	54.4	Low	122 Å²	122	140 Å²	140	74%	0.739	73%	0.733	S	S	*	*			trans	-62.2	93.5	162.9	-176.3	0	0	0	0	104.8	I28 P32	I28-V30 HydrophobicContact CG2-CG2 3.97Å; I28-V30 PolarHBondContact O-N 2.92Å; V30-P32 WeakPolarHBondContact O-CD 3.21Å
31	L	67	Low	54	Low	138 Å²	138	133.4 Å²	133.4	72%	0.723	73%	0.733	S	S	*	*			trans	-63.7	118.5	169.6	-108.6	101	0	0	0	105.8	R29 L33	R29-L31 PolarHBondContact O-N 2.84Å; L31-L33 PolarHBondContact O-N 2.96Å
32	P	61.8	Low	53.7	Low	112 Å²	112	134.9 Å²	134.9	73%	0.727	74%	0.739	S	S	*	*			trans	-60.3	112	167.7	24.5	-30	0	0	0	106.7	V30	V30-P32 WeakPolarHBondContact O-CD 3.21Å
33	L	63.4	Low	53.2	Low	157 Å²	157	137.7 Å²	137.7	82%	0.822	74%	0.739	S	S	*	*			trans	-53.8	125.6	172.4	-81.8	151.3	0	0	0	107.2	L31 L35	L31-L33 PolarHBondContact O-N 2.96Å; L33-L35 PolarHBondContact O-N 3.29Å; L33-L35 VanDerWaalsContact O-N 3.15Å
34	P	59.6	Low	52.7	Low	99 Å²	99	139 Å²	139	64%	0.643	75%	0.748	S	S	*	*			trans	-59.4	125.6	-176	22.7	-31.4	0	0	0	108.8	S36	P34-S36 PolarHBondContact O-N 3.28Å; P34-S36 PolarHBondContact O-OG 3.23Å
35	L	60.5	Low	52.5	Low	187 Å²	187	135.3 Å²	135.3	98%	0.979	75%	0.746	S	S	*	*			trans	-69	54.1	166.6	-66.1	167.5	0	0	0	109.1	L33	L33-L35 PolarHBondContact O-N 3.29Å; L33-L35 VanDerWaalsContact O-N 3.15Å
36	S	55.9	Low	52.8	Low	84 Å²	84	133.7 Å²	133.7	59%	0.587	74%	0.742	S	S	*	*			trans	-94.4	108.3	179.2	44.9	0	0	0	0	109.2	P34	P34-S36 PolarHBondContact O-N 3.28Å; P34-S36 PolarHBondContact O-OG 3.23Å
37	N	46.4	Very low	52.8	Low	143 Å²	143	135.8 Å²	135.8	77%	0.765	74%	0.743	S	S	*	*			trans	68.1	51.3	153.6	-66.8	19.5	0	0	0	118.6
38	M	48.1	Very low	53.2	Low	187 Å²	187	132.7 Å²	132.7	92%	0.921	73%	0.73	S	S	*	*			trans	-105.8	68.8	140.9	-73.4	-133.2	156.6	0	0	109.7	S40	M38-S40 PolarHBondContact O-N 3.27Å
39	Q	45.7	Very low	53	Low	174 Å²	174	133 Å²	133	81%	0.813	73%	0.729	S	S	*	*			trans	-50	97.1	151.9	-167.3	174.4	17.1	0	0	106.8	G41	Q39-G41 PolarHBondContact O-N 3.33Å
40	S	45.3	Very low	53	Low	45 Å²	45	130.6 Å²	130.6	32%	0.315	73%	0.725	S	S	.	*			trans	-56.1	114.9	166.3	145.1	0	0	0	0	109.4	M38 R42 K43	M38-S40 PolarHBondContact O-N 3.27Å; S40-R42 VanDerWaalsContact OG-CA 3.29Å; S40-R42 WeakPolarHBondContact OG-CA 3.49Å; S40-R42 PolarHBondContact OG-N 2.99Å; S40-K43 VanDerWaalsContact OG-CB 3.22Å; S40-K43 WeakPolarHBondContact OG-CB 3.45Å; S40-K43 PolarHBondContact OG-N 3.15Å
41	G	45.2	Very low	52.8	Low	80 Å²	80	131.9 Å²	131.9	83%	0.825	72%	0.721	S	S	*	*	S	Bend		-73.6	3.4	115.4	0	0	0	0	0	114.7	Q39	Q39-G41 PolarHBondContact O-N 3.33Å
42	R	49.3	Very low	52.4	Low	240 Å²	240	130 Å²	130	91%	0.906	71%	0.712	S	S	*	*	S	Bend	trans	-151.1	90.1	174.4	-60.1	-173.9	167.2	172	-6.7	113.4	S40	S40-R42 VanDerWaalsContact OG-CA 3.29Å; S40-R42 WeakPolarHBondContact OG-CA 3.49Å; S40-R42 PolarHBondContact OG-N 2.99Å
43	K	46.4	Very low	52	Low	178 Å²	178	129.6 Å²	129.6	77%	0.774	70%	0.703	S	S	*	*			trans	-113.9	87.6	-174.2	-115	168.6	-170.8	-173.7	0	108	S40	S40-K43 VanDerWaalsContact OG-CB 3.22Å; S40-K43 WeakPolarHBondContact OG-CB 3.45Å; S40-K43 PolarHBondContact OG-N 3.15Å
44	S	43.9	Very low	51.8	Low	124 Å²	124	127.2 Å²	127.2	87%	0.867	70%	0.695	S	S	*	*			trans	176.6	131.3	157.2	-169.8	0	0	0	0	108.4
45	G	46.5	Very low	51.8	Low	74 Å²	74	125 Å²	125	76%	0.763	68%	0.682	S	S	*	*			trans	85	129.8	177.4	0	0	0	0	0	112
46	N	51.6	Low	52	Low	137 Å²	137	120.4 Å²	120.4	73%	0.733	66%	0.661	S	S	*	*			cis	-152.5	111.1	19.6	-154.3	20.4	0	0	0	103.8
47	L	55.1	Low	52.2	Low	116 Å²	116	122.5 Å²	122.5	61%	0.607	66%	0.663	S	S	*	*			trans	-58.6	125.8	165.8	-158.1	105.1	0	0	0	104.6	E49 L52	L47-E49 PolarHBondContact O-N 2.78Å; L47-L52 HydrophobicContact CD2-CD1 4.18Å; L47-L52 HydrophobicContact CD2-CD2 4.11Å; L47-L52 HydrophobicContact CD2-CG 3.86Å
48	P	54.9	Low	53.1	Low	63 Å²	63	122.2 Å²	122.2	41%	0.409	66%	0.656	S	S	.	*			trans	-62.7	120.3	-173	-9.8	22.3	0	0	0	106.7	H50 F51	P48-H50 PolarHBondContact O-N 3.4Å; P48-F51 HydrophobicContact CB-CD2 3.78Å; P48-F51 HydrophobicContact CB-CE2 4.32Å; P48-F51 HydrophobicContact CG-CD2 3.51Å; P48-F51 HydrophobicContact CG-CE2 3.78Å; P48-F51 WeakPolarHBondContact O-CB 3.2Å; P48-F51 PolarHBondContact O-N 3.07Å
49	E	52.7	Low	54	Low	141 Å²	141	116.9 Å²	116.9	66%	0.659	63%	0.634	S	S	*	*	H	α-helix	trans	-52	-30.2	-176.2	-69.3	-175.3	148.9	0	0	111.3	L47 F51 L52 D53	L47-E49 PolarHBondContact O-N 2.78Å; E49-F51 VanDerWaalsContact C-N 3.27Å; E49-F51 PolarHBondContact O-N 3.49Å; E49-L52 PolarHBondContact O-N 3.45Å; E49-D53 PolarHBondContact O-N 2.93Å
50	H	54.2	Low	54.8	Low	141 Å²	141	111.3 Å²	111.3	65%	0.653	62%	0.617	S	S	*	*	H	α-helix	trans	-59	-27.6	173.6	-56	-48.7	0	0	0	115	P48 V54	P48-H50 PolarHBondContact O-N 3.4Å; H50-V54 VanDerWaalsContact O-CG2 3.3Å; H50-V54 WeakPolarHBondContact O-CG2 3.3Å; H50-V54 PolarHBondContact O-N 3.49Å; H50-V54 VanDerWaalsContact O-N 3.12Å
51	F	54.8	Low	56	Low	150 Å²	150	113.2 Å²	113.2	66%	0.658	63%	0.63	S	S	*	*	H	α-helix	trans	-70.2	-35.6	173.7	-87.3	-95.5	0	0	0	111.7	P48 E49 S55	P48-F51 HydrophobicContact CB-CD2 3.78Å; P48-F51 HydrophobicContact CB-CE2 4.32Å; P48-F51 HydrophobicContact CG-CD2 3.51Å; P48-F51 HydrophobicContact CG-CE2 3.78Å; P48-F51 WeakPolarHBondContact O-CB 3.2Å; P48-F51 PolarHBondContact O-N 3.07Å; E49-F51 VanDerWaalsContact C-N 3.27Å; E49-F51 PolarHBondContact O-N 3.49Å; F51-S55 PolarHBondContact O-N 3.47Å
52	L	58.3	Low	57.3	Low	99 Å²	99	114.5 Å²	114.5	52%	0.518	62%	0.617	S	S	.	*	H	α-helix	trans	-73.2	-42.5	175	-67.1	174.3	0	0	0	110.1	L47 E49 V54 S55 V56	L47-L52 HydrophobicContact CD2-CD1 4.18Å; L47-L52 HydrophobicContact CD2-CD2 4.11Å; L47-L52 HydrophobicContact CD2-CG 3.86Å; E49-L52 PolarHBondContact O-N 3.45Å; L52-V54 PolarHBondContact O-N 2.98Å; L52-S55 PolarHBondContact O-N 2.84Å; L52-S55 VanDerWaalsContact O-N 3.1Å; L52-S55 PolarHBondContact O-OG 3.37Å; L52-V56 WeakPolarHBondContact O-CB 3.23Å; L52-V56 VanDerWaalsContact O-CG2 3.3Å; L52-V56 WeakPolarHBondContact O-CG2 3.35Å; L52-V56 PolarHBondContact O-N 3.42Å
53	D	53.9	Low	58.2	Low	103 Å²	103	112.7 Å²	112.7	55%	0.551	61%	0.611	S	S	*	*	H	α-helix	trans	-58.5	-44	178	-92.6	-21	0	0	0	112.9	E49 S55 V56 M57	E49-D53 PolarHBondContact O-N 2.93Å; D53-S55 VanDerWaalsContact C-N 3.31Å; D53-S55 PolarHBondContact O-N 3.46Å; D53-V56 PolarHBondContact O-N 3.37Å; D53-M57 WeakPolarHBondContact O-CB 3.32Å; D53-M57 PolarHBondContact O-N 3.34Å
54	V	60.1	Low	58.4	Low	106 Å²	106	111 Å²	111	64%	0.642	63%	0.63	S	S	*	*	H	α-helix	trans	-64.8	-38.3	177.7	175.8	0	0	0	0	111	H50 L52 F58	H50-V54 VanDerWaalsContact O-CG2 3.3Å; H50-V54 WeakPolarHBondContact O-CG2 3.3Å; H50-V54 PolarHBondContact O-N 3.49Å; H50-V54 VanDerWaalsContact O-N 3.12Å; L52-V54 PolarHBondContact O-N 2.98Å; V54-F58 WeakPolarHBondContact O-CB 3.37Å; V54-F58 PolarHBondContact O-N 2.86Å
55	S	59	Low	59.2	Low	54 Å²	54	110.4 Å²	110.4	38%	0.378	62%	0.618	S	S	.	*	H	α-helix	trans	-70.3	-37.7	178	74.7	0	0	0	0	113.1	F51 L52 D53 T59	F51-S55 PolarHBondContact O-N 3.47Å; L52-S55 PolarHBondContact O-N 2.84Å; L52-S55 VanDerWaalsContact O-N 3.1Å; L52-S55 PolarHBondContact O-OG 3.37Å; D53-S55 VanDerWaalsContact C-N 3.31Å; D53-S55 PolarHBondContact O-N 3.46Å; S55-T59 WeakPolarHBondContact O-CB 3.3Å; S55-T59 PolarHBondContact O-N 2.83Å; S55-T59 PolarHBondContact O-OG1 3.1Å
56	V	65.3	Low	59.8	Low	90 Å²	90	112.3 Å²	112.3	55%	0.545	61%	0.611	S	S	.	*	H	α-helix	trans	-72.6	-44.4	178	173.4	0	0	0	0	110.2	L52 D53 F58 T59 A60	L52-V56 WeakPolarHBondContact O-CB 3.23Å; L52-V56 VanDerWaalsContact O-CG2 3.3Å; L52-V56 WeakPolarHBondContact O-CG2 3.35Å; L52-V56 PolarHBondContact O-N 3.42Å; D53-V56 PolarHBondContact O-N 3.37Å; V56-F58 PolarHBondContact O-N 2.7Å; V56-T59 PolarHBondContact O-N 2.72Å; V56-A60 WeakPolarHBondContact O-CB 3.48Å; V56-A60 PolarHBondContact O-N 3.39Å
57	M	58.9	Low	60.3	Low	127 Å²	127	110.9 Å²	110.9	63%	0.626	60%	0.604	S	S	*	*	H	α-helix	trans	-60.1	-45	173.9	-111.9	-146.7	74.5	0	0	111.5	D53 T59 A60 C61	D53-M57 WeakPolarHBondContact O-CB 3.32Å; D53-M57 PolarHBondContact O-N 3.34Å; M57-T59 PolarHBondContact O-N 3.12Å; M57-A60 PolarHBondContact O-N 3.38Å; M57-C61 WeakPolarHBondContact O-CB 3.44Å; M57-C61 PolarHBondContact O-N 3.04Å; M57-C61 PolarHBondContact O-SG 2.9Å
58	F	66.6	Low	60.6	Low	138 Å²	138	110.6 Å²	110.6	61%	0.605	60%	0.604	S	S	*	*	H	α-helix	trans	-63.7	-42	179.2	-172.5	-101.6	0	0	0	111.8	V54 V56 C61 I62	V54-F58 WeakPolarHBondContact O-CB 3.37Å; V54-F58 PolarHBondContact O-N 2.86Å; V56-F58 PolarHBondContact O-N 2.7Å; F58-C61 PolarHBondContact O-N 2.97Å; F58-I62 HydrophobicContact CD1-CD1 3.77Å; F58-I62 HydrophobicContact CE1-CD1 3.31Å; F58-I62 HydrophobicContact CE1-CG1 4.49Å; F58-I62 HydrophobicContact CE2-CD1 4.45Å; F58-I62 HydrophobicContact CZ-CD1 3.71Å; F58-I62 WeakPolarHBondContact O-CG1 3.29Å; F58-I62 PolarHBondContact O-N 3.03Å
59	T	66.5	Low	60.9	Low	75 Å²	75	113.6 Å²	113.6	46%	0.46	62%	0.616	S	S	.	*	H	α-helix	trans	-65.7	-41.9	176.6	-53.5	0	0	0	0	111.2	S55 V56 M57 C61 I62 Y63	S55-T59 WeakPolarHBondContact O-CB 3.3Å; S55-T59 PolarHBondContact O-N 2.83Å; S55-T59 PolarHBondContact O-OG1 3.1Å; V56-T59 PolarHBondContact O-N 2.72Å; M57-T59 PolarHBondContact O-N 3.12Å; T59-C61 VanDerWaalsContact C-N 3.34Å; T59-C61 PolarHBondContact O-N 3Å; T59-I62 PolarHBondContact O-N 2.79Å; T59-Y63 HydrophobicContact CG2-CD2 4.11Å; T59-Y63 HydrophobicContact CG2-CE2 4.43Å; T59-Y63 PolarHBondContact O-N 2.76Å
60	A	63.5	Low	61.5	Low	57 Å²	57	111.7 Å²	111.7	47%	0.471	61%	0.613	S	S	.	*	H	α-helix	trans	-64.1	-36.5	176.4	0	0	0	0	0	112.5	V56 M57 I62 Y63 A64	V56-A60 WeakPolarHBondContact O-CB 3.48Å; V56-A60 PolarHBondContact O-N 3.39Å; M57-A60 PolarHBondContact O-N 3.38Å; A60-I62 VanDerWaalsContact C-N 3.33Å; A60-I62 PolarHBondContact O-N 2.79Å; A60-Y63 PolarHBondContact O-N 3.24Å; A60-A64 VanDerWaalsContact O-CB 3.23Å; A60-A64 WeakPolarHBondContact O-CB 3.22Å; A60-A64 PolarHBondContact O-N 2.99Å; A60-A64 VanDerWaalsContact O-N 3.07Å
61	C	68.9	Low	62	Low	85 Å²	85	109.6 Å²	109.6	57%	0.574	61%	0.61	S	S	*	*	H	α-helix	trans	-71.4	-22	176.9	-71.9	0	0	0	0	114.4	M57 F58 T59	M57-C61 WeakPolarHBondContact O-CB 3.44Å; M57-C61 PolarHBondContact O-N 3.04Å; M57-C61 PolarHBondContact O-SG 2.9Å; F58-C61 PolarHBondContact O-N 2.97Å; T59-C61 VanDerWaalsContact C-N 3.34Å; T59-C61 PolarHBondContact O-N 3Å
62	I	73.7	Confident	62.6	Low	107 Å²	107	106.5 Å²	106.5	55%	0.549	61%	0.607	S	S	.	*	H	α-helix	trans	-85.9	-29.7	176.6	-66.7	171.6	0	0	0	111.5	F58 T59 A60	F58-I62 HydrophobicContact CD1-CD1 3.77Å; F58-I62 HydrophobicContact CE1-CD1 3.31Å; F58-I62 HydrophobicContact CE1-CG1 4.49Å; F58-I62 HydrophobicContact CE2-CD1 4.45Å; F58-I62 HydrophobicContact CZ-CD1 3.71Å; F58-I62 WeakPolarHBondContact O-CG1 3.29Å; F58-I62 PolarHBondContact O-N 3.03Å; T59-I62 PolarHBondContact O-N 2.79Å; A60-I62 VanDerWaalsContact C-N 3.33Å; A60-I62 PolarHBondContact O-N 2.79Å
63	Y	67.8	Low	62.9	Low	202 Å²	202	107.2 Å²	107.2	79%	0.792	61%	0.614	S	S	*	*	H	α-helix	trans	-103	-5.9	-173.7	-83	-86.6	0	0	0	115.4	T59 A60	T59-Y63 HydrophobicContact CG2-CD2 4.11Å; T59-Y63 HydrophobicContact CG2-CE2 4.43Å; T59-Y63 PolarHBondContact O-N 2.76Å; A60-Y63 PolarHBondContact O-N 3.24Å
64	A	51	Low	63.7	Low	142 Å²	142	107.5 Å²	107.5	100%	1.174	62%	0.62	S	S	*	*			trans	-90.2	0	172.5	0	0	0	0	0	112	A60	A60-A64 VanDerWaalsContact O-CB 3.23Å; A60-A64 WeakPolarHBondContact O-CB 3.22Å; A60-A64 PolarHBondContact O-N 2.99Å; A60-A64 VanDerWaalsContact O-N 3.07Å

Retrieved 64 of 64 residues in 27.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).