A0A077ZLX8_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZLX8, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 122 aa.

						>A0A077ZLX8_TRITR|A0A077ZLX8
GGVSISPRRRVRFGTKREEIGAAGVAGIKLEEKDFTLTFDPVVRCWTAAWRWSDGRGPDVLRNRVKEYVPAAGAKSAYREELRNWIENGWLVPYDEKKYGPAKGLIPLMAVVQRNKGKPMQT
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	G	44.5	Very low	64.7	Low	129 Å²	129	100.9 Å²	100.9	100%	1.33	59%	0.589	S	S	*	*				0	149.2	0	0	0	0	0	0	108.7
2	G	65.9	Low	64.8	Low	51 Å²	51	104.4 Å²	104.4	53%	0.526	59%	0.585	S	S	.	*			trans	-142.1	160.2	179	0	0	0	0	0	110.6	G14	G2-G14 PolarHBondContact O-N 3.33Å
3	V	63.9	Low	64.5	Low	92 Å²	92	103.1 Å²	103.1	56%	0.558	57%	0.569	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-101.7	129.7	175.3	-174.2	0	0	0	0	108.1	V11 R12 F13	V3-V11 HydrophobicContact CG1-CG1 3.69Å; V3-R12 WeakPolarHBondContact CA-O 3.38Å; V3-F13 HydrophobicContact CB-CE1 4.4Å; V3-F13 HydrophobicContact CG1-CE1 4.22Å; V3-F13 HydrophobicContact CG1-CZ 4.49Å; V3-F13 HydrophobicContact CG2-CD1 3.62Å; V3-F13 HydrophobicContact CG2-CE1 3.39Å; V3-F13 HydrophobicContact CG2-CZ 4.36Å
4	S	68.1	Low	64.6	Low	51 Å²	51	97.6 Å²	97.6	36%	0.357	55%	0.548	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.4	134	170.1	62.7	0	0	0	0	109.7	R12	S4-R12 PolarHBondContact N-O 3.12Å; S4-R12 PolarHBondContact O-N 3.47Å
5	I	68.2	Low	64.3	Low	88 Å²	88	100.5 Å²	100.5	45%	0.451	57%	0.569	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-108	123.5	177.8	-54.7	176.1	0	0	0	107.9	R10 V11	I5-R10 CarbonylContact C-O 3.54Å; I5-R10 WeakPolarHBondContact CA-O 3.39Å; I5-V11 HydrophobicContact CG1-CG2 4.33Å
6	S	70.1	Confident	63.6	Low	43 Å²	43	106.4 Å²	106.4	30%	0.301	59%	0.587	S	S	.	*			trans	-72.6	161.5	176.5	68.3	0	0	0	0	111.6	R8 R9 R10	S6-R8 PolarHBondContact O-N 3.31Å; S6-R8 PolarHBondContact OG-N 3.48Å; S6-R9 WeakPolarHBondContact O-CA 3.46Å; S6-R9 PolarHBondContact O-N 2.98Å; S6-R10 PolarHBondContact N-O 3.13Å; S6-R10 VanDerWaalsContact OG-CB 3.31Å; S6-R10 WeakPolarHBondContact OG-CB 3.39Å; S6-R10 PolarHBondContact OG-N 3.19Å; S6-R10 PolarHBondContact OG-O 3.41Å
7	P	62.4	Low	63	Low	143 Å²	143	113.4 Å²	113.4	93%	0.929	60%	0.602	S	S	*	*	T	Hydrogen-bonded Turn	trans	-55.3	-22.8	171.4	-26.3	35.1	0	0	0	113.6	R9	P7-R9 PolarHBondContact O-N 3.46Å
8	R	75.3	Confident	62.5	Low	194 Å²	194	117.2 Å²	117.2	73%	0.732	62%	0.616	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.3	15.1	173	-71.1	-174.4	152.1	-177.9	-7.5	113.7	S6 R10	S6-R8 PolarHBondContact O-N 3.31Å; S6-R8 PolarHBondContact OG-N 3.48Å; R8-R10 HydrophobicContact CB-CG 4.42Å; R8-R10 PolarHBondContact O-N 3.35Å
9	R	67.1	Low	61.9	Low	181 Å²	181	119.4 Å²	119.4	68%	0.683	62%	0.623	S	S	*	*			trans	57.7	24.1	-177.1	-57.8	-178.2	176.3	-126.6	-3.4	114.7	S6 P7	S6-R9 WeakPolarHBondContact O-CA 3.46Å; S6-R9 PolarHBondContact O-N 2.98Å; P7-R9 PolarHBondContact O-N 3.46Å
10	R	63.9	Low	61.3	Low	98 Å²	98	120.1 Å²	120.1	37%	0.37	63%	0.625	S	S	.	*			trans	-83.2	127.6	172.5	-54	-168.7	-134.6	-94.9	11.8	110	I5 S6 R8	I5-R10 CarbonylContact C-O 3.54Å; I5-R10 WeakPolarHBondContact CA-O 3.39Å; S6-R10 PolarHBondContact N-O 3.13Å; S6-R10 VanDerWaalsContact OG-CB 3.31Å; S6-R10 WeakPolarHBondContact OG-CB 3.39Å; S6-R10 PolarHBondContact OG-N 3.19Å; S6-R10 PolarHBondContact OG-O 3.41Å; R8-R10 HydrophobicContact CB-CG 4.42Å; R8-R10 PolarHBondContact O-N 3.35Å
11	V	62.1	Low	60.5	Low	40 Å²	40	117 Å²	117	24%	0.242	62%	0.623	C	S	.	*	E	Extended strand (participates in β ladder)	trans	-89.9	129.4	177.9	-172.9	0	0	0	0	109.2	V3 I5 F13 W46	V3-V11 HydrophobicContact CG1-CG1 3.69Å; I5-V11 HydrophobicContact CG1-CG2 4.33Å; V11-F13 HydrophobicContact CB-CE2 4.49Å; V11-F13 HydrophobicContact CG1-CD2 4.14Å; V11-F13 HydrophobicContact CG1-CE2 3.51Å; V11-F13 HydrophobicContact CG1-CZ 3.8Å; V11-W46 HydrophobicContact CG2-CZ2 4.39Å
12	R	66.2	Low	60.5	Low	143 Å²	143	116.1 Å²	116.1	54%	0.54	60%	0.603	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-119.2	131.8	173.3	-166.4	179.2	75.9	-170	1.5	110	V3 S4	V3-R12 WeakPolarHBondContact CA-O 3.38Å; S4-R12 PolarHBondContact N-O 3.12Å; S4-R12 PolarHBondContact O-N 3.47Å
13	F	61.1	Low	59.5	Low	87 Å²	87	118.3 Å²	118.3	38%	0.382	62%	0.616	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-107.7	121.6	172.8	-65.8	-88.5	0	0	0	110.1	V3 V11 L30	V3-F13 HydrophobicContact CB-CE1 4.4Å; V3-F13 HydrophobicContact CG1-CE1 4.22Å; V3-F13 HydrophobicContact CG1-CZ 4.49Å; V3-F13 HydrophobicContact CG2-CD1 3.62Å; V3-F13 HydrophobicContact CG2-CE1 3.39Å; V3-F13 HydrophobicContact CG2-CZ 4.36Å; V11-F13 HydrophobicContact CB-CE2 4.49Å; V11-F13 HydrophobicContact CG1-CD2 4.14Å; V11-F13 HydrophobicContact CG1-CE2 3.51Å; V11-F13 HydrophobicContact CG1-CZ 3.8Å; F13-L30 HydrophobicContact CE1-CD2 4.39Å; F13-L30 HydrophobicContact CZ-CD2 4.24Å
14	G	65.8	Low	58.9	Low	26 Å²	26	117.1 Å²	117.1	27%	0.268	62%	0.623	S	S	.	*	S	Bend	trans	73.1	-175.2	176.4	0	0	0	0	0	114.9	G2	G2-G14 PolarHBondContact O-N 3.33Å
15	T	60.6	Low	58.1	Low	141 Å²	141	121.3 Å²	121.3	87%	0.865	65%	0.646	S	S	*	*	S	Bend	trans	-93.5	-11.5	-174.7	48.7	0	0	0	0	113.8
16	K	52.1	Low	57.5	Low	196 Å²	196	120.9 Å²	120.9	85%	0.852	66%	0.655	S	S	*	*	S	Bend	trans	-145.4	88.5	-179.5	-77.5	-175.5	174.3	-177.9	0	110.5
17	R	53.3	Low	57.4	Low	224 Å²	224	121.4 Å²	121.4	85%	0.845	67%	0.668	S	S	*	*			trans	-166	146.3	156.6	-112.6	172.8	-176.5	-173.7	0.1	110.4
18	E	55.3	Low	58.4	Low	183 Å²	183	119 Å²	119	86%	0.855	65%	0.646	S	S	*	*			trans	-52.4	150.1	-171.9	-77.2	174.5	141.1	0	0	114.2	I20	E18-I20 PolarHBondContact O-N 3.2Å
19	E	50	Low	59	Low	159 Å²	159	115.7 Å²	115.7	74%	0.743	64%	0.637	S	S	*	*			trans	-61.9	116.9	171.9	-64.2	-168.5	161.5	0	0	110	G21	E19-G21 PolarHBondContact O-N 2.85Å
20	I	49.8	Very low	60.1	Low	132 Å²	132	109.4 Å²	109.4	68%	0.677	62%	0.617	S	S	*	*			trans	-81.3	103.8	172.7	-55.5	176.5	0	0	0	107.5	E18	E18-I20 PolarHBondContact O-N 3.2Å
21	G	44.1	Very low	61.3	Low	56 Å²	56	108.7 Å²	108.7	58%	0.577	62%	0.617	S	S	*	*			trans	-74.5	132.7	172	0	0	0	0	0	111.4	E19 A23	E19-G21 PolarHBondContact O-N 2.85Å; G21-A23 PolarHBondContact O-N 3.32Å; G21-A23 VanDerWaalsContact O-N 3.14Å
22	A	44.2	Very low	62.6	Low	111 Å²	111	111.2 Å²	111.2	92%	0.917	63%	0.627	S	S	*	*			trans	-76.7	97	176.2	0	0	0	0	0	110.2
23	A	44.9	Very low	63.6	Low	96 Å²	96	112.9 Å²	112.9	79%	0.793	64%	0.638	S	S	*	*			trans	-111.9	116.2	167	0	0	0	0	0	108.8	G21	G21-A23 PolarHBondContact O-N 3.32Å; G21-A23 VanDerWaalsContact O-N 3.14Å
24	G	51.1	Low	64.9	Low	68 Å²	68	113 Å²	113	70%	0.701	64%	0.642	S	S	*	*	S	Bend	trans	79.7	137.3	179.9	0	0	0	0	0	113.8	A26	G24-A26 PolarHBondContact O-N 2.8Å
25	V	51.6	Low	65.9	Low	138 Å²	138	114.6 Å²	114.6	84%	0.836	64%	0.642	S	S	*	*			trans	-72.2	55.2	172	-169.4	0	0	0	0	109.4	P41	V25-P41 HydrophobicContact CG1-CG 4.09Å
26	A	56.5	Low	67.3	Low	79 Å²	79	108.7 Å²	108.7	65%	0.653	61%	0.606	S	S	*	*	P	Polyproline II helix	trans	-80.9	128.5	161	0	0	0	0	0	106.3	G24 I28	G24-A26 PolarHBondContact O-N 2.8Å; A26-I28 PolarHBondContact O-N 3.01Å
27	G	67.4	Low	69.1	Low	54 Å²	54	101 Å²	101	56%	0.557	57%	0.574	S	S	*	*	P	Polyproline II helix	trans	-51.9	127.9	178.1	0	0	0	0	0	110.4	K29	G27-K29 PolarHBondContact O-N 3.29Å; G27-K29 VanDerWaalsContact O-N 3.14Å
28	I	83.3	Confident	70.9	Confident	92 Å²	92	92.9 Å²	92.9	47%	0.472	55%	0.549	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-67.5	117.5	178	-55.2	169.6	0	0	0	106.6	A26 T38 F39 W46	A26-I28 PolarHBondContact O-N 3.01Å; I28-T38 CarbonylContact O-C 3.53Å; I28-T38 WeakPolarHBondContact O-CA 3.41Å; I28-F39 HydrophobicContact CB-CB 3.92Å; I28-F39 HydrophobicContact CD1-CB 4.41Å; I28-F39 HydrophobicContact CD1-CD1 4.06Å; I28-F39 HydrophobicContact CD1-CG 4.48Å; I28-F39 PolarHBondContact O-N 2.99Å; I28-W46 HydrophobicContact CB-CH2 4.37Å; I28-W46 HydrophobicContact CG2-CH2 3.75Å; I28-W46 HydrophobicContact CG2-CZ3 4.3Å
29	K	88.2	Confident	72.5	Confident	125 Å²	125	86.4 Å²	86.4	54%	0.543	52%	0.518	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.1	126.9	-179.9	-172.8	174.5	-173.5	-157.1	0	109.9	G27 E31 T36 L37 T38	G27-K29 PolarHBondContact O-N 3.29Å; G27-K29 VanDerWaalsContact O-N 3.14Å; K29-E31 WeakPolarHBondContact CE-OE1 3.05Å; K29-E31 HydrophobicContact CG-CG 4.36Å; K29-E31 IonicContact NZ-OE1 3.49Å; K29-E31 PolarHBondContact NZ-OE1 3.1Å; K29-T36 HydrophobicContact CG-CG2 4.27Å; K29-L37 CarbonylContact C-O 3.59Å; K29-L37 VanDerWaalsContact CA-O 3.29Å; K29-L37 WeakPolarHBondContact CA-O 3.39Å; K29-T38 HydrophobicContact CB-CG2 4.35Å; K29-T38 HydrophobicContact CD-CG2 4.21Å; K29-T38 HydrophobicContact CG-CG2 3.88Å
30	L	89.5	Confident	74.1	Confident	50 Å²	50	81.9 Å²	81.9	26%	0.262	50%	0.499	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115	125.4	172.3	180	67.8	0	0	0	108.4	F13 E32 T36 L37	F13-L30 HydrophobicContact CE1-CD2 4.39Å; F13-L30 HydrophobicContact CZ-CD2 4.24Å; L30-E32 HydrophobicContact CD2-CG 4.17Å; L30-E32 HydrophobicContact CG-CG 4.11Å; L30-T36 CarbonylContact O-C 3.54Å; L30-T36 WeakPolarHBondContact O-CA 3.27Å; L30-L37 HydrophobicContact CB-CB 4.21Å; L30-L37 HydrophobicContact CD2-CD1 4.09Å; L30-L37 PolarHBondContact N-O 3.48Å; L30-L37 PolarHBondContact O-N 2.89Å
31	E	89.5	Confident	75.7	Confident	82 Å²	82	78.6 Å²	78.6	38%	0.383	49%	0.487	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.8	111.5	178.3	-68.8	-79	-157.7	0	0	108.5	K29 T36 R51	K29-E31 WeakPolarHBondContact CE-OE1 3.05Å; K29-E31 HydrophobicContact CG-CG 4.36Å; K29-E31 IonicContact NZ-OE1 3.49Å; K29-E31 PolarHBondContact NZ-OE1 3.1Å; E31-T36 HydrophobicContact CG-CG2 4.39Å; E31-T36 WeakPolarHBondContact OE2-CB 3.44Å; E31-T36 WeakPolarHBondContact OE2-CG2 3.34Å; E31-T36 PolarHBondContact OE2-OG1 3.45Å; E31-R51 IonicContact OE1-NH2 3.18Å; E31-R51 PolarHBondContact OE1-NH2 3.41Å; E31-R51 IonicContact OE2-CZ 3.68Å; E31-R51 IonicContact OE2-NE 3.22Å; E31-R51 PolarHBondContact OE2-NE 2.92Å; E31-R51 IonicContact OE2-NH2 2.65Å; E31-R51 PolarHBondContact OE2-NH2 3.29Å
32	E	89.2	Confident	77.6	Confident	93 Å²	93	82.1 Å²	82.1	44%	0.435	50%	0.496	S	S	.	.			trans	-110.8	169.4	175	-67.9	-67.7	165.5	0	0	109.8	L30 D34 F35	L30-E32 HydrophobicContact CD2-CG 4.17Å; L30-E32 HydrophobicContact CG-CG 4.11Å; E32-D34 VanDerWaalsContact C-N 3.28Å; E32-D34 PolarHBondContact O-N 3.15Å; E32-F35 CarbonylContact C-O 3.44Å; E32-F35 WeakPolarHBondContact CA-O 3.46Å; E32-F35 HydrophobicContact CB-CD1 3.97Å; E32-F35 HydrophobicContact CB-CD2 4.29Å; E32-F35 HydrophobicContact CB-CE1 3.74Å; E32-F35 HydrophobicContact CB-CE2 4.07Å; E32-F35 HydrophobicContact CB-CG 4.25Å; E32-F35 HydrophobicContact CB-CZ 3.81Å; E32-F35 WeakPolarHBondContact CB-O 3.17Å; E32-F35 HydrophobicContact CG-CD2 4.45Å; E32-F35 HydrophobicContact CG-CE1 3.95Å; E32-F35 HydrophobicContact CG-CE2 3.79Å; E32-F35 HydrophobicContact CG-CZ 3.52Å; E32-F35 PolarHBondContact N-O 2.95Å; E32-F35 VanDerWaalsContact O-O 3.11Å
33	K	87.7	Confident	79.5	Confident	179 Å²	179	81.3 Å²	81.3	78%	0.778	48%	0.48	S	S	*	.	S	Bend	trans	-53.9	-45.7	-179.1	-174.8	-173	173	-177.5	0	112.5
34	D	87.7	Confident	81.2	Confident	88 Å²	88	85.2 Å²	85.2	47%	0.471	47%	0.474	S	S	.	.	S	Bend	trans	-110.2	-2.7	-169.1	-52.8	-42	0	0	0	112.9	E32 R51	E32-D34 VanDerWaalsContact C-N 3.28Å; E32-D34 PolarHBondContact O-N 3.15Å; D34-R51 PolarHBondContact O-N 2.88Å
35	F	87.6	Confident	82.6	Confident	60 Å²	60	84.4 Å²	84.4	26%	0.263	46%	0.457	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-160.4	161.7	179.3	65.3	-87.3	0	0	0	113.4	E32 L37 A49 W50	E32-F35 CarbonylContact C-O 3.44Å; E32-F35 WeakPolarHBondContact CA-O 3.46Å; E32-F35 HydrophobicContact CB-CD1 3.97Å; E32-F35 HydrophobicContact CB-CD2 4.29Å; E32-F35 HydrophobicContact CB-CE1 3.74Å; E32-F35 HydrophobicContact CB-CE2 4.07Å; E32-F35 HydrophobicContact CB-CG 4.25Å; E32-F35 HydrophobicContact CB-CZ 3.81Å; E32-F35 WeakPolarHBondContact CB-O 3.17Å; E32-F35 HydrophobicContact CG-CD2 4.45Å; E32-F35 HydrophobicContact CG-CE1 3.95Å; E32-F35 HydrophobicContact CG-CE2 3.79Å; E32-F35 HydrophobicContact CG-CZ 3.52Å; E32-F35 PolarHBondContact N-O 2.95Å; E32-F35 VanDerWaalsContact O-O 3.11Å; F35-L37 HydrophobicContact CD2-CD1 4.47Å; F35-L37 HydrophobicContact CD2-CD2 3.94Å; F35-L37 HydrophobicContact CD2-CG 3.8Å; F35-L37 HydrophobicContact CE2-CD1 3.91Å; F35-L37 HydrophobicContact CE2-CD2 4.17Å; F35-L37 HydrophobicContact CE2-CG 3.72Å; F35-A49 CarbonylContact C-O 3.56Å; F35-A49 WeakPolarHBondContact CA-O 3.49Å; F35-A49 WeakPolarHBondContact CB-O 3.31Å; F35-W50 HydrophobicContact CB-CD2 4.39Å; F35-W50 HydrophobicContact CB-CE3 3.86Å; F35-W50 HydrophobicContact CB-CZ3 4.17Å; F35-W50 HydrophobicContact CD1-CZ3 4.03Å; F35-W50 HydrophobicContact CG-CZ3 4.38Å
36	T	90	Very high	84.1	Confident	17 Å²	17	83.1 Å²	83.1	10%	0.104	44%	0.437	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.4	134.1	171.8	-53.5	0	0	0	0	108.6	K29 L30 E31 T38 A48 A49 R51	K29-T36 HydrophobicContact CG-CG2 4.27Å; L30-T36 CarbonylContact O-C 3.54Å; L30-T36 WeakPolarHBondContact O-CA 3.27Å; E31-T36 HydrophobicContact CG-CG2 4.39Å; E31-T36 WeakPolarHBondContact OE2-CB 3.44Å; E31-T36 WeakPolarHBondContact OE2-CG2 3.34Å; E31-T36 PolarHBondContact OE2-OG1 3.45Å; T36-T38 HydrophobicContact CG2-CG2 4.44Å; T36-A48 WeakPolarHBondContact O-CA 3.48Å; T36-A49 PolarHBondContact N-O 3.29Å; T36-A49 PolarHBondContact O-N 3.47Å; T36-R51 PolarHBondContact OG1-NE 3.32Å; T36-R51 VanDerWaalsContact OG1-NE 3.09Å
37	L	90.7	Very high	85.5	Confident	34 Å²	34	82.9 Å²	82.9	18%	0.178	43%	0.428	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110.3	133.8	169.1	-56.2	179	0	0	0	109.7	K29 L30 F35 W46 T47 A48	K29-L37 CarbonylContact C-O 3.59Å; K29-L37 VanDerWaalsContact CA-O 3.29Å; K29-L37 WeakPolarHBondContact CA-O 3.39Å; L30-L37 HydrophobicContact CB-CB 4.21Å; L30-L37 HydrophobicContact CD2-CD1 4.09Å; L30-L37 PolarHBondContact N-O 3.48Å; L30-L37 PolarHBondContact O-N 2.89Å; F35-L37 HydrophobicContact CD2-CD1 4.47Å; F35-L37 HydrophobicContact CD2-CD2 3.94Å; F35-L37 HydrophobicContact CD2-CG 3.8Å; F35-L37 HydrophobicContact CE2-CD1 3.91Å; F35-L37 HydrophobicContact CE2-CD2 4.17Å; F35-L37 HydrophobicContact CE2-CG 3.72Å; L37-W46 HydrophobicContact CB-CE3 4.05Å; L37-W46 HydrophobicContact CB-CZ3 4.04Å; L37-T47 CarbonylContact C-O 3.57Å; L37-T47 WeakPolarHBondContact CA-O 3.23Å; L37-A48 HydrophobicContact CD2-CB 3.41Å; L37-A48 VanDerWaalsContact CD2-CB 3.41Å
38	T	91	Very high	86.4	Confident	54 Å²	54	83 Å²	83	33%	0.331	42%	0.424	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.6	141	169.7	52	0	0	0	0	110	I28 K29 T36 W46 T47	I28-T38 CarbonylContact O-C 3.53Å; I28-T38 WeakPolarHBondContact O-CA 3.41Å; K29-T38 HydrophobicContact CB-CG2 4.35Å; K29-T38 HydrophobicContact CD-CG2 4.21Å; K29-T38 HydrophobicContact CG-CG2 3.88Å; T36-T38 HydrophobicContact CG2-CG2 4.44Å; T38-W46 CarbonylContact O-C 3.49Å; T38-W46 WeakPolarHBondContact O-CA 3.45Å; T38-T47 PolarHBondContact N-O 2.89Å; T38-T47 PolarHBondContact O-N 3.37Å
39	F	87.7	Confident	86.5	Confident	48 Å²	48	81.2 Å²	81.2	21%	0.211	42%	0.422	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.3	123.4	170.7	-177.1	-109	0	0	0	109.7	I28 P41 R44 C45 W46	I28-F39 HydrophobicContact CB-CB 3.92Å; I28-F39 HydrophobicContact CD1-CB 4.41Å; I28-F39 HydrophobicContact CD1-CD1 4.06Å; I28-F39 HydrophobicContact CD1-CG 4.48Å; I28-F39 PolarHBondContact O-N 2.99Å; F39-P41 HydrophobicContact CD1-CB 4.49Å; F39-P41 HydrophobicContact CE1-CB 4.19Å; F39-P41 WeakPolarHBondContact O-CD 3.38Å; F39-R44 HydrophobicContact CZ-CB 4.4Å; F39-C45 WeakPolarHBondContact CA-O 3.37Å; F39-C45 WeakPolarHBondContact CD2-O 3.43Å; F39-W46 HydrophobicContact CB-CD2 4.03Å; F39-W46 HydrophobicContact CB-CE3 3.94Å; F39-W46 HydrophobicContact CB-CH2 4.03Å; F39-W46 HydrophobicContact CB-CZ2 4.08Å; F39-W46 HydrophobicContact CB-CZ3 3.95Å; F39-W46 AromaticContact CD2-CD1 3.72Å; F39-W46 AromaticContact CD2-CD2 3.89Å; F39-W46 HydrophobicContact CD2-CD2 3.89Å; F39-W46 AromaticContact CD2-CE2 3.65Å; F39-W46 AromaticContact CD2-CG 3.95Å; F39-W46 HydrophobicContact CD2-CG 3.95Å; F39-W46 HydrophobicContact CD2-CZ2 4.24Å; F39-W46 AromaticContact CD2-NE1 3.51Å; F39-W46 AromaticContact CE2-NE1 3.95Å; F39-W46 HydrophobicContact CG-CD2 4.4Å; F39-W46 HydrophobicContact CG-CZ2 4.32Å
40	D	85.4	Confident	86.3	Confident	64 Å²	64	82.3 Å²	82.3	34%	0.342	42%	0.423	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.2	113.3	170.2	-174.8	-38	0	0	0	109.1	V42 V43 R44 C45	D40-V42 VanDerWaalsContact C-N 3.31Å; D40-V42 PolarHBondContact O-N 3.44Å; D40-V42 WeakPolarHBondContact OD1-CA 3.38Å; D40-V42 VanDerWaalsContact OD1-CB 3.28Å; D40-V42 WeakPolarHBondContact OD1-CB 3.3Å; D40-V42 PolarHBondContact OD1-N 2.84Å; D40-V43 HydrophobicContact CB-CG2 3.62Å; D40-V43 VanDerWaalsContact CG-CG2 3.42Å; D40-V43 PolarHBondContact OD1-N 3.46Å; D40-V43 VanDerWaalsContact OD1-N 3.11Å; D40-R44 WeakPolarHBondContact O-CA 3.49Å; D40-R44 PolarHBondContact O-N 2.75Å; D40-C45 PolarHBondContact N-O 3.4Å; D40-C45 PolarHBondContact O-N 2.92Å
41	P	83.4	Confident	86.2	Confident	63 Å²	63	86.2 Å²	86.2	41%	0.409	44%	0.435	S	S	.	.	T	Hydrogen-bonded Turn	trans	-73.4	-20.4	-178.6	30.8	-35.1	0	0	0	113.7	V25 F39	V25-P41 HydrophobicContact CG1-CG 4.09Å; F39-P41 HydrophobicContact CD1-CB 4.49Å; F39-P41 HydrophobicContact CE1-CB 4.19Å; F39-P41 WeakPolarHBondContact O-CD 3.38Å
42	V	84	Confident	85.9	Confident	129 Å²	129	87.8 Å²	87.8	78%	0.782	44%	0.437	S	S	*	.	T	Hydrogen-bonded Turn	trans	-75.4	-54.3	179.9	-179.1	0	0	0	0	109.6	D40 R44	D40-V42 VanDerWaalsContact C-N 3.31Å; D40-V42 PolarHBondContact O-N 3.44Å; D40-V42 WeakPolarHBondContact OD1-CA 3.38Å; D40-V42 VanDerWaalsContact OD1-CB 3.28Å; D40-V42 WeakPolarHBondContact OD1-CB 3.3Å; D40-V42 PolarHBondContact OD1-N 2.84Å; V42-R44 VanDerWaalsContact C-N 3.34Å
43	V	83.2	Confident	85.7	Confident	95 Å²	95	90 Å²	90	58%	0.576	46%	0.463	S	S	*	.	T	Hydrogen-bonded Turn	trans	-88.1	-4	178.1	-61	0	0	0	0	113.4	D40 C45	D40-V43 HydrophobicContact CB-CG2 3.62Å; D40-V43 VanDerWaalsContact CG-CG2 3.42Å; D40-V43 PolarHBondContact OD1-N 3.46Å; D40-V43 VanDerWaalsContact OD1-N 3.11Å; V43-C45 VanDerWaalsContact C-N 3.29Å; V43-C45 HydrophobicContact CG2-CB 4.14Å; V43-C45 WeakPolarHBondContact CG2-SG 3.31Å; V43-C45 PolarHBondContact O-N 3.08Å
44	R	81.3	Confident	85.6	Confident	178 Å²	178	85.4 Å²	85.4	67%	0.672	45%	0.447	S	S	*	.	T	Hydrogen-bonded Turn	trans	55.4	39.4	179.3	-60.4	-179.4	169.5	-172.5	-1.4	113.4	F39 D40 V42	F39-R44 HydrophobicContact CZ-CB 4.4Å; D40-R44 WeakPolarHBondContact O-CA 3.49Å; D40-R44 PolarHBondContact O-N 2.75Å; V42-R44 VanDerWaalsContact C-N 3.34Å
45	C	79	Confident	85.3	Confident	51 Å²	51	84.4 Å²	84.4	35%	0.345	46%	0.457	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.1	149.2	-179.3	78.2	0	0	0	0	112	F39 D40 V43	F39-C45 WeakPolarHBondContact CA-O 3.37Å; F39-C45 WeakPolarHBondContact CD2-O 3.43Å; D40-C45 PolarHBondContact N-O 3.4Å; D40-C45 PolarHBondContact O-N 2.92Å; V43-C45 VanDerWaalsContact C-N 3.29Å; V43-C45 HydrophobicContact CG2-CB 4.14Å; V43-C45 WeakPolarHBondContact CG2-SG 3.31Å; V43-C45 PolarHBondContact O-N 3.08Å
46	W	85	Confident	85.1	Confident	110 Å²	110	91.1 Å²	91.1	42%	0.417	48%	0.481	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.3	134.5	165.8	-74.6	93.4	0	0	0	109.3	V11 I28 L37 T38 F39	V11-W46 HydrophobicContact CG2-CZ2 4.39Å; I28-W46 HydrophobicContact CB-CH2 4.37Å; I28-W46 HydrophobicContact CG2-CH2 3.75Å; I28-W46 HydrophobicContact CG2-CZ3 4.3Å; L37-W46 HydrophobicContact CB-CE3 4.05Å; L37-W46 HydrophobicContact CB-CZ3 4.04Å; T38-W46 CarbonylContact O-C 3.49Å; T38-W46 WeakPolarHBondContact O-CA 3.45Å; F39-W46 HydrophobicContact CB-CD2 4.03Å; F39-W46 HydrophobicContact CB-CE3 3.94Å; F39-W46 HydrophobicContact CB-CH2 4.03Å; F39-W46 HydrophobicContact CB-CZ2 4.08Å; F39-W46 HydrophobicContact CB-CZ3 3.95Å; F39-W46 AromaticContact CD2-CD1 3.72Å; F39-W46 AromaticContact CD2-CD2 3.89Å; F39-W46 HydrophobicContact CD2-CD2 3.89Å; F39-W46 AromaticContact CD2-CE2 3.65Å; F39-W46 AromaticContact CD2-CG 3.95Å; F39-W46 HydrophobicContact CD2-CG 3.95Å; F39-W46 HydrophobicContact CD2-CZ2 4.24Å; F39-W46 AromaticContact CD2-NE1 3.51Å; F39-W46 AromaticContact CE2-NE1 3.95Å; F39-W46 HydrophobicContact CG-CD2 4.4Å; F39-W46 HydrophobicContact CG-CZ2 4.32Å
47	T	84.8	Confident	84.6	Confident	74 Å²	74	91.1 Å²	91.1	45%	0.454	48%	0.484	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.1	126.2	169.7	-60.5	0	0	0	0	108.6	L37 T38	L37-T47 CarbonylContact C-O 3.57Å; L37-T47 WeakPolarHBondContact CA-O 3.23Å; T38-T47 PolarHBondContact N-O 2.89Å; T38-T47 PolarHBondContact O-N 3.37Å
48	A	86.3	Confident	84.1	Confident	58 Å²	58	92.5 Å²	92.5	48%	0.479	50%	0.495	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.7	126.5	172.5	0	0	0	0	0	109.5	T36 L37	T36-A48 WeakPolarHBondContact O-CA 3.48Å; L37-A48 HydrophobicContact CD2-CB 3.41Å; L37-A48 VanDerWaalsContact CD2-CB 3.41Å
49	A	85.8	Confident	83.5	Confident	53 Å²	53	97.1 Å²	97.1	44%	0.438	52%	0.518	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.8	119.4	174	0	0	0	0	0	109.4	F35 T36	F35-A49 CarbonylContact C-O 3.56Å; F35-A49 WeakPolarHBondContact CA-O 3.49Å; F35-A49 WeakPolarHBondContact CB-O 3.31Å; T36-A49 PolarHBondContact N-O 3.29Å; T36-A49 PolarHBondContact O-N 3.47Å
50	W	84.6	Confident	83.1	Confident	148 Å²	148	98.7 Å²	98.7	56%	0.561	53%	0.531	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-76.7	135.3	176.3	-63.7	98.8	0	0	0	110.4	F35 W52	F35-W50 HydrophobicContact CB-CD2 4.39Å; F35-W50 HydrophobicContact CB-CE3 3.86Å; F35-W50 HydrophobicContact CB-CZ3 4.17Å; F35-W50 HydrophobicContact CD1-CZ3 4.03Å; F35-W50 HydrophobicContact CG-CZ3 4.38Å; W50-W52 HydrophobicContact CB-CZ2 4.38Å
51	R	85.9	Confident	83	Confident	132 Å²	132	98.8 Å²	98.8	50%	0.498	53%	0.531	S	S	.	.			trans	-93.7	109	173.5	-68	178.6	171.7	-137	-1.9	108.3	E31 D34 T36	E31-R51 IonicContact OE1-NH2 3.18Å; E31-R51 PolarHBondContact OE1-NH2 3.41Å; E31-R51 IonicContact OE2-CZ 3.68Å; E31-R51 IonicContact OE2-NE 3.22Å; E31-R51 PolarHBondContact OE2-NE 2.92Å; E31-R51 IonicContact OE2-NH2 2.65Å; E31-R51 PolarHBondContact OE2-NH2 3.29Å; D34-R51 PolarHBondContact O-N 2.88Å; T36-R51 PolarHBondContact OG1-NE 3.32Å; T36-R51 VanDerWaalsContact OG1-NE 3.09Å
52	W	84.6	Confident	82.9	Confident	115 Å²	115	106.9 Å²	106.9	44%	0.436	55%	0.554	S	S	.	*			trans	-86.1	146.6	175.4	-58.3	93.3	0	0	0	110	W50 D54 G55 G57 P58 L61	W50-W52 HydrophobicContact CB-CZ2 4.38Å; W52-D54 PolarHBondContact O-N 2.93Å; W52-D54 VanDerWaalsContact O-N 3.16Å; W52-G55 PolarHBondContact O-N 3.3Å; W52-G57 VanDerWaalsContact CD2-CA 3.45Å; W52-P58 HydrophobicContact CH2-CG 3.86Å; W52-P58 HydrophobicContact CZ2-CG 3.87Å; W52-P58 HydrophobicContact CZ3-CG 4.39Å; W52-L61 HydrophobicContact CH2-CD2 4.01Å; W52-L61 HydrophobicContact CZ2-CD2 4.25Å
53	S	84.4	Confident	82.9	Confident	139 Å²	139	103.4 Å²	103.4	97%	0.972	53%	0.531	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.6	-27.2	-179	50.4	0	0	0	0	113.4
54	D	85.3	Confident	82.9	Confident	83 Å²	83	109.7 Å²	109.7	44%	0.444	54%	0.544	S	S	.	.	T	Hydrogen-bonded Turn	trans	-98	4.7	177	83.7	-29.2	0	0	0	113.8	W52 R56 G57	W52-D54 PolarHBondContact O-N 2.93Å; W52-D54 VanDerWaalsContact O-N 3.16Å; D54-R56 PolarHBondContact O-N 3.33Å; D54-R56 VanDerWaalsContact O-N 3.12Å; D54-R56 PolarHBondContact OD1-N 3.32Å; D54-R56 VanDerWaalsContact OD1-N 3.09Å; D54-R56 IonicContact OD2-CZ 2.65Å; D54-R56 IonicContact OD2-NE 3.26Å; D54-R56 PolarHBondContact OD2-NE 3.18Å; D54-R56 IonicContact OD2-NH2 3.32Å; D54-R56 PolarHBondContact OD2-NH2 3.36Å; D54-G57 PolarHBondContact OD1-N 3.4Å; D54-G57 VanDerWaalsContact OD1-N 3.15Å
55	G	82.6	Confident	83.2	Confident	67 Å²	67	103.8 Å²	103.8	69%	0.691	53%	0.528	S	S	*	.	S	Bend	trans	71.3	-5	179.2	0	0	0	0	0	116	W52	W52-G55 PolarHBondContact O-N 3.3Å
56	R	82.1	Confident	83.6	Confident	201 Å²	201	108.7 Å²	108.7	76%	0.758	54%	0.543	S	S	*	.	S	Bend	trans	-105.7	-43.8	-177.1	-69.3	-178.9	-68	-128.3	-4.5	112.4	D54	D54-R56 PolarHBondContact O-N 3.33Å; D54-R56 VanDerWaalsContact O-N 3.12Å; D54-R56 PolarHBondContact OD1-N 3.32Å; D54-R56 VanDerWaalsContact OD1-N 3.09Å; D54-R56 IonicContact OD2-CZ 2.65Å; D54-R56 IonicContact OD2-NE 3.26Å; D54-R56 PolarHBondContact OD2-NE 3.18Å; D54-R56 IonicContact OD2-NH2 3.32Å; D54-R56 PolarHBondContact OD2-NH2 3.36Å
57	G	79.6	Confident	83.8	Confident	17 Å²	17	107.6 Å²	107.6	18%	0.175	54%	0.543	C	S	.	.			trans	67.1	174.9	-169.1	0	0	0	0	0	113.7	W52 D54	W52-G57 VanDerWaalsContact CD2-CA 3.45Å; D54-G57 PolarHBondContact OD1-N 3.4Å; D54-G57 VanDerWaalsContact OD1-N 3.15Å
58	P	80.8	Confident	84.1	Confident	63 Å²	63	109.7 Å²	109.7	41%	0.409	54%	0.543	S	S	.	.			trans	-76.8	138.3	178.2	30.7	-30.9	0	0	0	111	W52 V60 L61	W52-P58 HydrophobicContact CH2-CG 3.86Å; W52-P58 HydrophobicContact CZ2-CG 3.87Å; W52-P58 HydrophobicContact CZ3-CG 4.39Å; P58-V60 PolarHBondContact O-N 3.29Å; P58-L61 HydrophobicContact CG-CD2 3.55Å; P58-L61 HydrophobicContact CG-CG 4.46Å
59	D	78.8	Confident	84.3	Confident	151 Å²	151	113.6 Å²	113.6	81%	0.807	56%	0.561	S	S	*	*	S	Bend	trans	-57.8	-37.2	172.8	-64.9	-43.7	0	0	0	111.9
60	V	79	Confident	84.5	Confident	82 Å²	82	111.6 Å²	111.6	50%	0.497	54%	0.543	S	S	.	.	S	Bend	trans	-140.2	125.9	177	-178.1	0	0	0	0	109.8	P58 R62 K103	P58-V60 PolarHBondContact O-N 3.29Å; V60-R62 PolarHBondContact O-N 3.09Å; V60-K103 CarbonylContact C-O 3.54Å; V60-K103 WeakPolarHBondContact CA-O 3.45Å
61	L	82.2	Confident	84.8	Confident	65 Å²	65	107.1 Å²	107.1	34%	0.34	54%	0.538	S	S	.	.			trans	-67.7	118.4	166.6	-59.3	172.8	0	0	0	108.5	W52 P58 N63 K103	W52-L61 HydrophobicContact CH2-CD2 4.01Å; W52-L61 HydrophobicContact CZ2-CD2 4.25Å; P58-L61 HydrophobicContact CG-CD2 3.55Å; P58-L61 HydrophobicContact CG-CG 4.46Å; L61-N63 PolarHBondContact O-N 3.36Å; L61-N63 VanDerWaalsContact O-N 3.1Å; L61-K103 PolarHBondContact N-O 2.82Å
62	R	82.7	Confident	85	Confident	233 Å²	233	105.5 Å²	105.5	88%	0.879	55%	0.553	S	S	*	*			trans	-74.3	3.5	-178	-61.8	-177.2	178.8	-175.7	-0.6	114	V60 R64	V60-R62 PolarHBondContact O-N 3.09Å; R62-R64 PolarHBondContact O-N 3.11Å
63	N	83.7	Confident	85.2	Confident	56 Å²	56	104 Å²	104	30%	0.299	57%	0.574	S	S	.	*			trans	-65.2	129.1	178.2	175.6	47.8	0	0	0	110.4	L61 V65 L105 P107	L61-N63 PolarHBondContact O-N 3.36Å; L61-N63 VanDerWaalsContact O-N 3.1Å; N63-V65 PolarHBondContact ND2-O 3.08Å; N63-V65 PolarHBondContact OD1-N 3.12Å; N63-V65 VanDerWaalsContact OD1-N 3.14Å; N63-L105 PolarHBondContact ND2-O 3.15Å; N63-P107 WeakPolarHBondContact ND2-CD 3.41Å; N63-P107 VanDerWaalsContact ND2-CG 3.32Å; N63-P107 WeakPolarHBondContact ND2-CG 3.34Å
64	R	83.4	Confident	85.5	Confident	227 Å²	227	98.1 Å²	98.1	86%	0.857	53%	0.533	S	S	*	.			trans	-103.3	-13.5	179.5	-63.1	-176	177.1	-172.4	-2	113	R62 K66	R62-R64 PolarHBondContact O-N 3.11Å; R64-K66 PolarHBondContact O-N 3.15Å
65	V	86.5	Confident	85.9	Confident	54 Å²	54	99 Å²	99	33%	0.327	53%	0.533	S	S	.	.			trans	-81.7	111.1	-177.8	-175.3	0	0	0	0	108.7	N63 E67 Y68 P107	N63-V65 PolarHBondContact ND2-O 3.08Å; N63-V65 PolarHBondContact OD1-N 3.12Å; N63-V65 VanDerWaalsContact OD1-N 3.14Å; V65-E67 WeakPolarHBondContact CG1-O 3.2Å; V65-Y68 HydrophobicContact CG1-CD1 4.26Å; V65-Y68 HydrophobicContact CG1-CD2 4.21Å; V65-Y68 HydrophobicContact CG1-CE1 4.21Å; V65-Y68 HydrophobicContact CG1-CE2 4.24Å; V65-Y68 HydrophobicContact CG1-CG 4.28Å; V65-P107 HydrophobicContact CB-CB 4.47Å; V65-P107 HydrophobicContact CB-CG 4.34Å; V65-P107 HydrophobicContact CG1-CB 4.18Å; V65-P107 WeakPolarHBondContact O-CB 3.35Å; V65-P107 WeakPolarHBondContact O-CG 3.45Å
66	K	86.8	Confident	86.4	Confident	155 Å²	155	100.5 Å²	100.5	67%	0.674	53%	0.532	S	S	*	.	S	Bend	trans	-77.7	-35.8	174.9	-64.6	178.9	-179.3	-173.9	0	112	R64 L105 P107 L108	R64-K66 PolarHBondContact O-N 3.15Å; K66-L105 HydrophobicContact CG-CD1 3.58Å; K66-L105 HydrophobicContact CG-CD2 4.19Å; K66-L105 HydrophobicContact CG-CG 4.43Å; K66-P107 WeakPolarHBondContact O-CA 3.22Å; K66-L108 PolarHBondContact O-N 2.95Å; K66-L108 VanDerWaalsContact O-N 3.14Å
67	E	90.1	Very high	86.9	Confident	87 Å²	87	93.7 Å²	93.7	41%	0.407	52%	0.519	S	S	.	.	B	Isolated β-bridge	trans	-154.5	136.6	-174	179	-177.5	151.1	0	0	108.2	V65 P70 Y78 L108	V65-E67 WeakPolarHBondContact CG1-O 3.2Å; E67-P70 WeakPolarHBondContact OE1-CD 3.34Å; E67-Y78 VanDerWaalsContact CD-CE1 3.43Å; E67-Y78 VanDerWaalsContact CD-OH 3.26Å; E67-Y78 HydrophobicContact CG-CE1 4.27Å; E67-Y78 WeakPolarHBondContact CG-OH 3.41Å; E67-Y78 WeakPolarHBondContact OE1-CE1 3.32Å; E67-L108 WeakPolarHBondContact CA-O 3.4Å
68	Y	91.1	Very high	87.6	Confident	117 Å²	117	93.4 Å²	93.4	46%	0.459	51%	0.513	S	S	.	.	P	Polyproline II helix	trans	-85.7	134.8	165.7	-68.1	-89.6	0	0	0	109.3	V65 P70 P107 L108 M109	V65-Y68 HydrophobicContact CG1-CD1 4.26Å; V65-Y68 HydrophobicContact CG1-CD2 4.21Å; V65-Y68 HydrophobicContact CG1-CE1 4.21Å; V65-Y68 HydrophobicContact CG1-CE2 4.24Å; V65-Y68 HydrophobicContact CG1-CG 4.28Å; Y68-P70 WeakPolarHBondContact O-CD 3.43Å; Y68-P70 VanDerWaalsContact O-N 3.1Å; Y68-P107 HydrophobicContact CD2-CB 3.6Å; Y68-P107 HydrophobicContact CD2-CG 4.47Å; Y68-P107 HydrophobicContact CE2-CB 3.38Å; Y68-P107 HydrophobicContact CE2-CG 3.78Å; Y68-L108 PolarHBondContact N-O 3.42Å; Y68-M109 HydrophobicContact CD2-CG 3.19Å; Y68-M109 HydrophobicContact CD2-SD 3.57Å; Y68-M109 VanDerWaalsContact CD2-SD 3.57Å; Y68-M109 HydrophobicContact CE2-CG 3.89Å; Y68-M109 HydrophobicContact CE2-SD 3.72Å; Y68-M109 HydrophobicContact CG-CG 3.88Å; Y68-M109 HydrophobicContact CG-SD 4.22Å
69	V	90.6	Very high	88.2	Confident	141 Å²	141	97.6 Å²	97.6	86%	0.855	52%	0.521	S	S	*	.	P	Polyproline II helix	trans	-55.7	116.6	-177.7	-178.1	0	0	0	0	110.1
70	P	90.2	Very high	89	Confident	10 Å²	10	95.7 Å²	95.7	7%	0.065	51%	0.507	C	S	.	.	P	Polyproline II helix	trans	-60.6	150.1	174.3	-25.7	36.3	0	0	0	111.3	E67 Y68 A72 K75 Y78 A110	E67-P70 WeakPolarHBondContact OE1-CD 3.34Å; Y68-P70 WeakPolarHBondContact O-CD 3.43Å; Y68-P70 VanDerWaalsContact O-N 3.1Å; P70-A72 PolarHBondContact O-N 3.35Å; P70-K75 HydrophobicContact CB-CB 4.47Å; P70-Y78 HydrophobicContact CG-CD1 3.61Å; P70-Y78 HydrophobicContact CG-CD2 4.49Å; P70-Y78 HydrophobicContact CG-CE1 4.02Å; P70-Y78 HydrophobicContact CG-CG 3.86Å; P70-A110 HydrophobicContact CB-CB 3.83Å; P70-A110 HydrophobicContact CG-CB 4.09Å
71	A	90.4	Very high	89.8	Confident	55 Å²	55	96.3 Å²	96.3	46%	0.455	50%	0.504	S	S	.	.	P	Polyproline II helix	trans	-53.2	141.9	166.5	0	0	0	0	0	110	G73 A74 K75 V112	A71-G73 VanDerWaalsContact C-N 3.26Å; A71-G73 PolarHBondContact O-N 3.39Å; A71-G73 VanDerWaalsContact O-N 3.13Å; A71-A74 HydrophobicContact CB-CB 4.38Å; A71-A74 WeakPolarHBondContact O-CA 3.35Å; A71-A74 PolarHBondContact O-N 2.86Å; A71-K75 PolarHBondContact O-N 2.87Å; A71-V112 HydrophobicContact CB-CG2 4.38Å
72	A	90	Very high	90.3	Very high	98 Å²	98	94.7 Å²	94.7	81%	0.81	50%	0.496	S	S	*	.	G	3₁₀ helix	trans	-51.8	-43.4	-172.8	0	0	0	0	0	113	P70 A74 K75	P70-A72 PolarHBondContact O-N 3.35Å; A72-A74 VanDerWaalsContact C-N 3.26Å; A72-A74 PolarHBondContact O-N 3.14Å; A72-K75 PolarHBondContact O-N 2.94Å
73	G	89.8	Confident	90.9	Very high	84 Å²	84	90.5 Å²	90.5	87%	0.866	48%	0.48	S	S	*	.	G	3₁₀ helix	trans	-70.8	-12.6	177.1	0	0	0	0	0	115.5	A71	A71-G73 VanDerWaalsContact C-N 3.26Å; A71-G73 PolarHBondContact O-N 3.39Å; A71-G73 VanDerWaalsContact O-N 3.13Å
74	A	90.7	Very high	91.5	Very high	14 Å²	14	90.9 Å²	90.9	12%	0.116	48%	0.482	C	S	.	.	G	3₁₀ helix	trans	-102.9	-11.3	179.4	0	0	0	0	0	113.3	A71 A72 S76 A77 Y78 V112	A71-A74 HydrophobicContact CB-CB 4.38Å; A71-A74 WeakPolarHBondContact O-CA 3.35Å; A71-A74 PolarHBondContact O-N 2.86Å; A72-A74 VanDerWaalsContact C-N 3.26Å; A72-A74 PolarHBondContact O-N 3.14Å; A74-S76 PolarHBondContact O-N 3.11Å; A74-A77 PolarHBondContact O-N 3.4Å; A74-Y78 VanDerWaalsContact O-CB 3.27Å; A74-Y78 WeakPolarHBondContact O-CB 3.24Å; A74-Y78 PolarHBondContact O-N 3.14Å; A74-V112 HydrophobicContact CB-CG2 3.92Å
75	K	92.8	Very high	92	Very high	103 Å²	103	83.6 Å²	83.6	45%	0.448	46%	0.455	S	S	.	.	H	α-helix	trans	-59.1	-42	-172.3	-171.9	177.5	-177	177	0	113.3	P70 A71 A72 R79	P70-K75 HydrophobicContact CB-CB 4.47Å; A71-K75 PolarHBondContact O-N 2.87Å; A72-K75 PolarHBondContact O-N 2.94Å; K75-R79 WeakPolarHBondContact O-CG 3.14Å; K75-R79 PolarHBondContact O-N 2.89Å; K75-R79 VanDerWaalsContact O-N 3.12Å
76	S	93.5	Very high	92.3	Very high	97 Å²	97	85 Å²	85	68%	0.678	46%	0.459	S	S	*	.	H	α-helix	trans	-67.3	-49.5	179	-58.1	0	0	0	0	111.5	A74 Y78 R79 E80	A74-S76 PolarHBondContact O-N 3.11Å; S76-Y78 VanDerWaalsContact C-N 3.32Å; S76-Y78 PolarHBondContact O-N 3.39Å; S76-R79 PolarHBondContact O-N 2.86Å; S76-E80 PolarHBondContact O-N 3.36Å
77	A	92.9	Very high	92.6	Very high	58 Å²	58	84.1 Å²	84.1	48%	0.479	46%	0.458	S	S	.	.	H	α-helix	trans	-60.8	-41.2	177.8	0	0	0	0	0	111.9	A74 R79 E80 E81	A74-A77 PolarHBondContact O-N 3.4Å; A77-R79 PolarHBondContact O-N 3.35Å; A77-E80 PolarHBondContact O-N 3.11Å; A77-E81 WeakPolarHBondContact O-CB 3.35Å; A77-E81 PolarHBondContact O-N 3.31Å
78	Y	93.4	Very high	92.8	Very high	12 Å²	12	84.7 Å²	84.7	5%	0.047	46%	0.464	C	S	.	.	H	α-helix	trans	-58	-47.9	174.2	170.5	-103.1	0	0	0	112	E67 P70 A74 S76 E80 E81 L82 L108 A110	E67-Y78 VanDerWaalsContact CD-CE1 3.43Å; E67-Y78 VanDerWaalsContact CD-OH 3.26Å; E67-Y78 HydrophobicContact CG-CE1 4.27Å; E67-Y78 WeakPolarHBondContact CG-OH 3.41Å; E67-Y78 WeakPolarHBondContact OE1-CE1 3.32Å; P70-Y78 HydrophobicContact CG-CD1 3.61Å; P70-Y78 HydrophobicContact CG-CD2 4.49Å; P70-Y78 HydrophobicContact CG-CE1 4.02Å; P70-Y78 HydrophobicContact CG-CG 3.86Å; A74-Y78 VanDerWaalsContact O-CB 3.27Å; A74-Y78 WeakPolarHBondContact O-CB 3.24Å; A74-Y78 PolarHBondContact O-N 3.14Å; S76-Y78 VanDerWaalsContact C-N 3.32Å; S76-Y78 PolarHBondContact O-N 3.39Å; Y78-E80 PolarHBondContact O-N 2.86Å; Y78-E81 PolarHBondContact O-N 2.79Å; Y78-L82 HydrophobicContact CD1-CD1 4.28Å; Y78-L82 HydrophobicContact CE1-CD1 3.53Å; Y78-L82 HydrophobicContact CE1-CG 4.15Å; Y78-L82 HydrophobicContact CE2-CD1 4.25Å; Y78-L82 HydrophobicContact CE2-CD2 4.14Å; Y78-L82 HydrophobicContact CE2-CG 4.14Å; Y78-L82 WeakPolarHBondContact O-CG 3.4Å; Y78-L82 PolarHBondContact O-N 3.2Å; Y78-L108 HydrophobicContact CE2-CB 4.43Å; Y78-L108 VanDerWaalsContact OH-CB 3.23Å; Y78-L108 WeakPolarHBondContact OH-CB 3.29Å; Y78-A110 HydrophobicContact CD2-CB 3.62Å; Y78-A110 HydrophobicContact CE2-CB 4.35Å; Y78-A110 HydrophobicContact CG-CB 3.99Å
79	R	94.3	Very high	92.6	Very high	150 Å²	150	81.5 Å²	81.5	57%	0.566	47%	0.466	S	S	*	.	H	α-helix	trans	-65.7	-37.2	179	-75.8	179.1	169.3	-167.4	-6.3	113.1	K75 S76 A77 R83	K75-R79 WeakPolarHBondContact O-CG 3.14Å; K75-R79 PolarHBondContact O-N 2.89Å; K75-R79 VanDerWaalsContact O-N 3.12Å; S76-R79 PolarHBondContact O-N 2.86Å; A77-R79 PolarHBondContact O-N 3.35Å; R79-R83 PolarHBondContact O-N 3.38Å; R79-R83 VanDerWaalsContact O-N 3.1Å
80	E	95.8	Very high	92.5	Very high	111 Å²	111	82.4 Å²	82.4	52%	0.519	45%	0.454	S	S	.	.	H	α-helix	trans	-65.1	-45.1	174.5	-174.2	178.2	-179	0	0	110.9	S76 A77 Y78 L82 R83 N84	S76-E80 PolarHBondContact O-N 3.36Å; A77-E80 PolarHBondContact O-N 3.11Å; Y78-E80 PolarHBondContact O-N 2.86Å; E80-L82 PolarHBondContact O-N 3.05Å; E80-R83 WeakPolarHBondContact O-CB 3.31Å; E80-R83 PolarHBondContact O-N 3.1Å; E80-R83 VanDerWaalsContact O-N 3.15Å; E80-N84 VanDerWaalsContact O-CG 3.25Å; E80-N84 PolarHBondContact O-N 2.84Å; E80-N84 PolarHBondContact O-ND2 2.77Å
81	E	94.3	Very high	92.5	Very high	95 Å²	95	85.1 Å²	85.1	44%	0.444	47%	0.468	S	S	.	.	H	α-helix	trans	-61.7	-43.1	176.8	-173.6	164.9	-146.1	0	0	111.9	A77 Y78 R83 N84 W85	A77-E81 WeakPolarHBondContact O-CB 3.35Å; A77-E81 PolarHBondContact O-N 3.31Å; Y78-E81 PolarHBondContact O-N 2.79Å; E81-R83 VanDerWaalsContact C-N 3.33Å; E81-R83 PolarHBondContact O-N 3.08Å; E81-N84 PolarHBondContact O-N 2.8Å; E81-W85 HydrophobicContact CG-CD2 4.27Å; E81-W85 HydrophobicContact CG-CH2 4.42Å; E81-W85 HydrophobicContact CG-CZ2 3.63Å; E81-W85 VanDerWaalsContact O-CD1 3.31Å; E81-W85 VanDerWaalsContact O-CG 3.25Å; E81-W85 PolarHBondContact O-N 3.46Å
82	L	93.7	Very high	92.4	Very high	32 Å²	32	87.8 Å²	87.8	17%	0.168	48%	0.478	C	S	.	.	H	α-helix	trans	-59.1	-43	173	-70.3	-170.8	0	0	0	112.6	Y78 E80 W85 I86 L91 L108	Y78-L82 HydrophobicContact CD1-CD1 4.28Å; Y78-L82 HydrophobicContact CE1-CD1 3.53Å; Y78-L82 HydrophobicContact CE1-CG 4.15Å; Y78-L82 HydrophobicContact CE2-CD1 4.25Å; Y78-L82 HydrophobicContact CE2-CD2 4.14Å; Y78-L82 HydrophobicContact CE2-CG 4.14Å; Y78-L82 WeakPolarHBondContact O-CG 3.4Å; Y78-L82 PolarHBondContact O-N 3.2Å; E80-L82 PolarHBondContact O-N 3.05Å; L82-W85 HydrophobicContact CD2-CE3 3.82Å; L82-W85 HydrophobicContact CD2-CZ3 3.91Å; L82-W85 PolarHBondContact O-N 3.45Å; L82-I86 WeakPolarHBondContact O-CG1 3.38Å; L82-I86 PolarHBondContact O-N 3.02Å; L82-L91 HydrophobicContact CD2-CD1 4.29Å; L82-L108 HydrophobicContact CD2-CD1 3.71Å
83	R	95.5	Very high	92.5	Very high	145 Å²	145	87.3 Å²	87.3	55%	0.547	47%	0.467	S	S	.	.	H	α-helix	trans	-63.9	-45.4	178.2	-165.5	-170.3	-47.3	161.9	11	110.8	R79 E80 E81 W85 I86 E87	R79-R83 PolarHBondContact O-N 3.38Å; R79-R83 VanDerWaalsContact O-N 3.1Å; E80-R83 WeakPolarHBondContact O-CB 3.31Å; E80-R83 PolarHBondContact O-N 3.1Å; E80-R83 VanDerWaalsContact O-N 3.15Å; E81-R83 VanDerWaalsContact C-N 3.33Å; E81-R83 PolarHBondContact O-N 3.08Å; R83-W85 VanDerWaalsContact C-N 3.29Å; R83-W85 PolarHBondContact O-N 3.2Å; R83-I86 PolarHBondContact O-N 2.94Å; R83-I86 VanDerWaalsContact O-N 3.08Å; R83-E87 WeakPolarHBondContact CD-OE1 3.3Å; R83-E87 HydrophobicContact CG-CG 4.45Å; R83-E87 WeakPolarHBondContact CG-OE1 3.36Å; R83-E87 WeakPolarHBondContact O-CG 3.35Å; R83-E87 PolarHBondContact O-N 3.48Å
84	N	95.1	Very high	92.5	Very high	64 Å²	64	88.8 Å²	88.8	34%	0.342	45%	0.447	S	S	.	.	H	α-helix	trans	-58.9	-41.6	175.5	-67.9	-17.2	0	0	0	110.9	E80 E81 I86 E87 N88	E80-N84 VanDerWaalsContact O-CG 3.25Å; E80-N84 PolarHBondContact O-N 2.84Å; E80-N84 PolarHBondContact O-ND2 2.77Å; E81-N84 PolarHBondContact O-N 2.8Å; N84-I86 VanDerWaalsContact C-N 3.32Å; N84-I86 PolarHBondContact O-N 2.99Å; N84-E87 PolarHBondContact O-N 2.77Å; N84-N88 VanDerWaalsContact O-CB 3.3Å; N84-N88 WeakPolarHBondContact O-CB 3.4Å; N84-N88 PolarHBondContact O-N 3.3Å; N84-N88 PolarHBondContact O-ND2 3.11Å
85	W	94.7	Very high	92.6	Very high	74 Å²	74	91.5 Å²	91.5	28%	0.28	46%	0.46	S	S	.	.	H	α-helix	trans	-64.3	-36.5	176.1	-66.3	-5.2	0	0	0	112.6	E81 L82 R83 G89 W90 L91	E81-W85 HydrophobicContact CG-CD2 4.27Å; E81-W85 HydrophobicContact CG-CH2 4.42Å; E81-W85 HydrophobicContact CG-CZ2 3.63Å; E81-W85 VanDerWaalsContact O-CD1 3.31Å; E81-W85 VanDerWaalsContact O-CG 3.25Å; E81-W85 PolarHBondContact O-N 3.46Å; L82-W85 HydrophobicContact CD2-CE3 3.82Å; L82-W85 HydrophobicContact CD2-CZ3 3.91Å; L82-W85 PolarHBondContact O-N 3.45Å; R83-W85 VanDerWaalsContact C-N 3.29Å; R83-W85 PolarHBondContact O-N 3.2Å; W85-G89 PolarHBondContact O-N 3.26Å; W85-W90 HydrophobicContact CB-CB 4.29Å; W85-W90 HydrophobicContact CB-CE3 4.4Å; W85-W90 AromaticContact CD1-CE3 3.27Å; W85-W90 AromaticContact CD1-CZ3 3.51Å; W85-W90 AromaticContact CG-CE3 3.9Å; W85-W90 HydrophobicContact CG-CE3 3.9Å; W85-W90 AromaticContact NE1-CE3 3.77Å; W85-W90 AromaticContact NE1-CZ3 3.71Å; W85-W90 WeakPolarHBondContact O-CA 3.46Å; W85-W90 WeakPolarHBondContact O-CB 3.44Å; W85-W90 PolarHBondContact O-N 2.87Å; W85-L91 HydrophobicContact CB-CB 4.41Å; W85-L91 HydrophobicContact CB-CD1 4.26Å; W85-L91 HydrophobicContact CB-CG 4.09Å; W85-L91 HydrophobicContact CE3-CD1 3.67Å; W85-L91 HydrophobicContact CE3-CG 4.22Å; W85-L91 HydrophobicContact CZ3-CD1 4.44Å; W85-L91 PolarHBondContact O-N 2.86Å; W85-L91 VanDerWaalsContact O-N 3.09Å
86	I	92.8	Very high	92.7	Very high	82 Å²	82	92.7 Å²	92.7	42%	0.421	47%	0.467	S	S	.	.	H	α-helix	trans	-69.1	-47.2	175.6	-67.1	165	0	0	0	111	L82 R83 N84 N88 G89 L91 P93	L82-I86 WeakPolarHBondContact O-CG1 3.38Å; L82-I86 PolarHBondContact O-N 3.02Å; R83-I86 PolarHBondContact O-N 2.94Å; R83-I86 VanDerWaalsContact O-N 3.08Å; N84-I86 VanDerWaalsContact C-N 3.32Å; N84-I86 PolarHBondContact O-N 2.99Å; I86-N88 VanDerWaalsContact C-N 3.3Å; I86-N88 PolarHBondContact O-N 3.03Å; I86-G89 PolarHBondContact O-N 2.84Å; I86-L91 WeakPolarHBondContact CA-O 3.28Å; I86-L91 HydrophobicContact CG1-CB 4.05Å; I86-P93 HydrophobicContact CG2-CG 4.47Å
87	E	93.4	Very high	92.8	Very high	137 Å²	137	98 Å²	98	64%	0.64	48%	0.478	S	S	*	.	H	α-helix	trans	-63.2	-35.8	179.1	-72.2	173.5	-173.4	0	0	112.2	R83 N84 G89	R83-E87 WeakPolarHBondContact CD-OE1 3.3Å; R83-E87 HydrophobicContact CG-CG 4.45Å; R83-E87 WeakPolarHBondContact CG-OE1 3.36Å; R83-E87 WeakPolarHBondContact O-CG 3.35Å; R83-E87 PolarHBondContact O-N 3.48Å; N84-E87 PolarHBondContact O-N 2.77Å; E87-G89 PolarHBondContact O-N 3.29Å
88	N	92.7	Very high	92.8	Very high	100 Å²	100	102 Å²	102	54%	0.535	49%	0.485	S	S	.	.	T	Hydrogen-bonded Turn	trans	-79.1	-2.3	174.4	-74	-72.2	0	0	0	113.6	N84 I86 W90	N84-N88 VanDerWaalsContact O-CB 3.3Å; N84-N88 WeakPolarHBondContact O-CB 3.4Å; N84-N88 PolarHBondContact O-N 3.3Å; N84-N88 PolarHBondContact O-ND2 3.11Å; I86-N88 VanDerWaalsContact C-N 3.3Å; I86-N88 PolarHBondContact O-N 3.03Å; N88-W90 VanDerWaalsContact C-N 3.25Å; N88-W90 HydrophobicContact CB-CD2 4.15Å; N88-W90 HydrophobicContact CB-CG 4.21Å; N88-W90 HydrophobicContact CB-CZ2 4.4Å; N88-W90 PolarHBondContact O-N 2.91Å
89	G	88.7	Confident	92.6	Very high	50 Å²	50	107 Å²	107	52%	0.515	50%	0.504	S	S	.	.	T	Hydrogen-bonded Turn	trans	69.9	17.2	-178.8	0	0	0	0	0	114.5	W85 I86 E87	W85-G89 PolarHBondContact O-N 3.26Å; I86-G89 PolarHBondContact O-N 2.84Å; E87-G89 PolarHBondContact O-N 3.29Å
90	W	87.9	Confident	92.4	Very high	159 Å²	159	101.2 Å²	101.2	60%	0.602	49%	0.491	S	S	*	.	S	Bend	trans	-76.8	-34.8	174.8	-59.8	-8	0	0	0	111.5	W85 N88	W85-W90 HydrophobicContact CB-CB 4.29Å; W85-W90 HydrophobicContact CB-CE3 4.4Å; W85-W90 AromaticContact CD1-CE3 3.27Å; W85-W90 AromaticContact CD1-CZ3 3.51Å; W85-W90 AromaticContact CG-CE3 3.9Å; W85-W90 HydrophobicContact CG-CE3 3.9Å; W85-W90 AromaticContact NE1-CE3 3.77Å; W85-W90 AromaticContact NE1-CZ3 3.71Å; W85-W90 WeakPolarHBondContact O-CA 3.46Å; W85-W90 WeakPolarHBondContact O-CB 3.44Å; W85-W90 PolarHBondContact O-N 2.87Å; N88-W90 VanDerWaalsContact C-N 3.25Å; N88-W90 HydrophobicContact CB-CD2 4.15Å; N88-W90 HydrophobicContact CB-CG 4.21Å; N88-W90 HydrophobicContact CB-CZ2 4.4Å; N88-W90 PolarHBondContact O-N 2.91Å
91	L	90	Very high	92.1	Very high	68 Å²	68	101 Å²	101	36%	0.356	50%	0.499	S	S	.	.	S	Bend	trans	-115.1	143.1	166.5	-66.8	-174.3	0	0	0	109.4	L82 W85 I86 L108	L82-L91 HydrophobicContact CD2-CD1 4.29Å; W85-L91 HydrophobicContact CB-CB 4.41Å; W85-L91 HydrophobicContact CB-CD1 4.26Å; W85-L91 HydrophobicContact CB-CG 4.09Å; W85-L91 HydrophobicContact CE3-CD1 3.67Å; W85-L91 HydrophobicContact CE3-CG 4.22Å; W85-L91 HydrophobicContact CZ3-CD1 4.44Å; W85-L91 PolarHBondContact O-N 2.86Å; W85-L91 VanDerWaalsContact O-N 3.09Å; I86-L91 WeakPolarHBondContact CA-O 3.28Å; I86-L91 HydrophobicContact CG1-CB 4.05Å; L91-L108 HydrophobicContact CD1-CD1 4.47Å
92	V	88.4	Confident	91.7	Very high	110 Å²	110	98.5 Å²	98.5	67%	0.667	49%	0.494	S	S	*	.			trans	-121.3	133.6	173.9	-177.4	0	0	0	0	107.6	Y94	V92-Y94 PolarHBondContact O-N 3.22Å
93	P	91.3	Very high	91.2	Very high	88 Å²	88	104.4 Å²	104.4	57%	0.571	52%	0.519	S	S	*	.			trans	-51.5	132.5	172.9	-27.3	35.6	0	0	0	111	I86 D95	I86-P93 HydrophobicContact CG2-CG 4.47Å; P93-D95 PolarHBondContact O-N 3.22Å
94	Y	90.7	Very high	90.6	Very high	115 Å²	115	98.8 Å²	98.8	45%	0.451	51%	0.506	S	S	.	.			trans	-69.9	124.7	-179.8	-171.4	-111.7	0	0	0	110	V92 E96 Y99 G100 P101 A102	V92-Y94 PolarHBondContact O-N 3.22Å; Y94-E96 HydrophobicContact CD1-CG 3.76Å; Y94-E96 HydrophobicContact CE1-CB 4.46Å; Y94-E96 HydrophobicContact CE1-CG 3.49Å; Y94-E96 VanDerWaalsContact CE1-CG 3.49Å; Y94-Y99 AromaticContact CD2-CD2 3.96Å; Y94-Y99 HydrophobicContact CD2-CD2 3.96Å; Y94-Y99 AromaticContact CE2-CD2 3.85Å; Y94-Y99 HydrophobicContact CE2-CD2 3.85Å; Y94-Y99 HydrophobicContact CE2-CG 4.09Å; Y94-G100 PolarHBondContact OH-O 2.54Å; Y94-P101 PolarHBondContact OH-O 2.76Å; Y94-A102 HydrophobicContact CE1-CB 3.89Å; Y94-A102 WeakPolarHBondContact OH-CA 3.2Å; Y94-A102 PolarHBondContact OH-N 2.84Å
95	D	93	Very high	90.2	Very high	71 Å²	71	98.2 Å²	98.2	38%	0.38	50%	0.503	S	S	.	.			trans	-106.2	99.5	177.1	-178.4	-4.4	0	0	0	109.6	P93 K97 K98 Y99	P93-D95 PolarHBondContact O-N 3.22Å; D95-K97 PolarHBondContact O-N 3.14Å; D95-K97 WeakPolarHBondContact OD1-CA 3.34Å; D95-K97 VanDerWaalsContact OD1-CB 3.31Å; D95-K97 WeakPolarHBondContact OD1-CB 3.44Å; D95-K97 PolarHBondContact OD1-N 2.79Å; D95-K98 HydrophobicContact CB-CB 3.95Å; D95-K98 PolarHBondContact O-N 2.81Å; D95-K98 VanDerWaalsContact O-N 3.11Å; D95-K98 PolarHBondContact OD1-N 3.23Å; D95-K98 WeakPolarHBondContact OD2-CB 3.44Å; D95-Y99 HydrophobicContact CB-CD2 4.24Å; D95-Y99 HydrophobicContact CB-CE2 4.22Å; D95-Y99 VanDerWaalsContact O-CD2 3.24Å; D95-Y99 WeakPolarHBondContact O-CD2 3.35Å; D95-Y99 PolarHBondContact O-N 2.83Å
96	E	94.5	Very high	89.8	Confident	128 Å²	128	100.7 Å²	100.7	60%	0.598	52%	0.52	S	S	*	.	H	α-helix	trans	-61.6	-27.1	177.7	-79.6	-176.9	-160.2	0	0	112.9	Y94 K98 G100	Y94-E96 HydrophobicContact CD1-CG 3.76Å; Y94-E96 HydrophobicContact CE1-CB 4.46Å; Y94-E96 HydrophobicContact CE1-CG 3.49Å; Y94-E96 VanDerWaalsContact CE1-CG 3.49Å; E96-K98 VanDerWaalsContact C-N 3.31Å; E96-G100 WeakPolarHBondContact CA-O 3.21Å; E96-G100 CarbonylContact O-C 3.52Å; E96-G100 WeakPolarHBondContact O-CA 3.48Å; E96-G100 PolarHBondContact O-N 3.09Å
97	K	96	Very high	89.6	Confident	208 Å²	208	98.3 Å²	98.3	90%	0.904	51%	0.51	S	S	*	.	H	α-helix	trans	-70.4	-32.8	176.4	-61.7	-177.5	178.1	-179.2	0	111.3	D95	D95-K97 PolarHBondContact O-N 3.14Å; D95-K97 WeakPolarHBondContact OD1-CA 3.34Å; D95-K97 VanDerWaalsContact OD1-CB 3.31Å; D95-K97 WeakPolarHBondContact OD1-CB 3.44Å; D95-K97 PolarHBondContact OD1-N 2.79Å
98	K	93	Very high	89.5	Confident	143 Å²	143	94.6 Å²	94.6	62%	0.622	49%	0.494	S	S	*	.	H	α-helix	trans	-86.5	-39.7	-179.8	-174.7	177.8	176.7	-168	0	113	D95 E96	D95-K98 HydrophobicContact CB-CB 3.95Å; D95-K98 PolarHBondContact O-N 2.81Å; D95-K98 VanDerWaalsContact O-N 3.11Å; D95-K98 PolarHBondContact OD1-N 3.23Å; D95-K98 WeakPolarHBondContact OD2-CB 3.44Å; E96-K98 VanDerWaalsContact C-N 3.31Å
99	Y	88.3	Confident	89.4	Confident	118 Å²	118	95.6 Å²	95.6	46%	0.463	50%	0.497	S	S	.	.	H	α-helix	trans	-108.7	-4	-170.5	-55.2	-59	0	0	0	114.2	Y94 D95	Y94-Y99 AromaticContact CD2-CD2 3.96Å; Y94-Y99 HydrophobicContact CD2-CD2 3.96Å; Y94-Y99 AromaticContact CE2-CD2 3.85Å; Y94-Y99 HydrophobicContact CE2-CD2 3.85Å; Y94-Y99 HydrophobicContact CE2-CG 4.09Å; D95-Y99 HydrophobicContact CB-CD2 4.24Å; D95-Y99 HydrophobicContact CB-CE2 4.22Å; D95-Y99 VanDerWaalsContact O-CD2 3.24Å; D95-Y99 WeakPolarHBondContact O-CD2 3.35Å; D95-Y99 PolarHBondContact O-N 2.83Å
100	G	91	Very high	89.5	Confident	27 Å²	27	94.7 Å²	94.7	28%	0.278	48%	0.484	S	S	.	.			trans	76.9	-170.2	-171.7	0	0	0	0	0	112.4	Y94 E96	Y94-G100 PolarHBondContact OH-O 2.54Å; E96-G100 WeakPolarHBondContact CA-O 3.21Å; E96-G100 CarbonylContact O-C 3.52Å; E96-G100 WeakPolarHBondContact O-CA 3.48Å; E96-G100 PolarHBondContact O-N 3.09Å
101	P	88.6	Confident	89.4	Confident	107 Å²	107	92.6 Å²	92.6	70%	0.695	49%	0.489	S	S	*	.	S	Bend	trans	-64.8	145.3	175.5	27.3	-34.2	0	0	0	111.1	Y94 K103	Y94-P101 PolarHBondContact OH-O 2.76Å; P101-K103 PolarHBondContact O-N 2.85Å; P101-K103 VanDerWaalsContact O-N 3.08Å
102	A	86.3	Confident	89.1	Confident	42 Å²	42	93.7 Å²	93.7	35%	0.347	50%	0.499	S	S	.	.			trans	-60	116.1	177.3	0	0	0	0	0	110.7	Y94 G104	Y94-A102 HydrophobicContact CE1-CB 3.89Å; Y94-A102 WeakPolarHBondContact OH-CA 3.2Å; Y94-A102 PolarHBondContact OH-N 2.84Å; A102-G104 PolarHBondContact O-N 3.14Å
103	K	83.4	Confident	88.9	Confident	157 Å²	157	94.6 Å²	94.6	68%	0.683	50%	0.495	S	S	*	.	S	Bend	trans	-72.4	-2.8	173.9	-61.1	-174.7	-178.8	-177	0	112.8	V60 L61 P101	V60-K103 CarbonylContact C-O 3.54Å; V60-K103 WeakPolarHBondContact CA-O 3.45Å; L61-K103 PolarHBondContact N-O 2.82Å; P101-K103 PolarHBondContact O-N 2.85Å; P101-K103 VanDerWaalsContact O-N 3.08Å
104	G	83.6	Confident	88.3	Confident	27 Å²	27	101.1 Å²	101.1	28%	0.278	51%	0.509	S	S	.	.			trans	173.7	157.4	179.4	0	0	0	0	0	112.7	A102	A102-G104 PolarHBondContact O-N 3.14Å
105	L	86.4	Confident	87.8	Confident	52 Å²	52	100.8 Å²	100.8	27%	0.272	52%	0.515	S	S	.	.			trans	-117.2	128.5	176.7	-62.1	173.4	0	0	0	108.9	N63 K66	N63-L105 PolarHBondContact ND2-O 3.15Å; K66-L105 HydrophobicContact CG-CD1 3.58Å; K66-L105 HydrophobicContact CG-CD2 4.19Å; K66-L105 HydrophobicContact CG-CG 4.43Å
106	I	84.9	Confident	86.5	Confident	125 Å²	125	105.3 Å²	105.3	64%	0.641	53%	0.531	S	S	*	.			trans	-98.4	112.3	166.5	-59.8	176.5	0	0	0	106.1	L108	I106-L108 PolarHBondContact O-N 3.26Å
107	P	88.6	Confident	85.1	Confident	32 Å²	32	102.9 Å²	102.9	21%	0.208	54%	0.54	C	S	.	.			trans	-64.2	132.4	-179.3	-11	20.6	0	0	0	111	N63 V65 K66 Y68	N63-P107 WeakPolarHBondContact ND2-CD 3.41Å; N63-P107 VanDerWaalsContact ND2-CG 3.32Å; N63-P107 WeakPolarHBondContact ND2-CG 3.34Å; V65-P107 HydrophobicContact CB-CB 4.47Å; V65-P107 HydrophobicContact CB-CG 4.34Å; V65-P107 HydrophobicContact CG1-CB 4.18Å; V65-P107 WeakPolarHBondContact O-CB 3.35Å; V65-P107 WeakPolarHBondContact O-CG 3.45Å; K66-P107 WeakPolarHBondContact O-CA 3.22Å; Y68-P107 HydrophobicContact CD2-CB 3.6Å; Y68-P107 HydrophobicContact CD2-CG 4.47Å; Y68-P107 HydrophobicContact CE2-CB 3.38Å; Y68-P107 HydrophobicContact CE2-CG 3.78Å
108	L	91.5	Very high	83.4	Confident	59 Å²	59	99.9 Å²	99.9	31%	0.309	53%	0.527	S	S	.	.	B	Isolated β-bridge	trans	-82.7	146.2	166.2	-64.8	177.2	0	0	0	110.5	K66 E67 Y68 Y78 L82 L91 I106	K66-L108 PolarHBondContact O-N 2.95Å; K66-L108 VanDerWaalsContact O-N 3.14Å; E67-L108 WeakPolarHBondContact CA-O 3.4Å; Y68-L108 PolarHBondContact N-O 3.42Å; Y78-L108 HydrophobicContact CE2-CB 4.43Å; Y78-L108 VanDerWaalsContact OH-CB 3.23Å; Y78-L108 WeakPolarHBondContact OH-CB 3.29Å; L82-L108 HydrophobicContact CD2-CD1 3.71Å; L91-L108 HydrophobicContact CD1-CD1 4.47Å; I106-L108 PolarHBondContact O-N 3.26Å
109	M	90.7	Very high	81.9	Confident	122 Å²	122	98.5 Å²	98.5	60%	0.601	53%	0.533	S	S	*	.			trans	-136.2	142.7	-179.2	-67.4	-172.4	-68.7	0	0	110.3	Y68	Y68-M109 HydrophobicContact CD2-CG 3.19Å; Y68-M109 HydrophobicContact CD2-SD 3.57Å; Y68-M109 VanDerWaalsContact CD2-SD 3.57Å; Y68-M109 HydrophobicContact CE2-CG 3.89Å; Y68-M109 HydrophobicContact CE2-SD 3.72Å; Y68-M109 HydrophobicContact CG-CG 3.88Å; Y68-M109 HydrophobicContact CG-SD 4.22Å
110	A	90.9	Very high	80.7	Confident	30 Å²	30	100.8 Å²	100.8	25%	0.248	55%	0.55	C	S	.	.			trans	-108.9	122.5	167.2	0	0	0	0	0	109.3	P70 Y78	P70-A110 HydrophobicContact CB-CB 3.83Å; P70-A110 HydrophobicContact CG-CB 4.09Å; Y78-A110 HydrophobicContact CD2-CB 3.62Å; Y78-A110 HydrophobicContact CE2-CB 4.35Å; Y78-A110 HydrophobicContact CG-CB 3.99Å
111	V	87.1	Confident	79.2	Confident	116 Å²	116	108.6 Å²	108.6	70%	0.703	58%	0.579	S	S	*	*			trans	-118.2	124.2	177.5	-178.6	0	0	0	0	109.4	Q113	V111-Q113 PolarHBondContact O-N 3.12Å
112	V	83.9	Confident	78.1	Confident	91 Å²	91	112.4 Å²	112.4	55%	0.552	60%	0.601	S	S	*	*			trans	-76	105.5	175.5	-178.8	0	0	0	0	109.2	A71 A74 R114	A71-V112 HydrophobicContact CB-CG2 4.38Å; A74-V112 HydrophobicContact CB-CG2 3.92Å; V112-R114 HydrophobicContact CG1-CG 4.43Å; V112-R114 PolarHBondContact O-N 3.09Å
113	Q	83.5	Confident	77.7	Confident	128 Å²	128	116 Å²	116	60%	0.598	61%	0.613	S	S	*	*			trans	-88.9	93.4	175.2	-70	-176.2	-32.2	0	0	110.7	V111 N115 K116	V111-Q113 PolarHBondContact O-N 3.12Å; Q113-N115 PolarHBondContact O-N 2.96Å; Q113-N115 VanDerWaalsContact O-N 3.15Å; Q113-K116 HydrophobicContact CB-CB 4Å; Q113-K116 VanDerWaalsContact O-CB 3.31Å; Q113-K116 WeakPolarHBondContact O-CB 2.87Å; Q113-K116 PolarHBondContact O-N 3.22Å; Q113-K116 VanDerWaalsContact O-N 3.11Å
114	R	79	Confident	77.4	Confident	226 Å²	226	113.8 Å²	113.8	85%	0.853	61%	0.61	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.4	-21.3	-179.7	-65.3	-176.5	-179.2	-179.7	0.2	114.8	V112	V112-R114 HydrophobicContact CG1-CG 4.43Å; V112-R114 PolarHBondContact O-N 3.09Å
115	N	79	Confident	77	Confident	108 Å²	108	118.6 Å²	118.6	58%	0.578	63%	0.628	S	S	*	*	T	Hydrogen-bonded Turn	trans	-97.4	2.8	179.9	-67.5	-28.2	0	0	0	113.2	Q113 G117 K118	Q113-N115 PolarHBondContact O-N 2.96Å; Q113-N115 VanDerWaalsContact O-N 3.15Å; N115-G117 PolarHBondContact O-N 3.28Å; N115-G117 VanDerWaalsContact O-N 3.08Å; N115-K118 HydrophobicContact CB-CD 4.42Å; N115-K118 PolarHBondContact O-N 2.65Å; N115-K118 VanDerWaalsContact O-N 3.12Å; N115-K118 PolarHBondContact OD1-NZ 3.49Å
116	K	66.6	Low	76.5	Confident	166 Å²	166	122.5 Å²	122.5	72%	0.722	65%	0.649	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63	114.3	178.2	-165	175.4	-177.5	-178.4	0	108.6	Q113	Q113-K116 HydrophobicContact CB-CB 4Å; Q113-K116 VanDerWaalsContact O-CB 3.31Å; Q113-K116 WeakPolarHBondContact O-CB 2.87Å; Q113-K116 PolarHBondContact O-N 3.22Å; Q113-K116 VanDerWaalsContact O-N 3.11Å
117	G	65.1	Low	75.9	Confident	77 Å²	77	122.4 Å²	122.4	79%	0.794	65%	0.649	S	S	*	*	T	Hydrogen-bonded Turn	trans	97.8	-1.8	-179.3	0	0	0	0	0	116.1	N115	N115-G117 PolarHBondContact O-N 3.28Å; N115-G117 VanDerWaalsContact O-N 3.08Å
118	K	61.1	Low	75.1	Confident	145 Å²	145	128.4 Å²	128.4	63%	0.63	68%	0.679	S	S	*	*			trans	-70.6	129.2	167.5	-73.8	-177.5	-178.1	170	0	109.1	N115 M120	N115-K118 HydrophobicContact CB-CD 4.42Å; N115-K118 PolarHBondContact O-N 2.65Å; N115-K118 VanDerWaalsContact O-N 3.12Å; N115-K118 PolarHBondContact OD1-NZ 3.49Å; K118-M120 PolarHBondContact O-N 2.65Å
119	P	61.2	Low	73.9	Confident	113 Å²	113	133.4 Å²	133.4	73%	0.734	71%	0.705	S	S	*	*			trans	-58.8	134.5	168.9	24.9	-30.9	0	0	0	108.3	Q121	P119-Q121 PolarHBondContact O-N 3.16Å; P119-Q121 VanDerWaalsContact O-N 3.11Å
120	M	62.3	Low	72.6	Confident	166 Å²	166	134.2 Å²	134.2	82%	0.818	71%	0.713	S	S	*	*			trans	-63.6	112.6	169.4	-171	175.9	179.9	0	0	106.5	K118 T122	K118-M120 PolarHBondContact O-N 2.65Å; M120-T122 HydrophobicContact CE-CG2 4.1Å; M120-T122 HydrophobicContact CG-CG2 4.34Å; M120-T122 PolarHBondContact O-N 3.18Å; M120-T122 HydrophobicContact SD-CG2 4.38Å
121	Q	60.2	Low	71.1	Confident	192 Å²	192	142.9 Å²	142.9	90%	0.897	75%	0.752	S	S	*	*			trans	-75.3	110.8	164.8	-71.8	-173.2	7.5	0	0	106.4	P119	P119-Q121 PolarHBondContact O-N 3.16Å; P119-Q121 VanDerWaalsContact O-N 3.11Å
122	T	64.4	Low	69.7	Low	187 Å²	187	145.4 Å²	145.4	100%	1.147	76%	0.757	S	S	*	*			trans	-102.1	0	165.9	35.3	0	0	0	0	109.4	M120	M120-T122 HydrophobicContact CE-CG2 4.1Å; M120-T122 HydrophobicContact CG-CG2 4.34Å; M120-T122 PolarHBondContact O-N 3.18Å; M120-T122 HydrophobicContact SD-CG2 4.38Å

Retrieved 122 of 122 residues in 185.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).