A0A077ZLY0_TRITR Loading...

DUF572 domain containing protein

AlphaFold DB , UniProt , Accession A0A077ZLY0, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 127 aa.

						>A0A077ZLY0_TRITR|A0A077ZLY0
MGLPIFRFYFRCPQCLAEITFKTDLKNCDYAQEHGSTRLFEAERLIREKEANEQAAEEEERTNPMTMLEKRTKMSRFEMEALDRLEELKEMNKRQANVNYDLMLAETRKSEFEERRQQQEEETALLR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	68.5	Low	90.6	Very high	217 Å²	217	121.9 Å²	121.9	100%	1.069	60%	0.601	S	S	*	*				0	111.2	0	-63.6	-56.7	-146	0	0	108.4	L3	M1-L3 HydrophobicContact CB-CD1 4.36Å; M1-L3 HydrophobicContact CB-CG 4.47Å; M1-L3 PolarHBondContact O-N 2.89Å; M1-L3 VanDerWaalsContact O-N 3.13Å
2	G	85.3	Confident	90.9	Very high	91 Å²	91	114 Å²	114	94%	0.938	57%	0.566	S	S	*	*			trans	-83.2	41	-178.7	0	0	0	0	0	113.5
3	L	89.4	Confident	91.2	Very high	100 Å²	100	114.8 Å²	114.8	52%	0.524	58%	0.584	S	S	.	*	P	Polyproline II helix	trans	-75.8	144	179.9	-68.6	167.4	0	0	0	109.8	M1 I5 L25	M1-L3 HydrophobicContact CB-CD1 4.36Å; M1-L3 HydrophobicContact CB-CG 4.47Å; M1-L3 PolarHBondContact O-N 2.89Å; M1-L3 VanDerWaalsContact O-N 3.13Å; L3-I5 PolarHBondContact O-N 3.09Å; L3-L25 HydrophobicContact CB-CD1 3.64Å; L3-L25 HydrophobicContact CD1-CD1 4.23Å; L3-L25 HydrophobicContact CD1-CD2 4.13Å
4	P	91.6	Very high	91.6	Very high	80 Å²	80	119.7 Å²	119.7	52%	0.519	60%	0.604	S	S	.	*	P	Polyproline II helix	trans	-64.3	137.7	176.8	27	-33.7	0	0	0	110.5	F6	P4-F6 HydrophobicContact CB-CE1 4.33Å; P4-F6 HydrophobicContact CB-CE2 3.92Å; P4-F6 HydrophobicContact CB-CZ 3.75Å; P4-F6 HydrophobicContact CG-CE2 3.62Å; P4-F6 HydrophobicContact CG-CZ 3.6Å
5	I	92.8	Very high	91.8	Very high	98 Å²	98	117.5 Å²	117.5	50%	0.503	60%	0.603	S	S	.	*	P	Polyproline II helix	trans	-99.4	120	171.8	-64.7	174.6	0	0	0	107.4	L3 K22 T23 L25	L3-I5 PolarHBondContact O-N 3.09Å; I5-K22 HydrophobicContact CG2-CD 4.09Å; I5-K22 VanDerWaalsContact CG2-CE 3.43Å; I5-K22 HydrophobicContact CG2-CG 3.53Å; I5-T23 WeakPolarHBondContact CA-OG1 3.48Å; I5-T23 WeakPolarHBondContact CG2-OG1 3.45Å; I5-L25 HydrophobicContact CG1-CD1 4.35Å
6	F	94	Very high	91.8	Very high	116 Å²	116	118 Å²	118	51%	0.509	61%	0.606	S	S	.	*	P	Polyproline II helix	trans	-97.1	143.9	-179.6	-61.6	-78.7	0	0	0	110.8	P4 F8 K22 T23	P4-F6 HydrophobicContact CB-CE1 4.33Å; P4-F6 HydrophobicContact CB-CE2 3.92Å; P4-F6 HydrophobicContact CB-CZ 3.75Å; P4-F6 HydrophobicContact CG-CE2 3.62Å; P4-F6 HydrophobicContact CG-CZ 3.6Å; F6-F8 HydrophobicContact CB-CE2 3.92Å; F6-F8 HydrophobicContact CB-CZ 3.93Å; F6-K22 WeakPolarHBondContact O-CA 3.45Å; F6-T23 HydrophobicContact CB-CG2 4.04Å; F6-T23 PolarHBondContact N-OG1 3.33Å; F6-T23 PolarHBondContact O-N 2.89Å; F6-T23 PolarHBondContact O-OG1 2.93Å
7	R	95.8	Very high	92	Very high	130 Å²	130	113.6 Å²	113.6	49%	0.491	59%	0.592	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-111.5	126.5	168.4	-77.2	-179.2	170.4	141.3	-3.3	109.2	Y9 F21 K22 E33	R7-Y9 HydrophobicContact CB-CE2 4.13Å; R7-F21 CarbonylContact C-O 3.51Å; R7-F21 VanDerWaalsContact CA-O 3.27Å; R7-F21 WeakPolarHBondContact CA-O 3.47Å; R7-K22 HydrophobicContact CG-CB 4.27Å; R7-K22 HydrophobicContact CG-CG 4.3Å; R7-E33 IonicContact CZ-OE1 2.9Å; R7-E33 VanDerWaalsContact CZ-OE1 3.31Å; R7-E33 IonicContact CZ-OE2 3.74Å; R7-E33 IonicContact NE-OE1 3.75Å; R7-E33 PolarHBondContact NE-OE1 3.15Å; R7-E33 IonicContact NE-OE2 3.27Å; R7-E33 PolarHBondContact NE-OE2 3.22Å; R7-E33 IonicContact NH2-OE1 3.9Å; R7-E33 PolarHBondContact NH2-OE1 3.02Å; R7-E33 IonicContact NH2-OE2 2.85Å
8	F	95.1	Very high	92.2	Very high	79 Å²	79	113.2 Å²	113.2	35%	0.346	59%	0.586	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-104.5	139.8	177.8	-60.1	-81.9	0	0	0	109.6	F6 F10 T20 F21 T23 Y30	F6-F8 HydrophobicContact CB-CE2 3.92Å; F6-F8 HydrophobicContact CB-CZ 3.93Å; F8-F10 HydrophobicContact CB-CD2 4.34Å; F8-F10 HydrophobicContact CB-CE2 3.53Å; F8-F10 HydrophobicContact CB-CZ 3.99Å; F8-T20 WeakPolarHBondContact O-CA 3.35Å; F8-F21 PolarHBondContact N-O 3.26Å; F8-F21 PolarHBondContact O-N 3.48Å; F8-T23 HydrophobicContact CE2-CG2 3.75Å; F8-Y30 HydrophobicContact CD2-CD1 4.42Å; F8-Y30 HydrophobicContact CD2-CE1 4.17Å; F8-Y30 HydrophobicContact CE2-CD1 4.36Å; F8-Y30 AromaticContact CE2-CE1 3.73Å; F8-Y30 HydrophobicContact CE2-CE1 3.73Å
9	Y	95.3	Very high	92.3	Very high	149 Å²	149	108.7 Å²	108.7	58%	0.584	56%	0.563	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-117.3	120.2	179.3	-63.4	-96.2	0	0	0	108.3	R7 T20	R7-Y9 HydrophobicContact CB-CE2 4.13Å; Y9-T20 HydrophobicContact CD1-CG2 3.47Å; Y9-T20 VanDerWaalsContact CD1-CG2 3.47Å; Y9-T20 HydrophobicContact CE1-CG2 3.53Å; Y9-T20 HydrophobicContact CG-CG2 4.37Å
10	F	93.6	Very high	92.5	Very high	107 Å²	107	103.8 Å²	103.8	47%	0.469	54%	0.538	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.4	156.9	174.3	-58.9	-84.8	0	0	0	109.3	F8 E18 I19 F21	F8-F10 HydrophobicContact CB-CD2 4.34Å; F8-F10 HydrophobicContact CB-CE2 3.53Å; F8-F10 HydrophobicContact CB-CZ 3.99Å; F10-E18 CarbonylContact O-C 3.55Å; F10-E18 WeakPolarHBondContact O-CA 3.47Å; F10-I19 HydrophobicContact CB-CB 4.32Å; F10-I19 PolarHBondContact N-O 2.79Å; F10-I19 PolarHBondContact O-N 3.29Å; F10-F21 AromaticContact CD2-CD2 3.92Å; F10-F21 HydrophobicContact CD2-CD2 3.92Å; F10-F21 HydrophobicContact CD2-CE2 4.17Å; F10-F21 AromaticContact CE2-CD2 3.61Å; F10-F21 HydrophobicContact CE2-CD2 3.61Å; F10-F21 HydrophobicContact CE2-CE2 4.14Å; F10-F21 HydrophobicContact CE2-CG 4.49Å
11	R	94.7	Very high	92.6	Very high	174 Å²	174	101.7 Å²	101.7	66%	0.657	53%	0.525	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-115.3	133.8	171.1	-69.6	-177.3	177.7	174.4	-1.5	109.4	A17 E18	R11-A17 WeakPolarHBondContact CA-O 3.26Å; R11-E18 HydrophobicContact CG-CG 4.33Å; R11-E18 IonicContact CZ-OE1 3.96Å; R11-E18 IonicContact NE-OE1 3.65Å; R11-E18 IonicContact NH2-OE1 3.34Å; R11-E18 PolarHBondContact NH2-OE1 2.88Å
12	C	94.4	Very high	93.9	Very high	27 Å²	27	94.6 Å²	94.6	18%	0.182	49%	0.488	C	S	.	.			trans	-65.7	130.1	173.9	178.6	0	0	0	0	109.8	Q14 C15 L16 A17 I19	C12-Q14 PolarHBondContact O-N 3.23Å; C12-C15 WeakPolarHBondContact CB-SG 3.31Å; C12-L16 VanDerWaalsContact O-CA 3.23Å; C12-L16 WeakPolarHBondContact O-CA 3.47Å; C12-L16 PolarHBondContact O-N 3.14Å; C12-A17 PolarHBondContact N-O 3.11Å; C12-I19 HydrophobicContact CB-CD1 4.33Å
13	P	95.5	Very high	94.3	Very high	124 Å²	124	91.2 Å²	91.2	81%	0.805	45%	0.449	S	S	*	.	T	Hydrogen-bonded Turn	trans	-64.7	-20.2	-178.8	25.4	-34.6	0	0	0	113.7
14	Q	96.1	Very high	94.5	Very high	184 Å²	184	88.7 Å²	88.7	86%	0.86	44%	0.436	S	S	*	.	T	Hydrogen-bonded Turn	trans	-96.9	-47.7	-177	-65.1	-174.3	-77.5	0	0	113.6	C12	C12-Q14 PolarHBondContact O-N 3.23Å
15	C	95.2	Very high	94.5	Very high	87 Å²	87	89.1 Å²	89.1	59%	0.588	43%	0.434	S	S	*	.	T	Hydrogen-bonded Turn	trans	-105.1	-3.6	-176	62.4	0	0	0	0	114	C12 A17	C12-C15 WeakPolarHBondContact CB-SG 3.31Å; C15-A17 PolarHBondContact O-N 3.45Å; C15-A17 VanDerWaalsContact SG-CB 3.54Å
16	L	92.1	Very high	94.4	Very high	125 Å²	125	93.7 Å²	93.7	65%	0.654	45%	0.45	S	S	*	.			trans	57	10.8	-176.1	-56.8	174.2	0	0	0	114.7	C12	C12-L16 VanDerWaalsContact O-CA 3.23Å; C12-L16 WeakPolarHBondContact O-CA 3.47Å; C12-L16 PolarHBondContact O-N 3.14Å
17	A	94.9	Very high	94.1	Very high	44 Å²	44	93.6 Å²	93.6	36%	0.364	46%	0.455	S	S	.	.			trans	-65.7	143.9	175	0	0	0	0	0	110.7	R11 C12 C15	R11-A17 WeakPolarHBondContact CA-O 3.26Å; C12-A17 PolarHBondContact N-O 3.11Å; C15-A17 PolarHBondContact O-N 3.45Å; C15-A17 VanDerWaalsContact SG-CB 3.54Å
18	E	94.6	Very high	93.8	Very high	105 Å²	105	93.4 Å²	93.4	49%	0.491	47%	0.472	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-81	128.3	178.8	-61.9	-171.2	159.4	0	0	110.5	F10 R11	F10-E18 CarbonylContact O-C 3.55Å; F10-E18 WeakPolarHBondContact O-CA 3.47Å; R11-E18 HydrophobicContact CG-CG 4.33Å; R11-E18 IonicContact CZ-OE1 3.96Å; R11-E18 IonicContact NE-OE1 3.65Å; R11-E18 IonicContact NH2-OE1 3.34Å; R11-E18 PolarHBondContact NH2-OE1 2.88Å
19	I	95.2	Very high	93.7	Very high	28 Å²	28	92.8 Å²	92.8	14%	0.144	47%	0.472	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.5	127.2	175.6	-57.2	170.8	0	0	0	107.4	F10 C12 F21 H34	F10-I19 HydrophobicContact CB-CB 4.32Å; F10-I19 PolarHBondContact N-O 2.79Å; F10-I19 PolarHBondContact O-N 3.29Å; C12-I19 HydrophobicContact CB-CD1 4.33Å; I19-F21 HydrophobicContact CG2-CD1 4.34Å; I19-F21 HydrophobicContact CG2-CE1 3.71Å; I19-F21 HydrophobicContact CG2-CE2 4.4Å; I19-F21 HydrophobicContact CG2-CZ 3.73Å; I19-H34 WeakPolarHBondContact CA-O 3.43Å
20	T	95.3	Very high	93.6	Very high	10 Å²	10	91.5 Å²	91.5	6%	0.061	47%	0.467	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.3	128.4	-176.8	55.2	0	0	0	0	112.4	F8 Y9 E33 H34	F8-T20 WeakPolarHBondContact O-CA 3.35Å; Y9-T20 HydrophobicContact CD1-CG2 3.47Å; Y9-T20 VanDerWaalsContact CD1-CG2 3.47Å; Y9-T20 HydrophobicContact CE1-CG2 3.53Å; Y9-T20 HydrophobicContact CG-CG2 4.37Å; T20-E33 PolarHBondContact O-N 3.24Å; T20-E33 WeakPolarHBondContact OG1-CB 3.27Å; T20-H34 PolarHBondContact N-O 3.48Å; T20-H34 WeakPolarHBondContact OG1-CB 3.44Å; T20-H34 PolarHBondContact OG1-N 2.89Å
21	F	95.4	Very high	93.6	Very high	61 Å²	61	88.4 Å²	88.4	27%	0.268	46%	0.462	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.6	143.5	174.6	-61.9	-31.9	0	0	0	110.9	R7 F8 F10 I19 A31 Q32	R7-F21 CarbonylContact C-O 3.51Å; R7-F21 VanDerWaalsContact CA-O 3.27Å; R7-F21 WeakPolarHBondContact CA-O 3.47Å; F8-F21 PolarHBondContact N-O 3.26Å; F8-F21 PolarHBondContact O-N 3.48Å; F10-F21 AromaticContact CD2-CD2 3.92Å; F10-F21 HydrophobicContact CD2-CD2 3.92Å; F10-F21 HydrophobicContact CD2-CE2 4.17Å; F10-F21 AromaticContact CE2-CD2 3.61Å; F10-F21 HydrophobicContact CE2-CD2 3.61Å; F10-F21 HydrophobicContact CE2-CE2 4.14Å; F10-F21 HydrophobicContact CE2-CG 4.49Å; I19-F21 HydrophobicContact CG2-CD1 4.34Å; I19-F21 HydrophobicContact CG2-CE1 3.71Å; I19-F21 HydrophobicContact CG2-CE2 4.4Å; I19-F21 HydrophobicContact CG2-CZ 3.73Å; F21-A31 CarbonylContact C-O 3.58Å; F21-A31 WeakPolarHBondContact CA-O 3.35Å; F21-Q32 HydrophobicContact CD1-CB 4.15Å; F21-Q32 HydrophobicContact CD1-CG 4.38Å; F21-Q32 HydrophobicContact CE1-CB 4.14Å; F21-Q32 HydrophobicContact CE1-CG 4.1Å
22	K	94.6	Very high	93.4	Very high	67 Å²	67	82.7 Å²	82.7	29%	0.291	44%	0.442	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.2	134.8	178.7	-179	178.4	176.2	-176.6	0	109.6	I5 F6 R7 D24 Y30 A31 E33	I5-K22 HydrophobicContact CG2-CD 4.09Å; I5-K22 VanDerWaalsContact CG2-CE 3.43Å; I5-K22 HydrophobicContact CG2-CG 3.53Å; F6-K22 WeakPolarHBondContact O-CA 3.45Å; R7-K22 HydrophobicContact CG-CB 4.27Å; R7-K22 HydrophobicContact CG-CG 4.3Å; K22-D24 PolarHBondContact O-N 3.27Å; K22-Y30 CarbonylContact O-C 3.58Å; K22-Y30 WeakPolarHBondContact O-CA 3.22Å; K22-A31 PolarHBondContact N-O 2.91Å; K22-A31 PolarHBondContact O-N 2.95Å; K22-E33 HydrophobicContact CB-CG 4.31Å; K22-E33 WeakPolarHBondContact CD-OE1 3.3Å
23	T	94.9	Very high	93.3	Very high	21 Å²	21	84.2 Å²	84.2	13%	0.129	45%	0.447	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-64.5	124.2	175.8	53.5	0	0	0	0	111.2	I5 F6 F8 Y30	I5-T23 WeakPolarHBondContact CA-OG1 3.48Å; I5-T23 WeakPolarHBondContact CG2-OG1 3.45Å; F6-T23 HydrophobicContact CB-CG2 4.04Å; F6-T23 PolarHBondContact N-OG1 3.33Å; F6-T23 PolarHBondContact O-N 2.89Å; F6-T23 PolarHBondContact O-OG1 2.93Å; F8-T23 HydrophobicContact CE2-CG2 3.75Å; T23-Y30 HydrophobicContact CG2-CD1 4.09Å; T23-Y30 HydrophobicContact CG2-CE1 3.72Å
24	D	92.8	Very high	93.1	Very high	47 Å²	47	84.5 Å²	84.5	25%	0.251	44%	0.437	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.3	100.1	171.4	-176.3	7.5	0	0	0	110.8	K22 K26 N27 C28 D29 A31	K22-D24 PolarHBondContact O-N 3.27Å; D24-K26 VanDerWaalsContact C-N 3.26Å; D24-K26 PolarHBondContact O-N 3.14Å; D24-K26 WeakPolarHBondContact OD1-CB 3.31Å; D24-K26 PolarHBondContact OD1-N 2.87Å; D24-N27 PolarHBondContact OD2-ND2 2.89Å; D24-C28 PolarHBondContact O-N 3.37Å; D24-D29 CarbonylContact C-O 3.45Å; D24-D29 WeakPolarHBondContact CA-O 3.26Å; D24-D29 WeakPolarHBondContact CB-O 3.23Å; D24-D29 PolarHBondContact N-O 2.93Å; D24-D29 PolarHBondContact O-N 3.23Å; D24-D29 VanDerWaalsContact O-N 3.14Å; D24-A31 HydrophobicContact CB-CB 4.48Å
25	L	92.1	Very high	92.8	Very high	88 Å²	88	78.3 Å²	78.3	46%	0.461	42%	0.423	S	S	.	.	T	Hydrogen-bonded Turn	trans	-70.6	-19.1	-178.8	-66.9	163.9	0	0	0	113.4	L3 I5	L3-L25 HydrophobicContact CB-CD1 3.64Å; L3-L25 HydrophobicContact CD1-CD1 4.23Å; L3-L25 HydrophobicContact CD1-CD2 4.13Å; I5-L25 HydrophobicContact CG1-CD1 4.35Å
26	K	89.9	Confident	92.6	Very high	194 Å²	194	76.9 Å²	76.9	84%	0.843	41%	0.413	S	S	*	.	T	Hydrogen-bonded Turn	trans	-73.4	-41.9	-179.3	-71.2	-176.3	175.5	-177.2	0	111.5	D24	D24-K26 VanDerWaalsContact C-N 3.26Å; D24-K26 PolarHBondContact O-N 3.14Å; D24-K26 WeakPolarHBondContact OD1-CB 3.31Å; D24-K26 PolarHBondContact OD1-N 2.87Å
27	N	87.9	Confident	92.6	Very high	115 Å²	115	76.7 Å²	76.7	62%	0.615	42%	0.418	S	S	*	.	T	Hydrogen-bonded Turn	trans	-101.1	1	-175	-62.1	-44.1	0	0	0	113.2	D24 D29	D24-N27 PolarHBondContact OD2-ND2 2.89Å; N27-D29 VanDerWaalsContact C-N 3.28Å; N27-D29 HydrophobicContact CB-CB 4.37Å; N27-D29 PolarHBondContact O-N 3.38Å
28	C	90.8	Very high	92.4	Very high	126 Å²	126	78.5 Å²	78.5	85%	0.851	42%	0.415	S	S	*	.	T	Hydrogen-bonded Turn	trans	53.7	43.8	-171.5	-61.4	0	0	0	0	112.4	D24	D24-C28 PolarHBondContact O-N 3.37Å
29	D	92.7	Very high	92.3	Very high	66 Å²	66	81.1 Å²	81.1	35%	0.353	43%	0.432	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-143.3	-178.3	-173.2	-162.6	-1.1	0	0	0	111.3	D24 N27 R38	D24-D29 CarbonylContact C-O 3.45Å; D24-D29 WeakPolarHBondContact CA-O 3.26Å; D24-D29 WeakPolarHBondContact CB-O 3.23Å; D24-D29 PolarHBondContact N-O 2.93Å; D24-D29 PolarHBondContact O-N 3.23Å; D24-D29 VanDerWaalsContact O-N 3.14Å; N27-D29 VanDerWaalsContact C-N 3.28Å; N27-D29 HydrophobicContact CB-CB 4.37Å; N27-D29 PolarHBondContact O-N 3.38Å; D29-R38 IonicContact OD1-CZ 3.92Å; D29-R38 IonicContact OD1-NH1 3.53Å; D29-R38 IonicContact OD1-NH2 2.67Å; D29-R38 PolarHBondContact OD1-NH2 3.05Å; D29-R38 IonicContact OD2-CZ 3.57Å; D29-R38 VanDerWaalsContact OD2-CZ 3.27Å; D29-R38 IonicContact OD2-NH1 3.96Å; D29-R38 PolarHBondContact OD2-NH1 3.1Å; D29-R38 IonicContact OD2-NH2 3.36Å; D29-R38 PolarHBondContact OD2-NH2 3.39Å
30	Y	93.2	Very high	92	Very high	122 Å²	122	87.5 Å²	87.5	48%	0.478	46%	0.459	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.7	115.3	177.8	-64.8	-84.6	0	0	0	112.1	F8 K22 T23 R38	F8-Y30 HydrophobicContact CD2-CD1 4.42Å; F8-Y30 HydrophobicContact CD2-CE1 4.17Å; F8-Y30 HydrophobicContact CE2-CD1 4.36Å; F8-Y30 AromaticContact CE2-CE1 3.73Å; F8-Y30 HydrophobicContact CE2-CE1 3.73Å; K22-Y30 CarbonylContact O-C 3.58Å; K22-Y30 WeakPolarHBondContact O-CA 3.22Å; T23-Y30 HydrophobicContact CG2-CD1 4.09Å; T23-Y30 HydrophobicContact CG2-CE1 3.72Å; Y30-R38 PolarHBondContact O-NH2 3Å
31	A	92.6	Very high	91.7	Very high	42 Å²	42	90.7 Å²	90.7	35%	0.347	47%	0.473	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-73	132.1	172.8	0	0	0	0	0	111.2	F21 K22 D24	F21-A31 CarbonylContact C-O 3.58Å; F21-A31 WeakPolarHBondContact CA-O 3.35Å; K22-A31 PolarHBondContact N-O 2.91Å; K22-A31 PolarHBondContact O-N 2.95Å; D24-A31 HydrophobicContact CB-CB 4.48Å
32	Q	91.9	Very high	91.6	Very high	53 Å²	53	90.4 Å²	90.4	25%	0.248	48%	0.482	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-83	129.9	173.9	172.9	157.4	43.7	0	0	111.1	F21 S36 T37	F21-Q32 HydrophobicContact CD1-CB 4.15Å; F21-Q32 HydrophobicContact CD1-CG 4.38Å; F21-Q32 HydrophobicContact CE1-CB 4.14Å; F21-Q32 HydrophobicContact CE1-CG 4.1Å; Q32-S36 VanDerWaalsContact CD-C 3.4Å; Q32-S36 PolarHBondContact NE2-O 3.48Å; Q32-S36 PolarHBondContact NE2-OG 2.93Å; Q32-S36 PolarHBondContact OE1-O 3.43Å; Q32-T37 VanDerWaalsContact OE1-C 3.22Å
33	E	92	Very high	91.4	Very high	60 Å²	60	94.3 Å²	94.3	28%	0.28	50%	0.501	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.1	-59.4	177.3	-70	-175	153.8	0	0	111.3	R7 T20 K22	R7-E33 IonicContact CZ-OE1 2.9Å; R7-E33 VanDerWaalsContact CZ-OE1 3.31Å; R7-E33 IonicContact CZ-OE2 3.74Å; R7-E33 IonicContact NE-OE1 3.75Å; R7-E33 PolarHBondContact NE-OE1 3.15Å; R7-E33 IonicContact NE-OE2 3.27Å; R7-E33 PolarHBondContact NE-OE2 3.22Å; R7-E33 IonicContact NH2-OE1 3.9Å; R7-E33 PolarHBondContact NH2-OE1 3.02Å; R7-E33 IonicContact NH2-OE2 2.85Å; T20-E33 PolarHBondContact O-N 3.24Å; T20-E33 WeakPolarHBondContact OG1-CB 3.27Å; K22-E33 HydrophobicContact CB-CG 4.31Å; K22-E33 WeakPolarHBondContact CD-OE1 3.3Å
34	H	91.1	Very high	91.1	Very high	130 Å²	130	100.3 Å²	100.3	60%	0.602	52%	0.522	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-140.8	156.1	-175.1	-54.9	-59.3	0	0	0	113.2	I19 T20 S36	I19-H34 WeakPolarHBondContact CA-O 3.43Å; T20-H34 PolarHBondContact N-O 3.48Å; T20-H34 WeakPolarHBondContact OG1-CB 3.44Å; T20-H34 PolarHBondContact OG1-N 2.89Å; H34-S36 PolarHBondContact O-N 3.17Å
35	G	90.3	Very high	91	Very high	54 Å²	54	101.5 Å²	101.5	56%	0.557	53%	0.528	S	S	*	.	S	Bend	trans	87.7	-2.5	162.7	0	0	0	0	0	117.3
36	S	90.3	Very high	91.1	Very high	56 Å²	56	101.6 Å²	101.6	39%	0.392	53%	0.528	S	S	.	.			trans	-156.1	172.8	176.6	148.5	0	0	0	0	110.3	Q32 H34	Q32-S36 VanDerWaalsContact CD-C 3.4Å; Q32-S36 PolarHBondContact NE2-O 3.48Å; Q32-S36 PolarHBondContact NE2-OG 2.93Å; Q32-S36 PolarHBondContact OE1-O 3.43Å; H34-S36 PolarHBondContact O-N 3.17Å
37	T	92.3	Very high	91.2	Very high	122 Å²	122	100.1 Å²	100.1	75%	0.748	52%	0.517	S	S	*	.			trans	-121.4	148.2	167.2	50.6	0	0	0	0	109.3	Q32	Q32-T37 VanDerWaalsContact OE1-C 3.22Å
38	R	90.8	Very high	91.3	Very high	82 Å²	82	99.7 Å²	99.7	31%	0.309	51%	0.511	S	S	.	.	P	Polyproline II helix	trans	-68.3	147.4	170.9	-76.9	-160.3	170.3	-159.1	0.2	111	D29 Y30 E41	D29-R38 IonicContact OD1-CZ 3.92Å; D29-R38 IonicContact OD1-NH1 3.53Å; D29-R38 IonicContact OD1-NH2 2.67Å; D29-R38 PolarHBondContact OD1-NH2 3.05Å; D29-R38 IonicContact OD2-CZ 3.57Å; D29-R38 VanDerWaalsContact OD2-CZ 3.27Å; D29-R38 IonicContact OD2-NH1 3.96Å; D29-R38 PolarHBondContact OD2-NH1 3.1Å; D29-R38 IonicContact OD2-NH2 3.36Å; D29-R38 PolarHBondContact OD2-NH2 3.39Å; Y30-R38 PolarHBondContact O-NH2 3Å; R38-E41 IonicContact CZ-OE1 2.95Å; R38-E41 IonicContact NH1-OE1 2.8Å; R38-E41 PolarHBondContact NH1-OE1 2.98Å; R38-E41 IonicContact NH1-OE2 3.06Å
39	L	91.8	Very high	91.5	Very high	159 Å²	159	100.2 Å²	100.2	83%	0.832	50%	0.499	S	S	*	.	P	Polyproline II helix	trans	-67.8	155.2	164.7	-69.4	162.3	0	0	0	109.2	E41	L39-E41 PolarHBondContact O-N 3.43Å
40	F	90.4	Very high	91.6	Very high	163 Å²	163	101.7 Å²	101.7	72%	0.715	50%	0.503	S	S	*	.	P	Polyproline II helix	trans	-62.7	127.8	174.8	175	-92.5	0	0	0	110.7	A42 L45	F40-A42 HydrophobicContact CE1-CB 4.16Å; F40-L45 HydrophobicContact CD2-CD1 4.19Å; F40-L45 HydrophobicContact CE1-CD1 4.39Å; F40-L45 HydrophobicContact CE2-CD1 3.15Å; F40-L45 HydrophobicContact CE2-CG 4.35Å; F40-L45 HydrophobicContact CZ-CD1 3.28Å
41	E	88.6	Confident	91.6	Very high	76 Å²	76	98.3 Å²	98.3	36%	0.355	50%	0.501	S	S	.	.			trans	-113.7	105.6	179.6	-70.5	168	-159.2	0	0	109.3	R38 L39 E43 R44 L45	R38-E41 IonicContact CZ-OE1 2.95Å; R38-E41 IonicContact NH1-OE1 2.8Å; R38-E41 PolarHBondContact NH1-OE1 2.98Å; R38-E41 IonicContact NH1-OE2 3.06Å; L39-E41 PolarHBondContact O-N 3.43Å; E41-E43 VanDerWaalsContact C-N 3.26Å; E41-E43 PolarHBondContact O-N 2.93Å; E41-R44 HydrophobicContact CB-CB 3.92Å; E41-R44 PolarHBondContact O-N 3.5Å; E41-L45 PolarHBondContact O-N 2.88Å
42	A	92.5	Very high	91.6	Very high	56 Å²	56	101.2 Å²	101.2	46%	0.463	51%	0.51	S	S	.	.	H	α-helix	trans	-59.5	-38.2	179.4	0	0	0	0	0	112	F40 R44 L45 I46	F40-A42 HydrophobicContact CE1-CB 4.16Å; A42-R44 VanDerWaalsContact C-N 3.32Å; A42-R44 PolarHBondContact O-N 3.26Å; A42-L45 PolarHBondContact O-N 3.36Å; A42-I46 WeakPolarHBondContact O-CG1 3.37Å; A42-I46 PolarHBondContact O-N 2.91Å
43	E	90.4	Very high	91.6	Very high	149 Å²	149	105 Å²	105	70%	0.696	53%	0.528	S	S	*	.	H	α-helix	trans	-61.3	-38.6	178.3	-63.3	-175.7	166.5	0	0	112.7	E41 L45 I46 R47	E41-E43 VanDerWaalsContact C-N 3.26Å; E41-E43 PolarHBondContact O-N 2.93Å; E43-L45 VanDerWaalsContact C-N 3.35Å; E43-I46 PolarHBondContact O-N 3.21Å; E43-R47 WeakPolarHBondContact O-CB 3.4Å; E43-R47 PolarHBondContact O-N 3.16Å
44	R	88.5	Confident	91.6	Very high	147 Å²	147	108.1 Å²	108.1	56%	0.555	54%	0.543	S	S	*	.	H	α-helix	trans	-65.7	-40.2	178.7	-176.9	176.7	168.6	-175.2	-3.7	111.3	E41 A42 R47 E48	E41-R44 HydrophobicContact CB-CB 3.92Å; E41-R44 PolarHBondContact O-N 3.5Å; A42-R44 VanDerWaalsContact C-N 3.32Å; A42-R44 PolarHBondContact O-N 3.26Å; R44-R47 PolarHBondContact O-N 3.07Å; R44-E48 PolarHBondContact O-N 3.48Å
45	L	91.5	Very high	91.6	Very high	72 Å²	72	104.9 Å²	104.9	38%	0.377	54%	0.539	S	S	.	.	H	α-helix	trans	-68.9	-38.1	175.7	-74.8	177.7	0	0	0	112.9	F40 E41 A42 E43 R47 E48 K49	F40-L45 HydrophobicContact CD2-CD1 4.19Å; F40-L45 HydrophobicContact CE1-CD1 4.39Å; F40-L45 HydrophobicContact CE2-CD1 3.15Å; F40-L45 HydrophobicContact CE2-CG 4.35Å; F40-L45 HydrophobicContact CZ-CD1 3.28Å; E41-L45 PolarHBondContact O-N 2.88Å; A42-L45 PolarHBondContact O-N 3.36Å; E43-L45 VanDerWaalsContact C-N 3.35Å; L45-R47 VanDerWaalsContact C-N 3.35Å; L45-E48 PolarHBondContact O-N 2.94Å; L45-K49 WeakPolarHBondContact O-CB 3.44Å; L45-K49 WeakPolarHBondContact O-CG 3.48Å; L45-K49 PolarHBondContact O-N 2.9Å
46	I	93.6	Very high	91.5	Very high	90 Å²	90	104.5 Å²	104.5	46%	0.462	53%	0.53	S	S	.	.	H	α-helix	trans	-61	-48.4	174.2	-68.5	165.4	0	0	0	109.2	A42 E43 E48 K49 E50	A42-I46 WeakPolarHBondContact O-CG1 3.37Å; A42-I46 PolarHBondContact O-N 2.91Å; E43-I46 PolarHBondContact O-N 3.21Å; I46-E48 VanDerWaalsContact C-N 3.34Å; I46-E48 PolarHBondContact O-N 3.2Å; I46-K49 PolarHBondContact O-N 3.41Å; I46-K49 VanDerWaalsContact O-N 3.16Å; I46-E50 HydrophobicContact CG2-CG 4.21Å; I46-E50 WeakPolarHBondContact CG2-OE1 3.48Å; I46-E50 WeakPolarHBondContact O-CB 3.43Å; I46-E50 WeakPolarHBondContact O-CG 3.34Å; I46-E50 PolarHBondContact O-N 3.32Å
47	R	91.2	Very high	91.4	Very high	162 Å²	162	106.2 Å²	106.2	61%	0.611	53%	0.532	S	S	*	.	H	α-helix	trans	-60.1	-41.1	178.7	-170.1	-177.5	-64.2	146.7	3.7	113.1	E43 R44 L45 A51	E43-R47 WeakPolarHBondContact O-CB 3.4Å; E43-R47 PolarHBondContact O-N 3.16Å; R44-R47 PolarHBondContact O-N 3.07Å; L45-R47 VanDerWaalsContact C-N 3.35Å; R47-A51 WeakPolarHBondContact O-CB 3.44Å; R47-A51 PolarHBondContact O-N 3.48Å
48	E	91.5	Very high	91.1	Very high	107 Å²	107	106.6 Å²	106.6	50%	0.5	53%	0.525	S	S	.	.	H	α-helix	trans	-66.6	-40.9	176.4	-174.7	176.1	-177.2	0	0	111.8	R44 L45 I46 A51 N52	R44-E48 PolarHBondContact O-N 3.48Å; L45-E48 PolarHBondContact O-N 2.94Å; I46-E48 VanDerWaalsContact C-N 3.34Å; I46-E48 PolarHBondContact O-N 3.2Å; E48-A51 PolarHBondContact O-N 2.9Å; E48-N52 VanDerWaalsContact O-CG 3.25Å; E48-N52 PolarHBondContact O-N 2.96Å; E48-N52 PolarHBondContact O-ND2 3.39Å
49	K	94.1	Very high	90.8	Very high	136 Å²	136	110 Å²	110	59%	0.591	55%	0.545	S	S	*	.	H	α-helix	trans	-63.7	-47.6	174.3	-76.1	-177.2	176.2	-171.4	0	112	L45 I46 A51 N52 E53	L45-K49 WeakPolarHBondContact O-CB 3.44Å; L45-K49 WeakPolarHBondContact O-CG 3.48Å; L45-K49 PolarHBondContact O-N 2.9Å; I46-K49 PolarHBondContact O-N 3.41Å; I46-K49 VanDerWaalsContact O-N 3.16Å; K49-A51 VanDerWaalsContact C-N 3.31Å; K49-A51 PolarHBondContact O-N 2.94Å; K49-N52 PolarHBondContact O-N 3.5Å; K49-N52 VanDerWaalsContact O-N 3.17Å; K49-E53 WeakPolarHBondContact O-CB 3.36Å; K49-E53 WeakPolarHBondContact O-CG 3.33Å; K49-E53 PolarHBondContact O-N 2.84Å
50	E	94	Very high	90.4	Very high	97 Å²	97	105.8 Å²	105.8	45%	0.453	52%	0.521	S	S	.	.	H	α-helix	trans	-59.1	-42.3	177.2	-73.2	173.5	170.4	0	0	111.5	I46 N52 E53 Q54	I46-E50 HydrophobicContact CG2-CG 4.21Å; I46-E50 WeakPolarHBondContact CG2-OE1 3.48Å; I46-E50 WeakPolarHBondContact O-CB 3.43Å; I46-E50 WeakPolarHBondContact O-CG 3.34Å; I46-E50 PolarHBondContact O-N 3.32Å; E50-N52 PolarHBondContact O-N 2.66Å; E50-E53 PolarHBondContact O-N 3.47Å; E50-Q54 WeakPolarHBondContact O-CB 3.47Å; E50-Q54 VanDerWaalsContact O-CG 3.22Å; E50-Q54 WeakPolarHBondContact O-CG 3.28Å; E50-Q54 PolarHBondContact O-N 2.81Å
51	A	93.5	Very high	90.1	Very high	51 Å²	51	105.6 Å²	105.6	42%	0.421	52%	0.515	S	S	.	.	H	α-helix	trans	-63.6	-40	176.5	0	0	0	0	0	112.4	R47 E48 K49 A55	R47-A51 WeakPolarHBondContact O-CB 3.44Å; R47-A51 PolarHBondContact O-N 3.48Å; E48-A51 PolarHBondContact O-N 2.9Å; K49-A51 VanDerWaalsContact C-N 3.31Å; K49-A51 PolarHBondContact O-N 2.94Å; A51-A55 WeakPolarHBondContact O-CB 3.41Å; A51-A55 PolarHBondContact O-N 3.14Å
52	N	93.3	Very high	89.9	Confident	103 Å²	103	107.5 Å²	107.5	55%	0.551	53%	0.532	S	S	*	.	H	α-helix	trans	-69.2	-40.2	176.1	-69.9	-24.4	0	0	0	112.1	E48 K49 E50 A55 A56	E48-N52 VanDerWaalsContact O-CG 3.25Å; E48-N52 PolarHBondContact O-N 2.96Å; E48-N52 PolarHBondContact O-ND2 3.39Å; K49-N52 PolarHBondContact O-N 3.5Å; K49-N52 VanDerWaalsContact O-N 3.17Å; E50-N52 PolarHBondContact O-N 2.66Å; N52-A55 PolarHBondContact O-N 3.44Å; N52-A56 PolarHBondContact O-N 3.45Å
53	E	92.4	Very high	89.7	Confident	133 Å²	133	108.4 Å²	108.4	62%	0.621	53%	0.529	S	S	*	.	H	α-helix	trans	-63.9	-42.2	175.3	-74.6	174.8	-176.1	0	0	111.3	K49 E50 A56 E57	K49-E53 WeakPolarHBondContact O-CB 3.36Å; K49-E53 WeakPolarHBondContact O-CG 3.33Å; K49-E53 PolarHBondContact O-N 2.84Å; E50-E53 PolarHBondContact O-N 3.47Å; E53-A56 PolarHBondContact O-N 2.94Å; E53-E57 WeakPolarHBondContact O-CB 3.47Å; E53-E57 PolarHBondContact O-N 3.11Å
54	Q	91.8	Very high	89.6	Confident	126 Å²	126	105.8 Å²	105.8	59%	0.589	53%	0.525	S	S	*	.	H	α-helix	trans	-63.2	-42.3	174.5	-74.8	173.1	12.6	0	0	112.1	E50 A56 E57 E58	E50-Q54 WeakPolarHBondContact O-CB 3.47Å; E50-Q54 VanDerWaalsContact O-CG 3.22Å; E50-Q54 WeakPolarHBondContact O-CG 3.28Å; E50-Q54 PolarHBondContact O-N 2.81Å; Q54-A56 VanDerWaalsContact C-N 3.35Å; Q54-A56 PolarHBondContact O-N 3.29Å; Q54-E57 PolarHBondContact O-N 3.42Å; Q54-E58 WeakPolarHBondContact O-CB 3.34Å; Q54-E58 PolarHBondContact O-N 2.99Å
55	A	91.3	Very high	89.7	Confident	62 Å²	62	104.2 Å²	104.2	51%	0.512	53%	0.525	S	S	.	.	H	α-helix	trans	-63.1	-41.5	176.9	0	0	0	0	0	112.1	A51 N52 E58 E59	A51-A55 WeakPolarHBondContact O-CB 3.41Å; A51-A55 PolarHBondContact O-N 3.14Å; N52-A55 PolarHBondContact O-N 3.44Å; A55-E58 PolarHBondContact O-N 3.35Å; A55-E59 PolarHBondContact O-N 3.4Å; A55-E59 VanDerWaalsContact O-N 3.12Å
56	A	88.3	Confident	89.6	Confident	46 Å²	46	103 Å²	103	38%	0.38	52%	0.521	S	S	.	.	H	α-helix	trans	-65.2	-40.1	174.4	0	0	0	0	0	111.8	N52 E53 Q54 E59 E60	N52-A56 PolarHBondContact O-N 3.45Å; E53-A56 PolarHBondContact O-N 2.94Å; Q54-A56 VanDerWaalsContact C-N 3.35Å; Q54-A56 PolarHBondContact O-N 3.29Å; A56-E59 PolarHBondContact O-N 3.49Å; A56-E60 WeakPolarHBondContact O-CG 3.33Å; A56-E60 PolarHBondContact O-N 2.93Å
57	E	87.1	Confident	89.5	Confident	91 Å²	91	100.2 Å²	100.2	43%	0.425	51%	0.507	S	S	.	.	H	α-helix	trans	-66.9	-37.8	176.2	-170.4	174.3	-171	0	0	112.2	E53 Q54 E60 R61	E53-E57 WeakPolarHBondContact O-CB 3.47Å; E53-E57 PolarHBondContact O-N 3.11Å; Q54-E57 PolarHBondContact O-N 3.42Å; E57-E60 PolarHBondContact O-N 3.07Å; E57-R61 HydrophobicContact CG-CG 4.43Å; E57-R61 WeakPolarHBondContact O-CB 3.34Å; E57-R61 WeakPolarHBondContact O-CG 3.25Å; E57-R61 PolarHBondContact O-N 2.9Å
58	E	87.3	Confident	89.4	Confident	131 Å²	131	97 Å²	97	61%	0.612	50%	0.501	S	S	*	.	H	α-helix	trans	-62.6	-41.9	174.8	-165.7	92.8	-160.2	0	0	111.4	Q54 A55 R61 T62	Q54-E58 WeakPolarHBondContact O-CB 3.34Å; Q54-E58 PolarHBondContact O-N 2.99Å; A55-E58 PolarHBondContact O-N 3.35Å; E58-R61 PolarHBondContact O-N 3.48Å; E58-T62 PolarHBondContact O-N 2.99Å; E58-T62 VanDerWaalsContact O-N 3.12Å; E58-T62 PolarHBondContact O-OG1 3.4Å
59	E	83.9	Confident	89.4	Confident	153 Å²	153	97.6 Å²	97.6	72%	0.715	50%	0.504	S	S	*	.	H	α-helix	trans	-63.5	-45.7	174.2	-171.9	177.5	-174.7	0	0	111.2	A55 A56 R61 T62	A55-E59 PolarHBondContact O-N 3.4Å; A55-E59 VanDerWaalsContact O-N 3.12Å; A56-E59 PolarHBondContact O-N 3.49Å; E59-R61 VanDerWaalsContact C-N 3.3Å; E59-R61 PolarHBondContact O-N 3.49Å; E59-T62 VanDerWaalsContact O-CB 3.29Å; E59-T62 WeakPolarHBondContact O-CB 3.48Å; E59-T62 PolarHBondContact O-N 3.44Å; E59-T62 VanDerWaalsContact O-N 3.15Å
60	E	82.7	Confident	89.3	Confident	70 Å²	70	95.3 Å²	95.3	33%	0.327	49%	0.494	S	S	.	.	H	α-helix	trans	-61.1	-38.4	175	-74.9	178.3	175.1	0	0	112	A56 E57 T62 N63 T66 M67 K70	A56-E60 WeakPolarHBondContact O-CG 3.33Å; A56-E60 PolarHBondContact O-N 2.93Å; E57-E60 PolarHBondContact O-N 3.07Å; E60-T62 PolarHBondContact O-N 2.89Å; E60-N63 PolarHBondContact O-N 3.34Å; E60-T66 PolarHBondContact O-OG1 3.04Å; E60-M67 HydrophobicContact CB-SD 4.2Å; E60-M67 WeakPolarHBondContact O-CG 3.29Å; E60-K70 IonicContact OE1-NZ 3.39Å; E60-K70 VanDerWaalsContact OE2-CD 3.28Å; E60-K70 WeakPolarHBondContact OE2-CD 3.49Å; E60-K70 WeakPolarHBondContact OE2-CE 3.42Å; E60-K70 IonicContact OE2-NZ 2.66Å; E60-K70 PolarHBondContact OE2-NZ 2.92Å
61	R	83.5	Confident	89.1	Confident	159 Å²	159	98.6 Å²	98.6	60%	0.6	50%	0.502	S	S	*	.	H	α-helix	trans	-67	-25.5	177.7	-76.8	177.9	76.2	178.4	4.2	113.3	E57 E58 E59 N63 M67	E57-R61 HydrophobicContact CG-CG 4.43Å; E57-R61 WeakPolarHBondContact O-CB 3.34Å; E57-R61 WeakPolarHBondContact O-CG 3.25Å; E57-R61 PolarHBondContact O-N 2.9Å; E58-R61 PolarHBondContact O-N 3.48Å; E59-R61 VanDerWaalsContact C-N 3.3Å; E59-R61 PolarHBondContact O-N 3.49Å; R61-N63 PolarHBondContact O-N 3.29Å; R61-M67 HydrophobicContact CB-SD 4.29Å; R61-M67 HydrophobicContact CG-CE 3.69Å; R61-M67 HydrophobicContact CG-CG 4.39Å; R61-M67 HydrophobicContact CG-SD 3.59Å; R61-M67 VanDerWaalsContact CG-SD 3.59Å
62	T	85.8	Confident	89.2	Confident	116 Å²	116	100.6 Å²	100.6	71%	0.712	51%	0.509	S	S	*	.	H	α-helix	trans	-64.9	-29.2	177.1	-57.2	0	0	0	0	111.2	E58 E59 E60	E58-T62 PolarHBondContact O-N 2.99Å; E58-T62 VanDerWaalsContact O-N 3.12Å; E58-T62 PolarHBondContact O-OG1 3.4Å; E59-T62 VanDerWaalsContact O-CB 3.29Å; E59-T62 WeakPolarHBondContact O-CB 3.48Å; E59-T62 PolarHBondContact O-N 3.44Å; E59-T62 VanDerWaalsContact O-N 3.15Å; E60-T62 PolarHBondContact O-N 2.89Å
63	N	87.5	Confident	89.3	Confident	76 Å²	76	102.2 Å²	102.2	41%	0.406	51%	0.511	S	S	.	.	S	Bend	trans	-105.4	115	175.8	-175.5	-24.5	0	0	0	111.3	E60 R61 M65 T66 M67	E60-N63 PolarHBondContact O-N 3.34Å; R61-N63 PolarHBondContact O-N 3.29Å; N63-M65 VanDerWaalsContact C-N 3.28Å; N63-M65 PolarHBondContact O-N 3.11Å; N63-M65 WeakPolarHBondContact OD1-CB 3.27Å; N63-M65 PolarHBondContact OD1-N 3.09Å; N63-T66 HydrophobicContact CB-CG2 4.27Å; N63-T66 WeakPolarHBondContact CB-OG1 3.31Å; N63-T66 PolarHBondContact O-N 2.88Å; N63-T66 PolarHBondContact O-OG1 3.1Å; N63-M67 PolarHBondContact O-N 3.49Å
64	P	89	Confident	89.4	Confident	93 Å²	93	100.5 Å²	100.5	60%	0.604	50%	0.504	S	S	*	.	H	α-helix	trans	-66.5	-27.1	-177	26.3	-34.3	0	0	0	113.4	L68	P64-L68 WeakPolarHBondContact O-CG 3.2Å; P64-L68 PolarHBondContact O-N 2.97Å
65	M	91	Very high	89.6	Confident	114 Å²	114	97.5 Å²	97.5	56%	0.562	50%	0.498	S	S	*	.	H	α-helix	trans	-72.3	-43.4	179.7	-73.5	-62.9	-63.2	0	0	111.8	N63 M67 L68 E69	N63-M65 VanDerWaalsContact C-N 3.28Å; N63-M65 PolarHBondContact O-N 3.11Å; N63-M65 WeakPolarHBondContact OD1-CB 3.27Å; N63-M65 PolarHBondContact OD1-N 3.09Å; M65-M67 VanDerWaalsContact C-N 3.29Å; M65-M67 PolarHBondContact O-N 3.35Å; M65-L68 WeakPolarHBondContact O-CB 3.46Å; M65-L68 PolarHBondContact O-N 3.44Å; M65-L68 VanDerWaalsContact O-N 3.12Å; M65-L68 HydrophobicContact SD-CD1 4.47Å; M65-E69 WeakPolarHBondContact O-CG 3.29Å; M65-E69 PolarHBondContact O-N 2.91Å
66	T	89.5	Confident	89.9	Confident	48 Å²	48	101.7 Å²	101.7	29%	0.294	50%	0.5	S	S	.	.	H	α-helix	trans	-62.7	-38.1	177.7	47.4	0	0	0	0	111.4	E60 N63 L68 E69 K70	E60-T66 PolarHBondContact O-OG1 3.04Å; N63-T66 HydrophobicContact CB-CG2 4.27Å; N63-T66 WeakPolarHBondContact CB-OG1 3.31Å; N63-T66 PolarHBondContact O-N 2.88Å; N63-T66 PolarHBondContact O-OG1 3.1Å; T66-L68 PolarHBondContact O-N 2.92Å; T66-E69 PolarHBondContact O-N 3.13Å; T66-K70 WeakPolarHBondContact O-CB 3.41Å; T66-K70 PolarHBondContact O-N 2.96Å
67	M	89.6	Confident	90.3	Very high	31 Å²	31	105.4 Å²	105.4	15%	0.153	51%	0.508	C	S	.	.	H	α-helix	trans	-61.3	-42	173.3	-71.6	-61.9	-68.6	0	0	112.8	E60 R61 N63 M65 R71	E60-M67 HydrophobicContact CB-SD 4.2Å; E60-M67 WeakPolarHBondContact O-CG 3.29Å; R61-M67 HydrophobicContact CB-SD 4.29Å; R61-M67 HydrophobicContact CG-CE 3.69Å; R61-M67 HydrophobicContact CG-CG 4.39Å; R61-M67 HydrophobicContact CG-SD 3.59Å; R61-M67 VanDerWaalsContact CG-SD 3.59Å; N63-M67 PolarHBondContact O-N 3.49Å; M65-M67 VanDerWaalsContact C-N 3.29Å; M65-M67 PolarHBondContact O-N 3.35Å; M67-R71 WeakPolarHBondContact O-CB 3.46Å; M67-R71 VanDerWaalsContact O-CG 3.3Å; M67-R71 WeakPolarHBondContact O-CG 3.45Å; M67-R71 PolarHBondContact O-N 3.13Å
68	L	90.5	Very high	90.7	Very high	94 Å²	94	106.4 Å²	106.4	49%	0.492	51%	0.513	S	S	.	.	H	α-helix	trans	-67.3	-41.5	176.7	-72.6	169.7	0	0	0	111.6	P64 M65 T66 R71 T72	P64-L68 WeakPolarHBondContact O-CG 3.2Å; P64-L68 PolarHBondContact O-N 2.97Å; M65-L68 WeakPolarHBondContact O-CB 3.46Å; M65-L68 PolarHBondContact O-N 3.44Å; M65-L68 VanDerWaalsContact O-N 3.12Å; M65-L68 HydrophobicContact SD-CD1 4.47Å; T66-L68 PolarHBondContact O-N 2.92Å; L68-R71 PolarHBondContact O-N 3.25Å; L68-T72 WeakPolarHBondContact O-CG2 3.35Å; L68-T72 PolarHBondContact O-N 3.25Å; L68-T72 PolarHBondContact O-OG1 3.48Å
69	E	91.5	Very high	91.2	Very high	119 Å²	119	105.6 Å²	105.6	56%	0.556	51%	0.51	S	S	*	.	H	α-helix	trans	-61.6	-43.7	175.5	-72.6	176.8	179.6	0	0	111.9	M65 T66 T72 K73	M65-E69 WeakPolarHBondContact O-CG 3.29Å; M65-E69 PolarHBondContact O-N 2.91Å; T66-E69 PolarHBondContact O-N 3.13Å; E69-T72 WeakPolarHBondContact CA-OG1 3.34Å; E69-T72 PolarHBondContact O-N 2.99Å; E69-T72 PolarHBondContact O-OG1 3.18Å; E69-K73 VanDerWaalsContact O-CB 3.28Å; E69-K73 WeakPolarHBondContact O-CB 3.47Å; E69-K73 PolarHBondContact O-N 3Å
70	K	90.6	Very high	91.8	Very high	89 Å²	89	102.1 Å²	102.1	39%	0.387	49%	0.494	S	S	.	.	H	α-helix	trans	-62.8	-46.6	175.9	-171.1	176	-176.1	177.1	0	111.3	E60 T66 T72 K73 M74	E60-K70 IonicContact OE1-NZ 3.39Å; E60-K70 VanDerWaalsContact OE2-CD 3.28Å; E60-K70 WeakPolarHBondContact OE2-CD 3.49Å; E60-K70 WeakPolarHBondContact OE2-CE 3.42Å; E60-K70 IonicContact OE2-NZ 2.66Å; E60-K70 PolarHBondContact OE2-NZ 2.92Å; T66-K70 WeakPolarHBondContact O-CB 3.41Å; T66-K70 PolarHBondContact O-N 2.96Å; K70-T72 PolarHBondContact O-N 3.32Å; K70-K73 PolarHBondContact O-N 3.37Å; K70-M74 HydrophobicContact CG-CG 4.5Å; K70-M74 WeakPolarHBondContact O-CB 3.42Å; K70-M74 VanDerWaalsContact O-CG 3.27Å; K70-M74 WeakPolarHBondContact O-CG 3.3Å; K70-M74 PolarHBondContact O-N 3.28Å
71	R	91.6	Very high	92.5	Very high	165 Å²	165	100.2 Å²	100.2	62%	0.623	49%	0.49	S	S	*	.	H	α-helix	trans	-60.4	-45.7	177.9	-75.4	176.5	-174.9	178	2.8	112.4	M67 L68 M74 S75	M67-R71 WeakPolarHBondContact O-CB 3.46Å; M67-R71 VanDerWaalsContact O-CG 3.3Å; M67-R71 WeakPolarHBondContact O-CG 3.45Å; M67-R71 PolarHBondContact O-N 3.13Å; L68-R71 PolarHBondContact O-N 3.25Å; R71-M74 PolarHBondContact O-N 2.93Å; R71-S75 WeakPolarHBondContact O-CB 3.27Å; R71-S75 PolarHBondContact O-N 2.98Å
72	T	94.8	Very high	93.1	Very high	93 Å²	93	98.1 Å²	98.1	57%	0.571	49%	0.491	S	S	*	.	H	α-helix	trans	-66.7	-39.6	178.9	51.9	0	0	0	0	111.6	L68 E69 K70 S75 R76	L68-T72 WeakPolarHBondContact O-CG2 3.35Å; L68-T72 PolarHBondContact O-N 3.25Å; L68-T72 PolarHBondContact O-OG1 3.48Å; E69-T72 WeakPolarHBondContact CA-OG1 3.34Å; E69-T72 PolarHBondContact O-N 2.99Å; E69-T72 PolarHBondContact O-OG1 3.18Å; K70-T72 PolarHBondContact O-N 3.32Å; T72-S75 PolarHBondContact O-N 3.48Å; T72-R76 WeakPolarHBondContact O-CB 3.44Å; T72-R76 PolarHBondContact O-N 2.95Å
73	K	95.7	Very high	93.6	Very high	138 Å²	138	96.4 Å²	96.4	60%	0.6	48%	0.477	S	S	*	.	H	α-helix	trans	-62.7	-44.4	173.9	-174.5	-179	177.9	-176.1	0	112.5	E69 K70 R76 F77	E69-K73 VanDerWaalsContact O-CB 3.28Å; E69-K73 WeakPolarHBondContact O-CB 3.47Å; E69-K73 PolarHBondContact O-N 3Å; K70-K73 PolarHBondContact O-N 3.37Å; K73-R76 PolarHBondContact O-N 3.44Å; K73-F77 PolarHBondContact O-N 2.93Å
74	M	94.8	Very high	94	Very high	96 Å²	96	98.9 Å²	98.9	47%	0.473	48%	0.481	S	S	.	.	H	α-helix	trans	-63.5	-47.9	176.9	-71	-56.2	-62.3	0	0	111.1	K70 R71 R76 F77 E78	K70-M74 HydrophobicContact CG-CG 4.5Å; K70-M74 WeakPolarHBondContact O-CB 3.42Å; K70-M74 VanDerWaalsContact O-CG 3.27Å; K70-M74 WeakPolarHBondContact O-CG 3.3Å; K70-M74 PolarHBondContact O-N 3.28Å; R71-M74 PolarHBondContact O-N 2.93Å; M74-R76 VanDerWaalsContact C-N 3.31Å; M74-R76 PolarHBondContact O-N 3.36Å; M74-F77 PolarHBondContact O-N 3.48Å; M74-E78 WeakPolarHBondContact O-CG 3.44Å; M74-E78 PolarHBondContact O-N 3.41Å
75	S	95.9	Very high	94.4	Very high	64 Å²	64	99.5 Å²	99.5	45%	0.448	48%	0.478	S	S	.	.	H	α-helix	trans	-60.9	-39.2	177.2	179.7	0	0	0	0	112.4	R71 T72 E78 M79	R71-S75 WeakPolarHBondContact O-CB 3.27Å; R71-S75 PolarHBondContact O-N 2.98Å; T72-S75 PolarHBondContact O-N 3.48Å; S75-E78 PolarHBondContact O-N 2.92Å; S75-M79 WeakPolarHBondContact O-CB 3.35Å; S75-M79 PolarHBondContact O-N 3.34Å
76	R	96.9	Very high	94.6	Very high	150 Å²	150	100.5 Å²	100.5	57%	0.566	48%	0.482	S	S	*	.	H	α-helix	trans	-63.7	-45.3	174.7	-170.2	-175.4	73.8	-158	-1.3	111.7	T72 K73 M74 E78 M79 E80	T72-R76 WeakPolarHBondContact O-CB 3.44Å; T72-R76 PolarHBondContact O-N 2.95Å; K73-R76 PolarHBondContact O-N 3.44Å; M74-R76 VanDerWaalsContact C-N 3.31Å; M74-R76 PolarHBondContact O-N 3.36Å; R76-E78 VanDerWaalsContact C-N 3.34Å; R76-E78 PolarHBondContact O-N 3.37Å; R76-M79 PolarHBondContact O-N 2.95Å; R76-E80 HydrophobicContact CG-CG 4.48Å; R76-E80 WeakPolarHBondContact CG-OE1 3.42Å; R76-E80 IonicContact NE-OE1 3.31Å; R76-E80 PolarHBondContact NE-OE1 2.88Å; R76-E80 WeakPolarHBondContact O-CG 3.3Å; R76-E80 PolarHBondContact O-N 3.49Å
77	F	96.6	Very high	94.9	Very high	123 Å²	123	104.4 Å²	104.4	54%	0.539	50%	0.496	S	S	.	.	H	α-helix	trans	-62.2	-42.6	178.6	178.1	-98.4	0	0	0	111.9	K73 M74 E80 A81	K73-F77 PolarHBondContact O-N 2.93Å; M74-F77 PolarHBondContact O-N 3.48Å; F77-E80 PolarHBondContact O-N 3.47Å; F77-A81 VanDerWaalsContact O-CB 3.31Å; F77-A81 WeakPolarHBondContact O-CB 3.49Å; F77-A81 PolarHBondContact O-N 2.91Å
78	E	96.4	Very high	95.1	Very high	113 Å²	113	107.5 Å²	107.5	53%	0.528	51%	0.513	S	S	.	.	H	α-helix	trans	-62.7	-43.6	175.9	-72.5	175.4	-175.2	0	0	111.8	M74 S75 R76 A81 L82	M74-E78 WeakPolarHBondContact O-CG 3.44Å; M74-E78 PolarHBondContact O-N 3.41Å; S75-E78 PolarHBondContact O-N 2.92Å; R76-E78 VanDerWaalsContact C-N 3.34Å; R76-E78 PolarHBondContact O-N 3.37Å; E78-A81 PolarHBondContact O-N 3.04Å; E78-L82 WeakPolarHBondContact O-CG 3.36Å; E78-L82 PolarHBondContact O-N 2.93Å
79	M	96.3	Very high	95.3	Very high	114 Å²	114	109.8 Å²	109.8	56%	0.562	52%	0.519	S	S	*	.	H	α-helix	trans	-60.5	-51.1	175.7	-172.3	177	-68.1	0	0	111.4	S75 R76 A81 L82 D83	S75-M79 WeakPolarHBondContact O-CB 3.35Å; S75-M79 PolarHBondContact O-N 3.34Å; R76-M79 PolarHBondContact O-N 2.95Å; M79-A81 PolarHBondContact O-N 2.96Å; M79-L82 PolarHBondContact O-N 2.91Å; M79-L82 VanDerWaalsContact O-N 3.13Å; M79-D83 VanDerWaalsContact O-CG 3.29Å; M79-D83 PolarHBondContact O-N 3.38Å
80	E	97	Very high	95.4	Very high	79 Å²	79	108.6 Å²	108.6	37%	0.369	51%	0.514	S	S	.	.	H	α-helix	trans	-61.2	-31.4	177.1	-71.6	172	-162.7	0	0	113	R76 F77 R84	R76-E80 HydrophobicContact CG-CG 4.48Å; R76-E80 WeakPolarHBondContact CG-OE1 3.42Å; R76-E80 IonicContact NE-OE1 3.31Å; R76-E80 PolarHBondContact NE-OE1 2.88Å; R76-E80 WeakPolarHBondContact O-CG 3.3Å; R76-E80 PolarHBondContact O-N 3.49Å; F77-E80 PolarHBondContact O-N 3.47Å; E80-R84 WeakPolarHBondContact O-CB 3.31Å; E80-R84 VanDerWaalsContact O-CG 3.27Å; E80-R84 WeakPolarHBondContact O-CG 3.35Å; E80-R84 PolarHBondContact O-N 2.92Å; E80-R84 PolarHBondContact O-NE 3.48Å; E80-R84 IonicContact OE2-NH2 3.81Å
81	A	96.9	Very high	95.4	Very high	31 Å²	31	109 Å²	109	26%	0.256	52%	0.518	S	S	.	.	H	α-helix	trans	-73.1	-39.6	176.4	0	0	0	0	0	111.5	F77 E78 M79 L85	F77-A81 VanDerWaalsContact O-CB 3.31Å; F77-A81 WeakPolarHBondContact O-CB 3.49Å; F77-A81 PolarHBondContact O-N 2.91Å; E78-A81 PolarHBondContact O-N 3.04Å; M79-A81 PolarHBondContact O-N 2.96Å; A81-L85 VanDerWaalsContact O-CG 3.3Å; A81-L85 WeakPolarHBondContact O-CG 3.44Å; A81-L85 PolarHBondContact O-N 2.92Å; A81-L85 VanDerWaalsContact O-N 3.09Å
82	L	97	Very high	95.3	Very high	115 Å²	115	105.7 Å²	105.7	60%	0.602	51%	0.513	S	S	*	.	H	α-helix	trans	-67.4	-44.4	176	-71.6	172.7	0	0	0	111.9	E78 M79 R84 L85 E86	E78-L82 WeakPolarHBondContact O-CG 3.36Å; E78-L82 PolarHBondContact O-N 2.93Å; M79-L82 PolarHBondContact O-N 2.91Å; M79-L82 VanDerWaalsContact O-N 3.13Å; L82-R84 VanDerWaalsContact C-N 3.34Å; L82-R84 PolarHBondContact O-N 3.12Å; L82-L85 WeakPolarHBondContact O-CB 3.4Å; L82-L85 PolarHBondContact O-N 3.35Å; L82-L85 VanDerWaalsContact O-N 3.11Å; L82-E86 PolarHBondContact O-N 2.67Å
83	D	96.6	Very high	95	Very high	80 Å²	80	108.5 Å²	108.5	43%	0.428	52%	0.517	S	S	.	.	H	α-helix	trans	-58.9	-46.5	177	-66.8	-16.3	0	0	0	110.6	M79 L85 E86 E87	M79-D83 VanDerWaalsContact O-CG 3.29Å; M79-D83 PolarHBondContact O-N 3.38Å; D83-L85 VanDerWaalsContact C-N 3.31Å; D83-L85 PolarHBondContact O-N 3.47Å; D83-E86 PolarHBondContact O-N 3.33Å; D83-E86 VanDerWaalsContact O-N 3.1Å; D83-E87 WeakPolarHBondContact O-CG 3.5Å; D83-E87 PolarHBondContact O-N 3.4Å
84	R	96.4	Very high	94.5	Very high	127 Å²	127	110 Å²	110	48%	0.479	52%	0.519	S	S	.	.	H	α-helix	trans	-59.1	-39.7	174.6	-79.7	-177.2	-84.7	-175.9	-11	112.9	E80 L82 E86 L88	E80-R84 WeakPolarHBondContact O-CB 3.31Å; E80-R84 VanDerWaalsContact O-CG 3.27Å; E80-R84 WeakPolarHBondContact O-CG 3.35Å; E80-R84 PolarHBondContact O-N 2.92Å; E80-R84 PolarHBondContact O-NE 3.48Å; E80-R84 IonicContact OE2-NH2 3.81Å; L82-R84 VanDerWaalsContact C-N 3.34Å; L82-R84 PolarHBondContact O-N 3.12Å; R84-E86 VanDerWaalsContact C-N 3.35Å; R84-L88 WeakPolarHBondContact O-CG 3.35Å; R84-L88 PolarHBondContact O-N 3.25Å; R84-L88 VanDerWaalsContact O-N 3.13Å
85	L	96.9	Very high	93.9	Very high	106 Å²	106	108.9 Å²	108.9	56%	0.555	51%	0.513	S	S	*	.	H	α-helix	trans	-68.4	-35.4	176.4	-75	172	0	0	0	112	A81 L82 D83 K89	A81-L85 VanDerWaalsContact O-CG 3.3Å; A81-L85 WeakPolarHBondContact O-CG 3.44Å; A81-L85 PolarHBondContact O-N 2.92Å; A81-L85 VanDerWaalsContact O-N 3.09Å; L82-L85 WeakPolarHBondContact O-CB 3.4Å; L82-L85 PolarHBondContact O-N 3.35Å; L82-L85 VanDerWaalsContact O-N 3.11Å; D83-L85 VanDerWaalsContact C-N 3.31Å; D83-L85 PolarHBondContact O-N 3.47Å; L85-K89 WeakPolarHBondContact O-CB 3.27Å; L85-K89 PolarHBondContact O-N 3.39Å
86	E	95.8	Very high	93.1	Very high	136 Å²	136	109.7 Å²	109.7	64%	0.636	52%	0.523	S	S	*	.	H	α-helix	trans	-68	-45	176.3	-173.5	161.2	-157.8	0	0	111.5	L82 D83 R84 L88 K89 E90	L82-E86 PolarHBondContact O-N 2.67Å; D83-E86 PolarHBondContact O-N 3.33Å; D83-E86 VanDerWaalsContact O-N 3.1Å; R84-E86 VanDerWaalsContact C-N 3.35Å; E86-L88 VanDerWaalsContact C-N 3.35Å; E86-L88 PolarHBondContact O-N 3Å; E86-K89 CarbonylContact O-C 3.6Å; E86-K89 WeakPolarHBondContact O-CB 3.47Å; E86-K89 PolarHBondContact O-N 3.26Å; E86-K89 VanDerWaalsContact O-N 3.14Å; E86-E90 PolarHBondContact O-N 2.8Å
87	E	95.3	Very high	91.9	Very high	129 Å²	129	109.9 Å²	109.9	60%	0.603	54%	0.535	S	S	*	.	H	α-helix	trans	-56	-47.1	173.5	-72.1	177.2	-177.1	0	0	111.8	D83 K89 E90 M91	D83-E87 WeakPolarHBondContact O-CG 3.5Å; D83-E87 PolarHBondContact O-N 3.4Å; E87-K89 PolarHBondContact O-N 2.98Å; E87-E90 PolarHBondContact O-N 3.46Å; E87-M91 WeakPolarHBondContact O-CB 3.38Å; E87-M91 PolarHBondContact O-N 3.29Å
88	L	94.4	Very high	91	Very high	96 Å²	96	107.3 Å²	107.3	50%	0.503	53%	0.529	S	S	.	.	H	α-helix	trans	-63	-41.5	176.3	-73.6	173.7	0	0	0	111.9	R84 E86 M91 N92	R84-L88 WeakPolarHBondContact O-CG 3.35Å; R84-L88 PolarHBondContact O-N 3.25Å; R84-L88 VanDerWaalsContact O-N 3.13Å; E86-L88 VanDerWaalsContact C-N 3.35Å; E86-L88 PolarHBondContact O-N 3Å; L88-M91 PolarHBondContact O-N 3.15Å; L88-N92 WeakPolarHBondContact O-CB 3.35Å; L88-N92 PolarHBondContact O-N 3.12Å; L88-N92 PolarHBondContact O-ND2 3.37Å; L88-N92 VanDerWaalsContact O-ND2 3.11Å
89	K	94.3	Very high	90.3	Very high	142 Å²	142	106 Å²	106	62%	0.617	53%	0.526	S	S	*	.	H	α-helix	trans	-63.7	-41.4	175.4	-99.1	-178.3	175.2	173.5	0	111.8	L85 E86 E87 N92 K93	L85-K89 WeakPolarHBondContact O-CB 3.27Å; L85-K89 PolarHBondContact O-N 3.39Å; E86-K89 CarbonylContact O-C 3.6Å; E86-K89 WeakPolarHBondContact O-CB 3.47Å; E86-K89 PolarHBondContact O-N 3.26Å; E86-K89 VanDerWaalsContact O-N 3.14Å; E87-K89 PolarHBondContact O-N 2.98Å; K89-N92 PolarHBondContact O-N 3.38Å; K89-K93 WeakPolarHBondContact O-CB 3.28Å; K89-K93 VanDerWaalsContact O-CG 3.27Å; K89-K93 WeakPolarHBondContact O-CG 3.5Å; K89-K93 PolarHBondContact O-N 3.42Å
90	E	92.6	Very high	89.6	Confident	95 Å²	95	105.8 Å²	105.8	44%	0.444	52%	0.52	S	S	.	.	H	α-helix	trans	-66.2	-44.5	178.6	-165.1	-175.3	178.6	0	0	111.1	E86 E87 N92 K93 R94	E86-E90 PolarHBondContact O-N 2.8Å; E87-E90 PolarHBondContact O-N 3.46Å; E90-N92 VanDerWaalsContact C-N 3.34Å; E90-N92 PolarHBondContact O-N 2.83Å; E90-K93 PolarHBondContact O-N 2.87Å; E90-R94 WeakPolarHBondContact O-CG 3.28Å; E90-R94 PolarHBondContact O-N 3.4Å; E90-R94 IonicContact OE1-CZ 2.8Å; E90-R94 IonicContact OE1-NE 3.8Å; E90-R94 PolarHBondContact OE1-NE 3.26Å; E90-R94 IonicContact OE1-NH2 2.78Å; E90-R94 PolarHBondContact OE1-NH2 3.39Å; E90-R94 IonicContact OE2-NH2 3.39Å
91	M	90.5	Very high	88.9	Confident	98 Å²	98	107.8 Å²	107.8	48%	0.483	53%	0.533	S	S	.	.	H	α-helix	trans	-57.3	-47.7	174	-170.4	-176.3	-54.5	0	0	111.4	E87 L88 K93 R94 Q95	E87-M91 WeakPolarHBondContact O-CB 3.38Å; E87-M91 PolarHBondContact O-N 3.29Å; L88-M91 PolarHBondContact O-N 3.15Å; M91-K93 PolarHBondContact O-N 3.33Å; M91-R94 PolarHBondContact O-N 3.02Å; M91-Q95 WeakPolarHBondContact O-CB 3.41Å; M91-Q95 WeakPolarHBondContact O-CG 3.17Å; M91-Q95 PolarHBondContact O-N 3.38Å
92	N	89.3	Confident	88.3	Confident	95 Å²	95	111.2 Å²	111.2	51%	0.508	55%	0.547	S	S	.	.	H	α-helix	trans	-62.6	-41.3	177.2	-75.1	-30.4	0	0	0	112.4	L88 K89 E90 Q95 A96	L88-N92 WeakPolarHBondContact O-CB 3.35Å; L88-N92 PolarHBondContact O-N 3.12Å; L88-N92 PolarHBondContact O-ND2 3.37Å; L88-N92 VanDerWaalsContact O-ND2 3.11Å; K89-N92 PolarHBondContact O-N 3.38Å; E90-N92 VanDerWaalsContact C-N 3.34Å; E90-N92 PolarHBondContact O-N 2.83Å; N92-Q95 PolarHBondContact O-N 3.32Å; N92-A96 WeakPolarHBondContact O-CB 3.48Å; N92-A96 PolarHBondContact O-N 2.98Å
93	K	89	Confident	87.7	Confident	152 Å²	152	110.8 Å²	110.8	66%	0.661	54%	0.543	S	S	*	.	H	α-helix	trans	-62.6	-42	175.4	-76.8	173.3	-178	177.3	0	112	K89 E90 M91 Q95 A96	K89-K93 WeakPolarHBondContact O-CB 3.28Å; K89-K93 VanDerWaalsContact O-CG 3.27Å; K89-K93 WeakPolarHBondContact O-CG 3.5Å; K89-K93 PolarHBondContact O-N 3.42Å; E90-K93 PolarHBondContact O-N 2.87Å; M91-K93 PolarHBondContact O-N 3.33Å; K93-Q95 VanDerWaalsContact C-N 3.34Å; K93-A96 PolarHBondContact O-N 2.95Å
94	R	85.1	Confident	87.4	Confident	170 Å²	170	111.5 Å²	111.5	64%	0.642	55%	0.546	S	S	*	.	H	α-helix	trans	-64.3	-41.1	176	-69.3	175.9	-171.2	179.1	3.4	111.2	E90 M91	E90-R94 WeakPolarHBondContact O-CG 3.28Å; E90-R94 PolarHBondContact O-N 3.4Å; E90-R94 IonicContact OE1-CZ 2.8Å; E90-R94 IonicContact OE1-NE 3.8Å; E90-R94 PolarHBondContact OE1-NE 3.26Å; E90-R94 IonicContact OE1-NH2 2.78Å; E90-R94 PolarHBondContact OE1-NH2 3.39Å; E90-R94 IonicContact OE2-NH2 3.39Å; M91-R94 PolarHBondContact O-N 3.02Å
95	Q	83.8	Confident	87.1	Confident	72 Å²	72	106.9 Å²	106.9	34%	0.336	54%	0.535	S	S	.	.	H	α-helix	trans	-75.3	-21.6	-179.7	-77.6	178	-5.8	0	0	114.3	M91 N92 K93 N97 V98 Y100	M91-Q95 WeakPolarHBondContact O-CB 3.41Å; M91-Q95 WeakPolarHBondContact O-CG 3.17Å; M91-Q95 PolarHBondContact O-N 3.38Å; N92-Q95 PolarHBondContact O-N 3.32Å; K93-Q95 VanDerWaalsContact C-N 3.34Å; Q95-N97 PolarHBondContact O-N 3.27Å; Q95-N97 VanDerWaalsContact O-N 3.09Å; Q95-V98 WeakPolarHBondContact O-CB 3.48Å; Q95-V98 PolarHBondContact O-N 3.5Å; Q95-Y100 VanDerWaalsContact CB-OH 3.26Å; Q95-Y100 WeakPolarHBondContact CB-OH 3.33Å; Q95-Y100 VanDerWaalsContact CG-OH 3.25Å; Q95-Y100 WeakPolarHBondContact CG-OH 3.35Å; Q95-Y100 PolarHBondContact OE1-OH 3.47Å
96	A	77.6	Confident	86.7	Confident	81 Å²	81	108.2 Å²	108.2	67%	0.669	54%	0.538	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.1	-26.6	-177.9	0	0	0	0	0	113.9	N92 K93	N92-A96 WeakPolarHBondContact O-CB 3.48Å; N92-A96 PolarHBondContact O-N 2.98Å; K93-A96 PolarHBondContact O-N 2.95Å
97	N	72.8	Confident	86.5	Confident	154 Å²	154	104.6 Å²	104.6	82%	0.824	53%	0.526	S	S	*	.	T	Hydrogen-bonded Turn	trans	-90.4	-7.4	176.8	-64.7	-29.6	0	0	0	113.5	Q95	Q95-N97 PolarHBondContact O-N 3.27Å; Q95-N97 VanDerWaalsContact O-N 3.09Å
98	V	77.3	Confident	86.3	Confident	68 Å²	68	106 Å²	106	41%	0.412	53%	0.525	S	S	.	.			trans	-86.6	116.6	-178.9	-178.2	0	0	0	0	108.9	Q95 Y100	Q95-V98 WeakPolarHBondContact O-CB 3.48Å; Q95-V98 PolarHBondContact O-N 3.5Å; V98-Y100 PolarHBondContact O-N 2.87Å; V98-Y100 VanDerWaalsContact O-N 3.14Å
99	N	80.3	Confident	86.2	Confident	85 Å²	85	107.8 Å²	107.8	46%	0.455	53%	0.529	S	S	.	.			trans	-80.3	94.1	173.4	-170.6	-30.8	0	0	0	109.5	D101 L102 M103	N99-D101 PolarHBondContact O-N 2.9Å; N99-D101 WeakPolarHBondContact OD1-CB 3.38Å; N99-D101 PolarHBondContact OD1-N 3.48Å; N99-D101 VanDerWaalsContact OD1-N 3.15Å; N99-L102 HydrophobicContact CB-CB 4.22Å; N99-L102 HydrophobicContact CB-CD1 3.98Å; N99-L102 HydrophobicContact CB-CG 4.16Å; N99-L102 PolarHBondContact O-N 3.37Å; N99-L102 PolarHBondContact OD1-N 3.17Å; N99-M103 PolarHBondContact O-N 3.02Å; N99-M103 VanDerWaalsContact O-N 3.14Å
100	Y	81.6	Confident	86	Confident	110 Å²	110	103.6 Å²	103.6	43%	0.431	52%	0.517	S	S	.	.	H	α-helix	trans	-56.3	-34.6	179.1	-66.6	-73.6	0	0	0	113.1	Q95 V98 M103 L104	Q95-Y100 VanDerWaalsContact CB-OH 3.26Å; Q95-Y100 WeakPolarHBondContact CB-OH 3.33Å; Q95-Y100 VanDerWaalsContact CG-OH 3.25Å; Q95-Y100 WeakPolarHBondContact CG-OH 3.35Å; Q95-Y100 PolarHBondContact OE1-OH 3.47Å; V98-Y100 PolarHBondContact O-N 2.87Å; V98-Y100 VanDerWaalsContact O-N 3.14Å; Y100-M103 PolarHBondContact O-N 3.07Å; Y100-L104 VanDerWaalsContact O-CB 3.31Å; Y100-L104 WeakPolarHBondContact O-CB 3.34Å; Y100-L104 VanDerWaalsContact O-CG 3.23Å; Y100-L104 WeakPolarHBondContact O-CG 3.47Å; Y100-L104 PolarHBondContact O-N 3.41Å
101	D	83.9	Confident	86	Confident	121 Å²	121	103.8 Å²	103.8	65%	0.647	52%	0.519	S	S	*	.	H	α-helix	trans	-66.8	-40.4	-179.1	-66.3	-36.5	0	0	0	111.7	N99 A105	N99-D101 PolarHBondContact O-N 2.9Å; N99-D101 WeakPolarHBondContact OD1-CB 3.38Å; N99-D101 PolarHBondContact OD1-N 3.48Å; N99-D101 VanDerWaalsContact OD1-N 3.15Å; D101-A105 VanDerWaalsContact O-CB 3.26Å; D101-A105 WeakPolarHBondContact O-CB 3.22Å; D101-A105 PolarHBondContact O-N 2.99Å
102	L	83.9	Confident	86	Confident	104 Å²	104	105.9 Å²	105.9	55%	0.545	53%	0.525	S	S	.	.	H	α-helix	trans	-66.4	-46.2	174.9	-69.5	178.7	0	0	0	111.1	N99 L104 A105 E106	N99-L102 HydrophobicContact CB-CB 4.22Å; N99-L102 HydrophobicContact CB-CD1 3.98Å; N99-L102 HydrophobicContact CB-CG 4.16Å; N99-L102 PolarHBondContact O-N 3.37Å; N99-L102 PolarHBondContact OD1-N 3.17Å; L102-L104 PolarHBondContact O-N 3.37Å; L102-A105 WeakPolarHBondContact O-CB 3.32Å; L102-A105 PolarHBondContact O-N 2.84Å; L102-A105 VanDerWaalsContact O-N 3.11Å; L102-E106 WeakPolarHBondContact O-CG 3.47Å; L102-E106 PolarHBondContact O-N 2.84Å
103	M	84.4	Confident	86.1	Confident	105 Å²	105	106.5 Å²	106.5	52%	0.517	53%	0.525	S	S	.	.	H	α-helix	trans	-59.3	-47.8	178.1	-171.2	-172	131.1	0	0	111	N99 Y100 A105 E106 T107	N99-M103 PolarHBondContact O-N 3.02Å; N99-M103 VanDerWaalsContact O-N 3.14Å; Y100-M103 PolarHBondContact O-N 3.07Å; M103-A105 VanDerWaalsContact C-N 3.29Å; M103-A105 PolarHBondContact O-N 3.16Å; M103-E106 PolarHBondContact O-N 2.97Å; M103-T107 PolarHBondContact O-N 3.36Å; M103-T107 PolarHBondContact O-OG1 3.21Å
104	L	89.4	Confident	86.2	Confident	95 Å²	95	104.6 Å²	104.6	50%	0.497	52%	0.519	S	S	.	.	H	α-helix	trans	-63.9	-32.1	176.1	-72.5	169.5	0	0	0	112.6	Y100 L102 R108	Y100-L104 VanDerWaalsContact O-CB 3.31Å; Y100-L104 WeakPolarHBondContact O-CB 3.34Å; Y100-L104 VanDerWaalsContact O-CG 3.23Å; Y100-L104 WeakPolarHBondContact O-CG 3.47Å; Y100-L104 PolarHBondContact O-N 3.41Å; L102-L104 PolarHBondContact O-N 3.37Å; L104-R108 WeakPolarHBondContact O-CB 3.36Å; L104-R108 WeakPolarHBondContact O-CG 3.45Å; L104-R108 PolarHBondContact O-N 3.46Å; L104-R108 VanDerWaalsContact O-N 3.17Å; L104-R108 PolarHBondContact O-NE 3.02Å
105	A	91.1	Very high	86.5	Confident	30 Å²	30	104.4 Å²	104.4	25%	0.248	52%	0.518	C	S	.	.	H	α-helix	trans	-70.7	-40.3	174.7	0	0	0	0	0	111.9	D101 L102 M103 K109	D101-A105 VanDerWaalsContact O-CB 3.26Å; D101-A105 WeakPolarHBondContact O-CB 3.22Å; D101-A105 PolarHBondContact O-N 2.99Å; L102-A105 WeakPolarHBondContact O-CB 3.32Å; L102-A105 PolarHBondContact O-N 2.84Å; L102-A105 VanDerWaalsContact O-N 3.11Å; M103-A105 VanDerWaalsContact C-N 3.29Å; M103-A105 PolarHBondContact O-N 3.16Å; A105-K109 VanDerWaalsContact O-CG 3.31Å; A105-K109 WeakPolarHBondContact O-CG 3.45Å; A105-K109 PolarHBondContact O-N 2.9Å
106	E	88.6	Confident	86.8	Confident	134 Å²	134	107 Å²	107	63%	0.626	53%	0.525	S	S	*	.	H	α-helix	trans	-66.3	-46.3	176.6	-73.3	176.9	177.1	0	0	111.7	L102 M103 R108 K109 S110	L102-E106 WeakPolarHBondContact O-CG 3.47Å; L102-E106 PolarHBondContact O-N 2.84Å; M103-E106 PolarHBondContact O-N 2.97Å; E106-R108 VanDerWaalsContact C-N 3.32Å; E106-R108 PolarHBondContact O-N 3.36Å; E106-K109 WeakPolarHBondContact O-CB 3.47Å; E106-K109 PolarHBondContact O-N 3.37Å; E106-K109 VanDerWaalsContact O-N 3.1Å; E106-S110 PolarHBondContact O-N 3.45Å; E106-S110 PolarHBondContact O-OG 3.21Å
107	T	90.7	Very high	87.4	Confident	60 Å²	60	108.5 Å²	108.5	37%	0.368	52%	0.517	S	S	.	.	H	α-helix	trans	-61.2	-40.8	176.5	-41.1	0	0	0	0	111.6	M103 K109 S110 E111	M103-T107 PolarHBondContact O-N 3.36Å; M103-T107 PolarHBondContact O-OG1 3.21Å; T107-K109 VanDerWaalsContact C-N 3.32Å; T107-K109 PolarHBondContact O-N 2.95Å; T107-S110 PolarHBondContact O-N 2.95Å; T107-S110 PolarHBondContact O-OG 3.33Å; T107-E111 WeakPolarHBondContact O-CB 3.37Å; T107-E111 VanDerWaalsContact O-CG 3.3Å; T107-E111 WeakPolarHBondContact O-CG 3.37Å; T107-E111 PolarHBondContact O-N 3.44Å
108	R	92	Very high	88.2	Confident	159 Å²	159	106.7 Å²	106.7	60%	0.6	50%	0.504	S	S	*	.	H	α-helix	trans	-64.7	-34.6	175.1	-77.8	-177.2	-69.5	-179.9	-1.3	112.9	L104 E106 F112	L104-R108 WeakPolarHBondContact O-CB 3.36Å; L104-R108 WeakPolarHBondContact O-CG 3.45Å; L104-R108 PolarHBondContact O-N 3.46Å; L104-R108 VanDerWaalsContact O-N 3.17Å; L104-R108 PolarHBondContact O-NE 3.02Å; E106-R108 VanDerWaalsContact C-N 3.32Å; E106-R108 PolarHBondContact O-N 3.36Å; R108-F112 WeakPolarHBondContact O-CB 3.36Å; R108-F112 PolarHBondContact O-N 3.42Å
109	K	91.3	Very high	88.8	Confident	134 Å²	134	109.2 Å²	109.2	58%	0.583	51%	0.512	S	S	*	.	H	α-helix	trans	-68.7	-46.5	176.4	-76.4	174.1	-178.1	-179.4	0	111.3	A105 E106 T107 F112 E113	A105-K109 VanDerWaalsContact O-CG 3.31Å; A105-K109 WeakPolarHBondContact O-CG 3.45Å; A105-K109 PolarHBondContact O-N 2.9Å; E106-K109 WeakPolarHBondContact O-CB 3.47Å; E106-K109 PolarHBondContact O-N 3.37Å; E106-K109 VanDerWaalsContact O-N 3.1Å; T107-K109 VanDerWaalsContact C-N 3.32Å; T107-K109 PolarHBondContact O-N 2.95Å; K109-F112 PolarHBondContact O-N 3.12Å; K109-E113 WeakPolarHBondContact O-CG 3.39Å; K109-E113 PolarHBondContact O-N 3.25Å
110	S	90.3	Very high	89.2	Confident	53 Å²	53	109.7 Å²	109.7	37%	0.371	51%	0.511	S	S	.	.	H	α-helix	trans	-62.2	-44.3	177.8	60.4	0	0	0	0	111.5	E106 T107 F112 E113 E114	E106-S110 PolarHBondContact O-N 3.45Å; E106-S110 PolarHBondContact O-OG 3.21Å; T107-S110 PolarHBondContact O-N 2.95Å; T107-S110 PolarHBondContact O-OG 3.33Å; S110-F112 VanDerWaalsContact C-N 3.29Å; S110-F112 PolarHBondContact O-N 3.03Å; S110-E113 PolarHBondContact O-N 3.36Å; S110-E114 WeakPolarHBondContact O-CB 3.33Å; S110-E114 WeakPolarHBondContact O-CG 3.45Å; S110-E114 PolarHBondContact O-N 3.14Å
111	E	92	Very high	89.5	Confident	100 Å²	100	110.5 Å²	110.5	47%	0.467	52%	0.519	S	S	.	.	H	α-helix	trans	-60.5	-38.2	175.2	-75	179.5	170.5	0	0	112.5	T107 R115	T107-E111 WeakPolarHBondContact O-CB 3.37Å; T107-E111 VanDerWaalsContact O-CG 3.3Å; T107-E111 WeakPolarHBondContact O-CG 3.37Å; T107-E111 PolarHBondContact O-N 3.44Å; E111-R115 WeakPolarHBondContact O-CB 3.29Å; E111-R115 VanDerWaalsContact O-CG 3.29Å; E111-R115 WeakPolarHBondContact O-CG 3.36Å; E111-R115 PolarHBondContact O-N 2.79Å
112	F	90.9	Very high	89.7	Confident	141 Å²	141	110.8 Å²	110.8	62%	0.618	52%	0.516	S	S	*	.	H	α-helix	trans	-69.3	-41.4	177.4	-175.7	-95.6	0	0	0	112	R108 K109 S110 R115 R116	R108-F112 WeakPolarHBondContact O-CB 3.36Å; R108-F112 PolarHBondContact O-N 3.42Å; K109-F112 PolarHBondContact O-N 3.12Å; S110-F112 VanDerWaalsContact C-N 3.29Å; S110-F112 PolarHBondContact O-N 3.03Å; F112-R115 PolarHBondContact O-N 2.78Å; F112-R116 WeakPolarHBondContact O-CB 3.46Å; F112-R116 PolarHBondContact O-N 2.64Å
113	E	91.7	Very high	89.8	Confident	109 Å²	109	110.2 Å²	110.2	51%	0.509	52%	0.517	S	S	.	.	H	α-helix	trans	-66.1	-43.8	177	-73.7	175	-175.2	0	0	112	K109 S110 R115 R116 Q117	K109-E113 WeakPolarHBondContact O-CG 3.39Å; K109-E113 PolarHBondContact O-N 3.25Å; S110-E113 PolarHBondContact O-N 3.36Å; E113-R115 PolarHBondContact O-N 2.85Å; E113-R116 PolarHBondContact O-N 2.8Å; E113-R116 VanDerWaalsContact O-N 3.16Å; E113-Q117 WeakPolarHBondContact O-CG 3.49Å; E113-Q117 PolarHBondContact O-N 2.78Å
114	E	91.1	Very high	90	Very high	112 Å²	112	108.4 Å²	108.4	52%	0.523	52%	0.519	S	S	.	.	H	α-helix	trans	-60.2	-45.5	174.4	-74.8	177.6	177.5	0	0	111.4	S110 R116 Q117 Q118	S110-E114 WeakPolarHBondContact O-CB 3.33Å; S110-E114 WeakPolarHBondContact O-CG 3.45Å; S110-E114 PolarHBondContact O-N 3.14Å; E114-R116 VanDerWaalsContact C-N 3.3Å; E114-R116 PolarHBondContact O-N 3.13Å; E114-Q117 PolarHBondContact O-N 3.5Å; E114-Q118 WeakPolarHBondContact O-CB 3.45Å; E114-Q118 VanDerWaalsContact O-CG 3.27Å; E114-Q118 WeakPolarHBondContact O-CG 3.38Å; E114-Q118 PolarHBondContact O-N 3.48Å
115	R	91.5	Very high	89.6	Confident	165 Å²	165	111.1 Å²	111.1	62%	0.623	53%	0.533	S	S	*	.	H	α-helix	trans	-61.3	-38.5	174.5	-77.9	179.3	-176.8	-161.2	3.4	112.2	E111 F112 E113 Q119	E111-R115 WeakPolarHBondContact O-CB 3.29Å; E111-R115 VanDerWaalsContact O-CG 3.29Å; E111-R115 WeakPolarHBondContact O-CG 3.36Å; E111-R115 PolarHBondContact O-N 2.79Å; F112-R115 PolarHBondContact O-N 2.78Å; E113-R115 PolarHBondContact O-N 2.85Å; R115-Q119 VanDerWaalsContact O-CG 3.31Å; R115-Q119 WeakPolarHBondContact O-CG 3.42Å; R115-Q119 PolarHBondContact O-N 2.97Å
116	R	90.9	Very high	88.8	Confident	128 Å²	128	116.5 Å²	116.5	48%	0.483	56%	0.557	S	S	.	*	H	α-helix	trans	-67.7	-43.1	178.7	-154.3	-170.9	87.4	-164.2	-0.8	111.3	F112 E113 E114 Q119 E120	F112-R116 WeakPolarHBondContact O-CB 3.46Å; F112-R116 PolarHBondContact O-N 2.64Å; E113-R116 PolarHBondContact O-N 2.8Å; E113-R116 VanDerWaalsContact O-N 3.16Å; E114-R116 VanDerWaalsContact C-N 3.3Å; E114-R116 PolarHBondContact O-N 3.13Å; R116-Q119 PolarHBondContact O-N 3Å; R116-E120 IonicContact CZ-OE1 3.45Å; R116-E120 IonicContact NE-OE1 2.79Å; R116-E120 PolarHBondContact NE-OE1 2.8Å; R116-E120 IonicContact NH2-OE1 3.29Å; R116-E120 PolarHBondContact NH2-OE1 2.75Å; R116-E120 WeakPolarHBondContact O-CB 3.37Å; R116-E120 WeakPolarHBondContact O-CG 3.4Å; R116-E120 PolarHBondContact O-N 2.87Å
117	Q	90.5	Very high	87.1	Confident	111 Å²	111	123.9 Å²	123.9	52%	0.519	58%	0.579	S	S	.	*	H	α-helix	trans	-62.6	-43.9	175.6	-72.4	176.6	5.5	0	0	111.4	E113 E114 Q119 E120 E121	E113-Q117 WeakPolarHBondContact O-CG 3.49Å; E113-Q117 PolarHBondContact O-N 2.78Å; E114-Q117 PolarHBondContact O-N 3.5Å; Q117-Q119 VanDerWaalsContact C-N 3.33Å; Q117-Q119 PolarHBondContact O-N 2.81Å; Q117-E120 PolarHBondContact O-N 3.35Å; Q117-E121 WeakPolarHBondContact O-CB 3.42Å; Q117-E121 WeakPolarHBondContact O-CG 3.44Å; Q117-E121 PolarHBondContact O-N 3.04Å
118	Q	89.8	Confident	86.9	Confident	117 Å²	117	127.1 Å²	127.1	55%	0.547	59%	0.589	S	S	.	*	H	α-helix	trans	-60	-42.1	175.4	-72.8	171.1	7.3	0	0	112.1	E114 E121 E122	E114-Q118 WeakPolarHBondContact O-CB 3.45Å; E114-Q118 VanDerWaalsContact O-CG 3.27Å; E114-Q118 WeakPolarHBondContact O-CG 3.38Å; E114-Q118 PolarHBondContact O-N 3.48Å; Q118-E121 PolarHBondContact O-N 3.48Å; Q118-E122 VanDerWaalsContact O-CB 3.29Å; Q118-E122 WeakPolarHBondContact O-CB 3.34Å; Q118-E122 PolarHBondContact O-N 2.98Å
119	Q	88.8	Confident	86.6	Confident	121 Å²	121	125.4 Å²	125.4	57%	0.565	59%	0.589	S	S	*	*	H	α-helix	trans	-66.2	-40.9	175	-73.5	177.1	-6.7	0	0	112.3	R115 R116 Q117 E122 T123	R115-Q119 VanDerWaalsContact O-CG 3.31Å; R115-Q119 WeakPolarHBondContact O-CG 3.42Å; R115-Q119 PolarHBondContact O-N 2.97Å; R116-Q119 PolarHBondContact O-N 3Å; Q117-Q119 VanDerWaalsContact C-N 3.33Å; Q117-Q119 PolarHBondContact O-N 2.81Å; Q119-E122 PolarHBondContact O-N 3.06Å; Q119-T123 WeakPolarHBondContact O-CB 3.48Å; Q119-T123 WeakPolarHBondContact O-CG2 3.44Å; Q119-T123 PolarHBondContact O-N 2.85Å; Q119-T123 PolarHBondContact O-OG1 3.04Å
120	E	89	Confident	86.4	Confident	94 Å²	94	124.9 Å²	124.9	44%	0.439	59%	0.589	S	S	.	*	H	α-helix	trans	-63.6	-42.5	175.8	-74.6	172.2	-161.5	0	0	111.2	R116 Q117 T123 A124	R116-E120 IonicContact CZ-OE1 3.45Å; R116-E120 IonicContact NE-OE1 2.79Å; R116-E120 PolarHBondContact NE-OE1 2.8Å; R116-E120 IonicContact NH2-OE1 3.29Å; R116-E120 PolarHBondContact NH2-OE1 2.75Å; R116-E120 WeakPolarHBondContact O-CB 3.37Å; R116-E120 WeakPolarHBondContact O-CG 3.4Å; R116-E120 PolarHBondContact O-N 2.87Å; Q117-E120 PolarHBondContact O-N 3.35Å; E120-T123 WeakPolarHBondContact CA-OG1 3.27Å; E120-T123 PolarHBondContact O-N 3.02Å; E120-T123 PolarHBondContact O-OG1 2.87Å; E120-A124 VanDerWaalsContact O-CB 3.28Å; E120-A124 WeakPolarHBondContact O-CB 3.23Å; E120-A124 PolarHBondContact O-N 2.8Å
121	E	88.5	Confident	86.1	Confident	127 Å²	127	129.1 Å²	129.1	59%	0.593	60%	0.602	S	S	*	*	H	α-helix	trans	-65.1	-45.1	175.3	-72.8	178.2	170.4	0	0	112	Q117 Q118 T123 A124 L125	Q117-E121 WeakPolarHBondContact O-CB 3.42Å; Q117-E121 WeakPolarHBondContact O-CG 3.44Å; Q117-E121 PolarHBondContact O-N 3.04Å; Q118-E121 PolarHBondContact O-N 3.48Å; E121-T123 PolarHBondContact O-N 2.95Å; E121-A124 PolarHBondContact O-N 2.95Å; E121-L125 WeakPolarHBondContact O-CD1 3.4Å; E121-L125 PolarHBondContact O-N 3.17Å
122	E	87.3	Confident	85.8	Confident	128 Å²	128	130.9 Å²	130.9	60%	0.598	61%	0.61	S	S	*	*	H	α-helix	trans	-62.4	-42.2	176.7	-170.2	179.5	-179.5	0	0	111.6	Q118 Q119 L125 L126	Q118-E122 VanDerWaalsContact O-CB 3.29Å; Q118-E122 WeakPolarHBondContact O-CB 3.34Å; Q118-E122 PolarHBondContact O-N 2.98Å; Q119-E122 PolarHBondContact O-N 3.06Å; E122-L125 PolarHBondContact O-N 2.96Å; E122-L126 HydrophobicContact CG-CD1 4.49Å; E122-L126 WeakPolarHBondContact O-CD1 3.38Å; E122-L126 WeakPolarHBondContact O-CG 3.47Å; E122-L126 PolarHBondContact O-N 2.95Å
123	T	85.8	Confident	85.4	Confident	91 Å²	91	130.3 Å²	130.3	56%	0.558	61%	0.61	S	S	*	*	H	α-helix	trans	-70.4	-32.7	176.1	57.9	0	0	0	0	113.1	Q119 E120 E121 L126	Q119-T123 WeakPolarHBondContact O-CB 3.48Å; Q119-T123 WeakPolarHBondContact O-CG2 3.44Å; Q119-T123 PolarHBondContact O-N 2.85Å; Q119-T123 PolarHBondContact O-OG1 3.04Å; E120-T123 WeakPolarHBondContact CA-OG1 3.27Å; E120-T123 PolarHBondContact O-N 3.02Å; E120-T123 PolarHBondContact O-OG1 2.87Å; E121-T123 PolarHBondContact O-N 2.95Å; T123-L126 PolarHBondContact O-N 2.8Å
124	A	88.1	Confident	85	Confident	67 Å²	67	131.8 Å²	131.8	55%	0.554	62%	0.617	S	S	*	*	H	α-helix	trans	-70.6	-32.6	175.1	0	0	0	0	0	112.5	E120 E121 L126	E120-A124 VanDerWaalsContact O-CB 3.28Å; E120-A124 WeakPolarHBondContact O-CB 3.23Å; E120-A124 PolarHBondContact O-N 2.8Å; E121-A124 PolarHBondContact O-N 2.95Å; A124-L126 VanDerWaalsContact C-N 3.29Å; A124-L126 PolarHBondContact O-N 3.34Å
125	L	82.3	Confident	84.5	Confident	152 Å²	152	133.3 Å²	133.3	80%	0.796	62%	0.624	S	S	*	*	H	α-helix	trans	-71.9	-20.9	174.5	-82.4	154.8	0	0	0	113.4	E121 E122	E121-L125 WeakPolarHBondContact O-CD1 3.4Å; E121-L125 PolarHBondContact O-N 3.17Å; E122-L125 PolarHBondContact O-N 2.96Å
126	L	72.9	Confident	83.9	Confident	144 Å²	144	130.7 Å²	130.7	75%	0.754	62%	0.624	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.3	-2.4	-179.8	-80.7	162.2	0	0	0	114.2	E122 T123 A124	E122-L126 HydrophobicContact CG-CD1 4.49Å; E122-L126 WeakPolarHBondContact O-CD1 3.38Å; E122-L126 WeakPolarHBondContact O-CG 3.47Å; E122-L126 PolarHBondContact O-N 2.95Å; T123-L126 PolarHBondContact O-N 2.8Å; A124-L126 VanDerWaalsContact C-N 3.29Å; A124-L126 PolarHBondContact O-N 3.34Å
127	R	53.5	Low	83.3	Confident	288 Å²	288	130.9 Å²	130.9	100%	1.087	64%	0.637	S	S	*	*			trans	-114.9	0	-177	-158.3	-175.3	-146.1	159.5	6.9	112.4

Retrieved 127 of 127 residues in 270.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).