A0A077ZM06_TRITR Loading...

TraV domain containing protein

AlphaFold DB , UniProt , Accession A0A077ZM06, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 133 aa.

						>A0A077ZM06_TRITR|A0A077ZM06
MEQANEKAKKLEQTSEAKPVAASLPRLAEGNFRTMPVQTVTATTPSGSRPAVTALPEQKLLAPRPLFTAAREVKTIVPVSSVAPVTPPRPLRTGEQTAALWIAPYIDNQDVYHQPSSVFFVIKPSAWGKPRIN
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	70.4	Confident	74.2	Confident	206 Å²	206	126.5 Å²	126.5	100%	1.015	64%	0.638	S	S	*	*				0	-33.5	0	-87	-174.2	-80.3	0	0	112	Q3 A4	M1-Q3 PolarHBondContact O-N 3.23Å; M1-A4 PolarHBondContact O-N 3.11Å; M1-A4 VanDerWaalsContact O-N 3.1Å
2	E	80.3	Confident	73	Confident	150 Å²	150	128.8 Å²	128.8	70%	0.701	64%	0.644	S	S	*	*	H	α-helix	trans	-39.1	-45.5	173.7	-103.9	60.7	-144.7	0	0	115.8	A4 N5 E6	E2-A4 VanDerWaalsContact C-N 3.27Å; E2-A4 PolarHBondContact O-N 3.18Å; E2-N5 PolarHBondContact O-N 3.13Å; E2-N5 VanDerWaalsContact O-N 3.15Å; E2-E6 PolarHBondContact O-N 2.86Å
3	Q	82.2	Confident	71.7	Confident	160 Å²	160	128.8 Å²	128.8	75%	0.748	64%	0.641	S	S	*	*	H	α-helix	trans	-65.8	-28.9	-172.8	-145.6	-178.6	20.6	0	0	113.5	M1 K7	M1-Q3 PolarHBondContact O-N 3.23Å; Q3-K7 PolarHBondContact O-N 2.92Å
4	A	75.9	Confident	70.7	Confident	67 Å²	67	128.2 Å²	128.2	55%	0.554	65%	0.648	S	S	*	*	H	α-helix	trans	-73.9	-38.1	175.9	0	0	0	0	0	111.4	M1 E2 K7 A8	M1-A4 PolarHBondContact O-N 3.11Å; M1-A4 VanDerWaalsContact O-N 3.1Å; E2-A4 VanDerWaalsContact C-N 3.27Å; E2-A4 PolarHBondContact O-N 3.18Å; A4-K7 PolarHBondContact O-N 3.06Å; A4-A8 PolarHBondContact O-N 3.29Å
5	N	81.8	Confident	69.7	Low	112 Å²	112	125.1 Å²	125.1	60%	0.599	64%	0.643	S	S	*	*	H	α-helix	trans	-67.7	-39	177.6	-69.7	-8.6	0	0	0	111.6	E2 K7 A8 K9	E2-N5 PolarHBondContact O-N 3.13Å; E2-N5 VanDerWaalsContact O-N 3.15Å; N5-K7 PolarHBondContact O-N 2.94Å; N5-A8 PolarHBondContact O-N 3.48Å; N5-K9 PolarHBondContact O-N 2.87Å; N5-K9 VanDerWaalsContact O-N 3.1Å
6	E	80	Confident	68.6	Low	99 Å²	99	128.3 Å²	128.3	46%	0.463	65%	0.654	S	S	.	*	H	α-helix	trans	-63.3	-38.6	174.9	-85.3	-68.7	126.9	0	0	112.7	E2 K10	E2-E6 PolarHBondContact O-N 2.86Å; E6-K10 WeakPolarHBondContact O-CG 3.31Å; E6-K10 PolarHBondContact O-N 2.88Å
7	K	77.5	Confident	67.4	Low	155 Å²	155	126.3 Å²	126.3	67%	0.674	66%	0.661	S	S	*	*	H	α-helix	trans	-66.5	-39.3	176.4	-80.3	-174.8	176.3	-177.7	0	112.5	Q3 A4 N5 L11	Q3-K7 PolarHBondContact O-N 2.92Å; A4-K7 PolarHBondContact O-N 3.06Å; N5-K7 PolarHBondContact O-N 2.94Å; K7-L11 PolarHBondContact O-N 3.18Å
8	A	68.3	Low	66.2	Low	57 Å²	57	130 Å²	130	47%	0.471	67%	0.671	S	S	.	*	H	α-helix	trans	-66.1	-43.3	177.3	0	0	0	0	0	111.8	A4 N5 K10 L11 E12	A4-A8 PolarHBondContact O-N 3.29Å; N5-A8 PolarHBondContact O-N 3.48Å; A8-K10 VanDerWaalsContact C-N 3.32Å; A8-K10 PolarHBondContact O-N 3.1Å; A8-L11 PolarHBondContact O-N 2.79Å; A8-L11 VanDerWaalsContact O-N 3.16Å; A8-E12 PolarHBondContact O-N 2.74Å; A8-E12 VanDerWaalsContact O-N 3.15Å
9	K	68.8	Low	65.5	Low	127 Å²	127	129.5 Å²	129.5	55%	0.552	68%	0.677	S	S	*	*	H	α-helix	trans	-61.7	-39.1	178.5	-168.5	177.5	176.8	-175.5	0	112.5	N5 Q13	N5-K9 PolarHBondContact O-N 2.87Å; N5-K9 VanDerWaalsContact O-N 3.1Å; K9-Q13 PolarHBondContact O-N 2.9Å
10	K	66.3	Low	64.7	Low	132 Å²	132	130 Å²	130	57%	0.574	69%	0.685	S	S	*	*	H	α-helix	trans	-68.6	-32.8	176.3	-71.4	179.3	-176.7	-178.4	0	113.1	E6 A8 T14	E6-K10 WeakPolarHBondContact O-CG 3.31Å; E6-K10 PolarHBondContact O-N 2.88Å; A8-K10 VanDerWaalsContact C-N 3.32Å; A8-K10 PolarHBondContact O-N 3.1Å; K10-T14 PolarHBondContact O-N 3.07Å; K10-T14 PolarHBondContact O-OG1 2.85Å
11	L	64.7	Low	64.1	Low	127 Å²	127	128.2 Å²	128.2	67%	0.665	69%	0.689	S	S	*	*	H	α-helix	trans	-71.1	-37.7	178.3	-169.7	66.2	0	0	0	111.8	K7 A8 T14 S15	K7-L11 PolarHBondContact O-N 3.18Å; A8-L11 PolarHBondContact O-N 2.79Å; A8-L11 VanDerWaalsContact O-N 3.16Å; L11-T14 PolarHBondContact O-OG1 3.41Å; L11-S15 PolarHBondContact O-N 3.05Å; L11-S15 PolarHBondContact O-OG 3.15Å
12	E	59.4	Low	63.4	Low	153 Å²	153	122.7 Å²	122.7	72%	0.715	68%	0.677	S	S	*	*	H	α-helix	trans	-69.3	-45	176.6	-63.8	-140.9	130.4	0	0	111.7	A8 T14 S15	A8-E12 PolarHBondContact O-N 2.74Å; A8-E12 VanDerWaalsContact O-N 3.15Å; E12-T14 VanDerWaalsContact C-N 3.28Å; E12-T14 PolarHBondContact O-N 3.26Å; E12-S15 PolarHBondContact O-N 3.38Å; E12-S15 VanDerWaalsContact O-N 3.09Å; E12-S15 PolarHBondContact O-OG 3.3Å
13	Q	56.9	Low	62.3	Low	130 Å²	130	121.1 Å²	121.1	61%	0.607	68%	0.682	S	S	*	*	H	α-helix	trans	-63.8	-28.8	179.8	-74.8	-174.4	-62	0	0	114	K9	K9-Q13 PolarHBondContact O-N 2.9Å
14	T	56.8	Low	61.3	Low	120 Å²	120	120.8 Å²	120.8	74%	0.736	68%	0.684	S	S	*	*	H	α-helix	trans	-84.2	-11	177	38.3	0	0	0	0	113.6	K10 L11 E12	K10-T14 PolarHBondContact O-N 3.07Å; K10-T14 PolarHBondContact O-OG1 2.85Å; L11-T14 PolarHBondContact O-OG1 3.41Å; E12-T14 VanDerWaalsContact C-N 3.28Å; E12-T14 PolarHBondContact O-N 3.26Å
15	S	56.1	Low	60.8	Low	81 Å²	81	122.8 Å²	122.8	57%	0.566	69%	0.692	S	S	*	*			trans	-93.6	1.6	-177.2	71.7	0	0	0	0	114.9	L11 E12 A17	L11-S15 PolarHBondContact O-N 3.05Å; L11-S15 PolarHBondContact O-OG 3.15Å; E12-S15 PolarHBondContact O-N 3.38Å; E12-S15 VanDerWaalsContact O-N 3.09Å; E12-S15 PolarHBondContact O-OG 3.3Å; S15-A17 PolarHBondContact O-N 2.78Å
16	E	51.7	Low	59.8	Low	177 Å²	177	128.2 Å²	128.2	83%	0.827	70%	0.704	S	S	*	*			trans	-73.2	18	-170.4	-144.1	168.8	-165.5	0	0	115.4
17	A	48.2	Very low	58.9	Low	94 Å²	94	130.2 Å²	130.2	78%	0.777	72%	0.717	S	S	*	*			trans	-138.1	56.9	-180	0	0	0	0	0	112.7	S15	S15-A17 PolarHBondContact O-N 2.78Å
18	K	46.9	Very low	58.5	Low	193 Å²	193	127.1 Å²	127.1	84%	0.839	72%	0.721	S	S	*	*	S	Bend	trans	-88.6	121.8	150.7	-92.8	-177.2	177.7	179.7	0	107.8	V20	K18-V20 PolarHBondContact O-N 3.21Å
19	P	53.1	Low	58.4	Low	120 Å²	120	132.9 Å²	132.9	78%	0.779	74%	0.738	S	S	*	*			trans	-57	135.2	-176.2	24.2	-32.2	0	0	0	109.1	A21	P19-A21 PolarHBondContact O-N 2.97Å; P19-A21 VanDerWaalsContact O-N 3.16Å
20	V	49.1	Very low	57.9	Low	139 Å²	139	128.6 Å²	128.6	84%	0.842	73%	0.73	S	S	*	*			trans	-19.4	112.9	170.4	178.7	0	0	0	0	109.9	K18 A22	K18-V20 PolarHBondContact O-N 3.21Å; V20-A22 VanDerWaalsContact C-N 3.29Å; V20-A22 PolarHBondContact O-N 3.34Å
21	A	52.9	Low	57.9	Low	93 Å²	93	129.7 Å²	129.7	77%	0.769	74%	0.742	S	S	*	*			trans	-48.2	99.7	173.9	0	0	0	0	0	107.8	P19 S23	P19-A21 PolarHBondContact O-N 2.97Å; P19-A21 VanDerWaalsContact O-N 3.16Å; A21-S23 PolarHBondContact O-N 3.37Å
22	A	55.5	Low	57.9	Low	91 Å²	91	131 Å²	131	75%	0.752	74%	0.743	S	S	*	*			trans	-53.7	118.7	174.7	0	0	0	0	0	105.4	V20 L24	V20-A22 VanDerWaalsContact C-N 3.29Å; V20-A22 PolarHBondContact O-N 3.34Å; A22-L24 PolarHBondContact O-N 3.49Å
23	S	56	Low	58.1	Low	116 Å²	116	133.7 Å²	133.7	81%	0.811	75%	0.746	S	S	*	*			trans	-39.5	126.5	-177.4	-45.4	0	0	0	0	109.7	A21	A21-S23 PolarHBondContact O-N 3.37Å
24	L	61.8	Low	58.2	Low	153 Å²	153	133.6 Å²	133.6	80%	0.801	76%	0.755	S	S	*	*	P	Polyproline II helix	trans	-50.5	134.2	177.9	-70.2	171.2	0	0	0	109	A22 R26	A22-L24 PolarHBondContact O-N 3.49Å; L24-R26 PolarHBondContact O-N 3.1Å
25	P	65.6	Low	58.3	Low	110 Å²	110	134.7 Å²	134.7	71%	0.714	75%	0.753	S	S	*	*	P	Polyproline II helix	trans	-56.4	131.2	178.8	21.2	-30.4	0	0	0	109.1	L27	P25-L27 PolarHBondContact O-N 2.85Å; P25-L27 VanDerWaalsContact O-N 3.13Å
26	R	60.7	Low	58.3	Low	226 Å²	226	136.1 Å²	136.1	85%	0.853	76%	0.761	S	S	*	*	P	Polyproline II helix	trans	-62.1	117.1	179.2	-156.9	-175.9	179.3	-176.3	-1.4	107.8	L24 A28	L24-R26 PolarHBondContact O-N 3.1Å; R26-A28 PolarHBondContact O-N 3.25Å
27	L	61.4	Low	58.3	Low	140 Å²	140	134.1 Å²	134.1	73%	0.733	76%	0.76	S	S	*	*	P	Polyproline II helix	trans	-59.2	137.8	175.1	-63.1	175.3	0	0	0	108.8	P25	P25-L27 PolarHBondContact O-N 2.85Å; P25-L27 VanDerWaalsContact O-N 3.13Å
28	A	69	Low	58.2	Low	91 Å²	91	137.8 Å²	137.8	75%	0.752	76%	0.761	S	S	*	*	P	Polyproline II helix	trans	-60.9	138.2	178.9	0	0	0	0	0	110.4	R26 G30	R26-A28 PolarHBondContact O-N 3.25Å; A28-G30 PolarHBondContact O-N 3.23Å
29	E	65.5	Low	58.2	Low	178 Å²	178	134.8 Å²	134.8	83%	0.832	76%	0.759	S	S	*	*			trans	-72.6	77.1	176.9	-150	77.3	-141.4	0	0	109
30	G	59.2	Low	58.2	Low	37 Å²	37	135.4 Å²	135.4	38%	0.381	76%	0.76	S	S	.	*			trans	-80.6	127.7	178.3	0	0	0	0	0	111	A28 F32	A28-G30 PolarHBondContact O-N 3.23Å; G30-F32 WeakPolarHBondContact O-CD2 3.35Å; G30-F32 WeakPolarHBondContact O-CE2 3.45Å; G30-F32 PolarHBondContact O-N 2.77Å
31	N	66.7	Low	58	Low	155 Å²	155	134.2 Å²	134.2	83%	0.829	75%	0.754	S	S	*	*			trans	-75	74.6	172.5	-167	-3.1	0	0	0	109.7	R33	N31-R33 PolarHBondContact O-N 3.38Å
32	F	62.9	Low	57.4	Low	155 Å²	155	134.7 Å²	134.7	68%	0.68	76%	0.758	S	S	*	*			trans	-69.8	99	179.5	-58.8	-74.9	0	0	0	109.4	G30 T34	G30-F32 WeakPolarHBondContact O-CD2 3.35Å; G30-F32 WeakPolarHBondContact O-CE2 3.45Å; G30-F32 PolarHBondContact O-N 2.77Å; F32-T34 PolarHBondContact O-N 3.36Å
33	R	64.5	Low	56.7	Low	208 Å²	208	136.3 Å²	136.3	79%	0.785	76%	0.758	S	S	*	*			trans	-66	105.6	164.3	-76.6	-174.3	169.2	-120.8	-0.8	108	N31 M35	N31-R33 PolarHBondContact O-N 3.38Å; R33-M35 PolarHBondContact O-N 2.99Å
34	T	58.4	Low	56.1	Low	129 Å²	129	137 Å²	137	79%	0.791	76%	0.758	S	S	*	*			trans	-67.8	98.5	168.5	42	0	0	0	0	108.6	F32	F32-T34 PolarHBondContact O-N 3.36Å
35	M	58.4	Low	55	Low	142 Å²	142	136.1 Å²	136.1	70%	0.7	76%	0.761	S	S	*	*			trans	-80.4	128.8	162	-73.5	-69.3	101	0	0	108	R33 V37	R33-M35 PolarHBondContact O-N 2.99Å; M35-V37 PolarHBondContact O-N 3.21Å
36	P	56.8	Low	53.9	Low	112 Å²	112	136.4 Å²	136.4	73%	0.727	77%	0.766	S	S	*	*			trans	-63.6	122.5	171.1	25.5	-30.5	0	0	0	108.5	Q38	P36-Q38 PolarHBondContact O-N 3.19Å
37	V	51.3	Low	52.6	Low	135 Å²	135	128.8 Å²	128.8	82%	0.818	76%	0.758	S	S	*	*			trans	-62.9	107.9	171.7	174.1	0	0	0	0	107	M35 T39	M35-V37 PolarHBondContact O-N 3.21Å; V37-T39 PolarHBondContact O-N 3.38Å
38	Q	46.6	Very low	51.5	Low	170 Å²	170	127.9 Å²	127.9	79%	0.794	76%	0.763	S	S	*	*			trans	-67.6	117.2	161.9	-73.6	-175	47.7	0	0	106.8	P36 V40	P36-Q38 PolarHBondContact O-N 3.19Å; Q38-V40 VanDerWaalsContact C-N 3.31Å; Q38-V40 PolarHBondContact O-N 3.23Å
39	T	48	Very low	49.8	Very low	131 Å²	131	135 Å²	135	80%	0.804	77%	0.771	S	S	*	*			trans	-58.1	95.1	168.1	2.2	0	0	0	0	107.9	V37 T41	V37-T39 PolarHBondContact O-N 3.38Å; T39-T41 PolarHBondContact O-N 3.15Å; T39-T41 VanDerWaalsContact O-N 3.12Å
40	V	52.3	Low	48.6	Very low	132 Å²	132	132.2 Å²	132.2	80%	0.8	77%	0.768	S	S	*	*			trans	-78.9	95.8	170.8	-177.6	0	0	0	0	106.6	Q38 A42	Q38-V40 VanDerWaalsContact C-N 3.31Å; Q38-V40 PolarHBondContact O-N 3.23Å; V40-A42 PolarHBondContact O-N 3.3Å
41	T	44.8	Very low	47.6	Very low	115 Å²	115	134.6 Å²	134.6	71%	0.706	78%	0.784	S	S	*	*			trans	-62	120.7	167.6	-32	0	0	0	0	107.7	T39 T43	T39-T41 PolarHBondContact O-N 3.15Å; T39-T41 VanDerWaalsContact O-N 3.12Å; T41-T43 PolarHBondContact O-N 3.16Å
42	A	39.7	Very low	46	Very low	103 Å²	103	134.2 Å²	134.2	85%	0.851	79%	0.787	S	S	*	*			trans	-65.5	96.7	178.1	0	0	0	0	0	110.1	V40	V40-A42 PolarHBondContact O-N 3.3Å
43	T	42	Very low	44.9	Very low	124 Å²	124	132.8 Å²	132.8	76%	0.761	79%	0.791	S	S	*	*			trans	-114	123	165.9	51.2	0	0	0	0	109.6	T41	T41-T43 PolarHBondContact O-N 3.16Å
44	T	41.6	Very low	43.6	Very low	130 Å²	130	127 Å²	127	80%	0.798	79%	0.788	S	S	*	*			trans	-41.7	145.3	-178.1	40.5	0	0	0	0	115.7	S46	T44-S46 PolarHBondContact O-N 3.48Å
45	P	38.9	Very low	42.5	Very low	135 Å²	135	128.1 Å²	128.1	88%	0.877	79%	0.788	S	S	*	*			trans	-77.2	110.1	-176.6	31.1	-32	0	0	0	110.7
46	S	42.9	Very low	42	Very low	116 Å²	116	125.9 Å²	125.9	81%	0.811	79%	0.785	S	S	*	*			trans	-121.3	109	163	-173.2	0	0	0	0	108.2	T44	T44-S46 PolarHBondContact O-N 3.48Å
47	G	33.6	Very low	41.2	Very low	67 Å²	67	128.9 Å²	128.9	69%	0.691	79%	0.789	S	S	*	*			trans	-63	135.9	177.4	0	0	0	0	0	111.4
48	S	38.8	Very low	41	Very low	121 Å²	121	131 Å²	131	85%	0.846	79%	0.79	S	S	*	*			trans	176	107	143.2	-80.3	0	0	0	0	109.5
49	R	33.7	Very low	40.9	Very low	240 Å²	240	131.7 Å²	131.7	91%	0.906	79%	0.79	S	S	*	*			trans	32.6	136.9	142.9	-148.5	164	-173.7	-166.9	1.5	120.3	A51	R49-A51 PolarHBondContact O-N 3.07Å
50	P	38.7	Very low	40.7	Very low	120 Å²	120	133.2 Å²	133.2	78%	0.779	79%	0.793	S	S	*	*			trans	-82	124.2	-161.4	33.1	-32.9	0	0	0	112.6
51	A	38.1	Very low	40.7	Very low	86 Å²	86	135 Å²	135	71%	0.711	80%	0.797	S	S	*	*			trans	-95.6	105.8	160.5	0	0	0	0	0	107.9	R49 T53	R49-A51 PolarHBondContact O-N 3.07Å; A51-T53 PolarHBondContact O-N 3.07Å; A51-T53 VanDerWaalsContact O-N 3.11Å
52	V	33.9	Very low	41	Very low	147 Å²	147	133.3 Å²	133.3	89%	0.891	79%	0.794	S	S	*	*			trans	-63.5	105.7	162.8	174.3	0	0	0	0	105.9
53	T	40.1	Very low	41.8	Very low	125 Å²	125	134.4 Å²	134.4	77%	0.767	79%	0.793	S	S	*	*			trans	-128.7	120.3	169.8	-36.3	0	0	0	0	108.4	A51	A51-T53 PolarHBondContact O-N 3.07Å; A51-T53 VanDerWaalsContact O-N 3.11Å
54	A	36.9	Very low	42.2	Very low	88 Å²	88	139.3 Å²	139.3	73%	0.727	80%	0.797	S	S	*	*			trans	-38.6	136.5	-177.1	0	0	0	0	0	114.1	P56	A54-P56 VanDerWaalsContact O-CD 3.24Å; A54-P56 WeakPolarHBondContact O-CD 3.46Å
55	L	35.7	Very low	43	Very low	151 Å²	151	138.8 Å²	138.8	79%	0.791	80%	0.796	S	S	*	*			trans	-41.3	111.9	161.3	-167.3	81	0	0	0	111	E57	L55-E57 PolarHBondContact O-N 3.41Å
56	P	48.1	Very low	43.7	Very low	96 Å²	96	139.3 Å²	139.3	62%	0.623	79%	0.791	S	S	*	*			trans	-79.5	112.2	160.6	29	-23.4	0	0	0	107.3	A54 Q58	A54-P56 VanDerWaalsContact O-CD 3.24Å; A54-P56 WeakPolarHBondContact O-CD 3.46Å; P56-Q58 HydrophobicContact CB-CG 4.5Å; P56-Q58 PolarHBondContact O-N 2.74Å
57	E	39.4	Very low	44.3	Very low	175 Å²	175	142.8 Å²	142.8	82%	0.818	79%	0.791	S	S	*	*			trans	-59.8	78.7	167.9	-60.6	176.8	127.2	0	0	110	L55 K59	L55-E57 PolarHBondContact O-N 3.41Å; E57-K59 VanDerWaalsContact C-N 3.3Å; E57-K59 PolarHBondContact O-N 3.44Å
58	Q	47.7	Very low	45.2	Very low	178 Å²	178	146 Å²	146	83%	0.832	80%	0.798	S	S	*	*			trans	-84.4	83.7	172.3	-72.5	-170.6	-98.6	0	0	109.8	P56	P56-Q58 HydrophobicContact CB-CG 4.5Å; P56-Q58 PolarHBondContact O-N 2.74Å
59	K	43.3	Very low	45.9	Very low	185 Å²	185	144.6 Å²	144.6	80%	0.804	79%	0.794	S	S	*	*			trans	25.2	106.3	136.3	-77.9	176.4	174.7	176.1	0	116.6	E57 L61	E57-K59 VanDerWaalsContact C-N 3.3Å; E57-K59 PolarHBondContact O-N 3.44Å; K59-L61 PolarHBondContact O-N 3.49Å
60	L	44.9	Very low	46.9	Very low	164 Å²	164	137 Å²	137	86%	0.859	78%	0.782	S	S	*	*				36.4	80.2	123	-55.9	-177.8	0	0	0	116.4
61	L	51	Low	47.8	Very low	169 Å²	169	142.6 Å²	142.6	89%	0.885	79%	0.788	S	S	*	*			trans	-102.8	90.3	141.4	-72.8	174.8	0	0	0	106.7	K59	K59-L61 PolarHBondContact O-N 3.49Å
62	A	51.5	Low	48.6	Very low	79 Å²	79	145.8 Å²	145.8	65%	0.653	79%	0.788	S	S	*	*			trans	-49.5	132.8	171.1	0	0	0	0	0	109	R64	A62-R64 PolarHBondContact O-N 3.27Å; A62-R64 VanDerWaalsContact O-N 3.07Å
63	P	57.5	Low	49.5	Very low	126 Å²	126	144.7 Å²	144.7	82%	0.818	78%	0.781	S	S	*	*			trans	-59.3	118.2	177.3	-16.9	28.2	0	0	0	108.1	P65	P63-P65 WeakPolarHBondContact O-CD 3.44Å
64	R	49.9	Very low	50.5	Low	228 Å²	228	146.6 Å²	146.6	86%	0.86	78%	0.779	S	S	*	*			trans	-71.2	113.7	165.6	-71.7	-176.6	176.9	-156.7	-0.5	106.9	A62 L66	A62-R64 PolarHBondContact O-N 3.27Å; A62-R64 VanDerWaalsContact O-N 3.07Å; R64-L66 PolarHBondContact O-N 3.28Å; R64-L66 VanDerWaalsContact O-N 3.07Å
65	P	58.3	Low	51.2	Low	118 Å²	118	148.2 Å²	148.2	77%	0.766	78%	0.78	S	S	*	*			trans	-71.8	104.2	169.7	29.3	-29.9	0	0	0	107.6	P63 F67	P63-P65 WeakPolarHBondContact O-CD 3.44Å; P65-F67 PolarHBondContact O-N 2.87Å
66	L	52.9	Low	52.2	Low	146 Å²	146	148.4 Å²	148.4	76%	0.764	78%	0.78	S	S	*	*			trans	-83	11.7	177	-90	176.6	0	0	0	114.1	R64	R64-L66 PolarHBondContact O-N 3.28Å; R64-L66 VanDerWaalsContact O-N 3.07Å
67	F	56	Low	52.6	Low	189 Å²	189	149.2 Å²	149.2	83%	0.829	78%	0.783	S	S	*	*			trans	-125.6	73.7	177.9	-62.8	-76.9	0	0	0	110.7	P65 A69	P65-F67 PolarHBondContact O-N 2.87Å; F67-A69 PolarHBondContact O-N 3.06Å
68	T	52.5	Low	53.5	Low	136 Å²	136	146.4 Å²	146.4	83%	0.834	78%	0.78	S	S	*	*			trans	-66.5	88.1	146.3	34.7	0	0	0	0	106.6	A70	T68-A70 PolarHBondContact O-N 2.78Å
69	A	54.3	Low	53.9	Low	91 Å²	91	144.4 Å²	144.4	75%	0.752	78%	0.779	S	S	*	*			trans	-63.5	89	165.8	0	0	0	0	0	107	F67 R71	F67-A69 PolarHBondContact O-N 3.06Å; A69-R71 PolarHBondContact O-N 2.84Å
70	A	53.9	Low	54.7	Low	80 Å²	80	140 Å²	140	66%	0.661	77%	0.772	S	S	*	*			trans	-55.2	111.9	166.6	0	0	0	0	0	105.7	T68 E72	T68-A70 PolarHBondContact O-N 2.78Å; A70-E72 PolarHBondContact O-N 3.34Å
71	R	58.6	Low	55.4	Low	238 Å²	238	137.9 Å²	137.9	90%	0.898	77%	0.771	S	S	*	*			trans	-63.3	76.6	162.6	-79.5	175.4	154	-171.8	-5.7	106.5	A69 V73	A69-R71 PolarHBondContact O-N 2.84Å; R71-V73 PolarHBondContact O-N 2.89Å
72	E	54.2	Low	55.8	Low	152 Å²	152	135.1 Å²	135.1	71%	0.71	76%	0.761	S	S	*	*			trans	-69.1	91.3	159.5	-77	-166.9	173.7	0	0	105.6	A70 K74	A70-E72 PolarHBondContact O-N 3.34Å; E72-K74 PolarHBondContact O-N 3.09Å
73	V	53.6	Low	56.3	Low	124 Å²	124	135.1 Å²	135.1	75%	0.752	76%	0.761	S	S	*	*			trans	-66	77.5	160.3	-176.9	0	0	0	0	105.1	R71 T75	R71-V73 PolarHBondContact O-N 2.89Å; V73-T75 VanDerWaalsContact C-N 3.29Å; V73-T75 PolarHBondContact O-N 2.99Å
74	K	60.7	Low	56.4	Low	166 Å²	166	134.3 Å²	134.3	72%	0.722	76%	0.756	S	S	*	*			trans	-64.9	102.4	165.3	-93.2	-169.8	174.9	-164.1	0	105.5	E72 I76	E72-K74 PolarHBondContact O-N 3.09Å; K74-I76 PolarHBondContact O-N 2.86Å
75	T	51.5	Low	57.1	Low	121 Å²	121	130.5 Å²	130.5	74%	0.742	76%	0.757	S	S	*	*			trans	-41.3	111	164	-58.4	0	0	0	0	107.3	V73 V77	V73-T75 VanDerWaalsContact C-N 3.29Å; V73-T75 PolarHBondContact O-N 2.99Å; T75-V77 VanDerWaalsContact C-N 3.29Å; T75-V77 PolarHBondContact O-N 3.34Å
76	I	57.5	Low	57.6	Low	156 Å²	156	129.8 Å²	129.8	80%	0.8	75%	0.751	S	S	*	*			trans	-66.4	98.8	175.7	-64.2	164.9	0	0	0	104.6	K74 P78	K74-I76 PolarHBondContact O-N 2.86Å; I76-P78 WeakPolarHBondContact O-CD 3.43Å
77	V	56.1	Low	58.2	Low	112 Å²	112	128 Å²	128	68%	0.679	75%	0.748	S	S	*	*			trans	-59.1	121.6	166.4	178	0	0	0	0	105.2	T75 V79	T75-V77 VanDerWaalsContact C-N 3.29Å; T75-V77 PolarHBondContact O-N 3.34Å; V77-V79 PolarHBondContact O-N 3.05Å
78	P	56.6	Low	58.8	Low	116 Å²	116	122.5 Å²	122.5	75%	0.753	73%	0.731	S	S	*	*			trans	-60.5	107.1	175.2	21.9	-28.8	0	0	0	107.3	I76 S80	I76-P78 WeakPolarHBondContact O-CD 3.43Å; P78-S80 PolarHBondContact O-N 3.33Å
79	V	57.3	Low	59.9	Low	136 Å²	136	126.4 Å²	126.4	82%	0.824	73%	0.731	S	S	*	*			trans	-62.5	113.7	167.8	168	0	0	0	0	105.4	V77 S81	V77-V79 PolarHBondContact O-N 3.05Å; V79-S81 PolarHBondContact O-N 2.9Å; V79-S81 VanDerWaalsContact O-N 3.13Å
80	S	59.8	Low	60.8	Low	93 Å²	93	125.8 Å²	125.8	65%	0.65	72%	0.719	S	S	*	*			trans	-48.8	119.1	173.8	-177.4	0	0	0	0	109	P78 V82	P78-S80 PolarHBondContact O-N 3.33Å; S80-V82 PolarHBondContact O-N 3.16Å
81	S	59.2	Low	62.1	Low	119 Å²	119	127.8 Å²	127.8	83%	0.832	72%	0.718	S	S	*	*			trans	-75.3	62.6	175.8	63	0	0	0	0	109.6	V79 A83	V79-S81 PolarHBondContact O-N 2.9Å; V79-S81 VanDerWaalsContact O-N 3.13Å; S81-A83 PolarHBondContact O-N 2.88Å
82	V	59	Low	63.2	Low	111 Å²	111	123 Å²	123	67%	0.673	70%	0.7	S	S	*	*			trans	-71.3	111.7	163.4	176.3	0	0	0	0	105.6	S80 P84	S80-V82 PolarHBondContact O-N 3.16Å; V82-P84 VanDerWaalsContact O-CD 3.31Å; V82-P84 WeakPolarHBondContact O-CD 3.26Å; V82-P84 VanDerWaalsContact O-N 3.12Å
83	A	63.2	Low	64.7	Low	79 Å²	79	119 Å²	119	65%	0.653	69%	0.686	S	S	*	*			trans	-51.8	120.2	171.5	0	0	0	0	0	107.9	S81 V85	S81-A83 PolarHBondContact O-N 2.88Å; A83-V85 PolarHBondContact O-N 3.01Å; A83-V85 VanDerWaalsContact O-N 3.11Å
84	P	59	Low	66.4	Low	110 Å²	110	115.7 Å²	115.7	71%	0.714	68%	0.677	S	S	*	*			trans	-58.1	123.1	177.1	-21.6	31.7	0	0	0	108.6	V82 T86	V82-P84 VanDerWaalsContact O-CD 3.31Å; V82-P84 WeakPolarHBondContact O-CD 3.26Å; V82-P84 VanDerWaalsContact O-N 3.12Å; P84-T86 PolarHBondContact O-N 2.79Å
85	V	64.1	Low	67.9	Low	147 Å²	147	113.5 Å²	113.5	89%	0.891	67%	0.669	S	S	*	*	S	Bend	trans	-63.5	-21.5	173.3	179.7	0	0	0	0	110.5	A83	A83-V85 PolarHBondContact O-N 3.01Å; A83-V85 VanDerWaalsContact O-N 3.11Å
86	T	68.9	Low	70	Confident	103 Å²	103	112.9 Å²	112.9	63%	0.632	66%	0.658	S	S	*	*	S	Bend	trans	-85.7	132.8	177.8	-47.9	0	0	0	0	110.7	P84	P84-T86 PolarHBondContact O-N 2.79Å
87	P	65.8	Low	71.9	Confident	108 Å²	108	108.5 Å²	108.5	70%	0.701	64%	0.639	S	S	*	*	P	Polyproline II helix	trans	-55.3	137.2	176	22.8	-33.6	0	0	0	110.3	R89	P87-R89 PolarHBondContact O-N 3.36Å
88	P	69.8	Low	73.9	Confident	74 Å²	74	104.4 Å²	104.4	48%	0.481	62%	0.617	S	S	.	*	P	Polyproline II helix	trans	-61.5	130.7	-175.5	23.9	-33.9	0	0	0	110.3	P130	P88-P130 HydrophobicContact CB-CB 3.54Å; P88-P130 HydrophobicContact CB-CG 3.48Å; P88-P130 VanDerWaalsContact CB-CG 3.48Å; P88-P130 HydrophobicContact CG-CB 3.87Å; P88-P130 HydrophobicContact CG-CG 3.32Å
89	R	75.1	Confident	75.8	Confident	219 Å²	219	102.1 Å²	102.1	83%	0.826	61%	0.608	S	S	*	*	P	Polyproline II helix	trans	-56.7	136.4	177.9	179.2	-178.6	-79.4	-177.2	-4	109.2	P87 L91	P87-R89 PolarHBondContact O-N 3.36Å; R89-L91 PolarHBondContact O-N 3.1Å
90	P	73.6	Confident	77.7	Confident	78 Å²	78	99.4 Å²	99.4	51%	0.506	59%	0.588	S	S	.	*	P	Polyproline II helix	trans	-53.9	124.6	171.7	-25.1	33.9	0	0	0	110.3	W127	P90-W127 HydrophobicContact CB-CE3 3.85Å; P90-W127 HydrophobicContact CB-CZ3 4.27Å; P90-W127 WeakPolarHBondContact O-CZ3 3.38Å
91	L	80	Confident	79.5	Confident	122 Å²	122	101.6 Å²	101.6	64%	0.639	58%	0.582	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-98.2	123.9	176.9	-176.6	62.1	0	0	0	108.5	R89 T93 G128	R89-L91 PolarHBondContact O-N 3.1Å; L91-T93 PolarHBondContact O-N 3.24Å; L91-G128 WeakPolarHBondContact O-CA 3.27Å; L91-G128 PolarHBondContact O-N 2.72Å
92	R	82.2	Confident	81.4	Confident	136 Å²	136	98.8 Å²	98.8	51%	0.513	56%	0.557	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-73.5	125.2	174.4	-165.4	168.3	-177.9	160	-0	109	S125 W127	R92-S125 PolarHBondContact NE-OG 2.76Å; R92-S125 PolarHBondContact NH2-OG 3.13Å; R92-W127 HydrophobicContact CB-CD2 4.36Å; R92-W127 HydrophobicContact CB-CE3 3.86Å; R92-W127 HydrophobicContact CB-CH2 4.35Å; R92-W127 HydrophobicContact CB-CZ3 3.86Å; R92-W127 HydrophobicContact CG-CD2 4.49Å; R92-W127 HydrophobicContact CG-CE3 4.48Å
93	T	86.4	Confident	83.2	Confident	69 Å²	69	95.7 Å²	95.7	42%	0.423	54%	0.543	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.4	128.6	168.5	-52.8	0	0	0	0	107.5	L91 S125 A126	L91-T93 PolarHBondContact O-N 3.24Å; T93-S125 VanDerWaalsContact O-CA 3.29Å; T93-S125 WeakPolarHBondContact O-CA 3.29Å; T93-S125 VanDerWaalsContact O-CB 3.26Å; T93-S125 WeakPolarHBondContact O-CB 3.5Å; T93-A126 WeakPolarHBondContact CB-O 3.45Å; T93-A126 PolarHBondContact N-O 2.95Å; T93-A126 PolarHBondContact O-N 3.26Å
94	G	88.8	Confident	84.9	Confident	55 Å²	55	94.5 Å²	94.5	57%	0.567	53%	0.529	S	S	*	.	P	Polyproline II helix	trans	-60.3	155.4	176	0	0	0	0	0	111.9
95	E	93.1	Very high	86.8	Confident	119 Å²	119	95 Å²	95	56%	0.556	52%	0.518	S	S	*	.	P	Polyproline II helix	trans	-69.3	149.4	169.5	63	-171.3	-151.8	0	0	110.6	V121 K123	E95-V121 HydrophobicContact CB-CG1 4.22Å; E95-K123 CarbonylContact C-O 3.57Å; E95-K123 VanDerWaalsContact CA-O 3.27Å; E95-K123 WeakPolarHBondContact CA-O 3.15Å
96	Q	94.9	Very high	88.4	Confident	108 Å²	108	93.2 Å²	93.2	51%	0.505	50%	0.502	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.5	126.6	171.8	-166.3	-177.8	-6.8	0	0	108	V121 I122 K123	Q96-V121 CarbonylContact O-C 3.58Å; Q96-I122 HydrophobicContact CB-CD1 4.46Å; Q96-I122 HydrophobicContact CB-CG1 4Å; Q96-I122 HydrophobicContact CG-CD1 3.82Å; Q96-I122 HydrophobicContact CG-CG1 3.87Å; Q96-I122 WeakPolarHBondContact O-CG1 3.32Å; Q96-I122 PolarHBondContact O-N 2.95Å; Q96-K123 HydrophobicContact CB-CB 3.67Å; Q96-K123 PolarHBondContact N-O 3.27Å; Q96-K123 PolarHBondContact O-N 3.12Å
97	T	97.2	Very high	89.8	Confident	64 Å²	64	90.5 Å²	90.5	39%	0.393	48%	0.483	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.8	140.5	-178.1	-60.8	0	0	0	0	109	F119 F120	T97-F119 HydrophobicContact CG2-CB 3.91Å; T97-F119 HydrophobicContact CG2-CD1 4.29Å; T97-F120 CarbonylContact C-O 3.54Å; T97-F120 VanDerWaalsContact CA-O 3.31Å; T97-F120 WeakPolarHBondContact CA-O 3.47Å; T97-F120 WeakPolarHBondContact CG2-O 3.22Å
98	A	97.1	Very high	91.3	Very high	27 Å²	27	91.9 Å²	91.9	22%	0.223	49%	0.485	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.8	155.5	170.3	0	0	0	0	0	109.9	F119 F120 I122	A98-F119 WeakPolarHBondContact O-CA 3.06Å; A98-F120 HydrophobicContact CB-CE1 4.26Å; A98-F120 HydrophobicContact CB-CE2 4.01Å; A98-F120 HydrophobicContact CB-CZ 3.84Å; A98-F120 PolarHBondContact N-O 3.03Å; A98-F120 PolarHBondContact O-N 2.83Å; A98-I122 HydrophobicContact CB-CD1 4.27Å; A98-I122 HydrophobicContact CB-CG1 4.45Å; A98-I122 HydrophobicContact CB-CG2 3.62Å
99	A	96.8	Very high	92.7	Very high	68 Å²	68	94.9 Å²	94.9	56%	0.562	49%	0.492	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-116.6	140.2	174.4	0	0	0	0	0	109.4	V118 F119	A99-V118 CarbonylContact C-O 3.57Å; A99-V118 VanDerWaalsContact CA-O 3.32Å; A99-V118 WeakPolarHBondContact CA-O 3.45Å; A99-F119 HydrophobicContact CB-CD1 3.67Å; A99-F119 HydrophobicContact CB-CE1 3.5Å; A99-F119 VanDerWaalsContact CB-CE1 3.5Å; A99-F119 HydrophobicContact CB-CZ 4.25Å
100	L	97.8	Very high	93.8	Very high	79 Å²	79	91.4 Å²	91.4	41%	0.414	49%	0.49	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.9	124.7	171.1	173.2	66.5	0	0	0	108.6	S117 V118 F120	L100-S117 CarbonylContact O-C 3.56Å; L100-S117 VanDerWaalsContact O-CA 3.28Å; L100-S117 WeakPolarHBondContact O-CA 3.2Å; L100-V118 HydrophobicContact CB-CG2 3.79Å; L100-V118 HydrophobicContact CD2-CG2 4.28Å; L100-V118 HydrophobicContact CG-CG2 4.38Å; L100-V118 PolarHBondContact N-O 3.25Å; L100-V118 PolarHBondContact O-N 2.78Å; L100-F120 HydrophobicContact CB-CE1 4.25Å
101	W	98.4	Very high	95	Very high	139 Å²	139	91.1 Å²	91.1	53%	0.527	49%	0.487	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.6	135.4	171.9	-178.4	74.8	0	0	0	110.1	A103 P115	W101-A103 HydrophobicContact CE3-CB 4.17Å; W101-A103 HydrophobicContact CH2-CB 3.55Å; W101-A103 HydrophobicContact CZ2-CB 4.4Å; W101-A103 VanDerWaalsContact CZ3-CA 3.49Å; W101-A103 HydrophobicContact CZ3-CB 3.4Å; W101-A103 VanDerWaalsContact CZ3-CB 3.4Å; W101-P115 HydrophobicContact CZ2-CB 4.03Å
102	I	97.4	Very high	95.9	Very high	60 Å²	60	91.1 Å²	91.1	31%	0.308	48%	0.479	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.6	115	177.8	-57.5	174.9	0	0	0	106.4	Y105 P115 S116 V118	I102-Y105 HydrophobicContact CG2-CE1 4.42Å; I102-P115 VanDerWaalsContact O-CA 3.29Å; I102-P115 WeakPolarHBondContact O-CA 3.29Å; I102-S116 PolarHBondContact N-O 3.11Å; I102-S116 PolarHBondContact O-N 2.98Å; I102-S116 VanDerWaalsContact O-N 3.1Å; I102-V118 HydrophobicContact CD1-CG1 4.28Å
103	A	98	Very high	96.6	Very high	46 Å²	46	87.4 Å²	87.4	38%	0.38	47%	0.468	S	S	.	.			trans	-61.7	152.2	176	0	0	0	0	0	110.9	W101 Y105	W101-A103 HydrophobicContact CE3-CB 4.17Å; W101-A103 HydrophobicContact CH2-CB 3.55Å; W101-A103 HydrophobicContact CZ2-CB 4.4Å; W101-A103 VanDerWaalsContact CZ3-CA 3.49Å; W101-A103 HydrophobicContact CZ3-CB 3.4Å; W101-A103 VanDerWaalsContact CZ3-CB 3.4Å; A103-Y105 WeakPolarHBondContact O-CD1 3.36Å
104	P	98.4	Very high	97.2	Very high	53 Å²	53	90.7 Å²	90.7	34%	0.344	48%	0.478	S	S	.	.			trans	-64.2	146.8	169.4	28.4	-30	0	0	0	110	Y112 H113	P104-Y112 HydrophobicContact CB-CE2 3.92Å; P104-Y112 WeakPolarHBondContact CB-OH 3.34Å; P104-H113 VanDerWaalsContact CA-O 3.28Å; P104-H113 WeakPolarHBondContact CA-O 3.24Å; P104-H113 WeakPolarHBondContact CB-O 3.36Å
105	Y	98.2	Very high	97.6	Very high	122 Å²	122	90.9 Å²	90.9	48%	0.478	47%	0.47	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-150.1	166.1	177.7	65.4	-85.5	0	0	0	110.6	I102 A103 D107 H113	I102-Y105 HydrophobicContact CG2-CE1 4.42Å; A103-Y105 WeakPolarHBondContact O-CD1 3.36Å; Y105-D107 HydrophobicContact CE2-CB 4.3Å; Y105-H113 HydrophobicContact CD1-CB 4.05Å; Y105-H113 HydrophobicContact CD2-CB 4.45Å; Y105-H113 AromaticContact CD2-CD2 3.99Å; Y105-H113 HydrophobicContact CE1-CB 3.75Å; Y105-H113 HydrophobicContact CE2-CB 4.16Å; Y105-H113 AromaticContact CE2-CD2 3.47Å; Y105-H113 VanDerWaalsContact CE2-CD2 3.47Å; Y105-H113 WeakPolarHBondContact CE2-CD2 3.28Å; Y105-H113 AromaticContact CE2-CG 3.8Å; Y105-H113 HydrophobicContact CG-CB 4.38Å; Y105-H113 AromaticContact CZ-CD2 3.81Å; Y105-H113 AromaticContact CZ-CG 3.64Å; Y105-H113 PolarHBondContact N-O 2.88Å; Y105-H113 PolarHBondContact O-N 3.06Å
106	I	98.3	Very high	97.8	Very high	108 Å²	108	88 Å²	88	55%	0.554	46%	0.462	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-107.9	132	171.4	-60.6	174.7	0	0	0	106.6	V111 Y112	I106-V111 WeakPolarHBondContact CA-O 3.32Å; I106-Y112 HydrophobicContact CG1-CD2 4.14Å
107	D	98	Very high	97.9	Very high	46 Å²	46	86 Å²	86	25%	0.246	46%	0.461	C	S	.	.			trans	-83.8	-174.5	176.6	69.6	18.1	0	0	0	112.3	Y105 Q109 D110 V111 H113	Y105-D107 HydrophobicContact CE2-CB 4.3Å; D107-Q109 PolarHBondContact O-N 2.88Å; D107-Q109 WeakPolarHBondContact OD1-CA 3.31Å; D107-Q109 PolarHBondContact OD1-N 3.26Å; D107-D110 PolarHBondContact O-N 3.04Å; D107-D110 PolarHBondContact OD1-N 3.22Å; D107-V111 PolarHBondContact N-O 3.49Å; D107-V111 WeakPolarHBondContact OD1-CB 3.28Å; D107-V111 PolarHBondContact OD1-N 3.41Å; D107-H113 IonicContact OD2-CD2 3.81Å; D107-H113 IonicContact OD2-CE1 3.68Å; D107-H113 IonicContact OD2-NE2 2.78Å; D107-H113 PolarHBondContact OD2-NE2 3.07Å
108	N	98.2	Very high	97.9	Very high	138 Å²	138	86 Å²	86	74%	0.738	46%	0.46	S	S	*	.	T	Hydrogen-bonded Turn	trans	-75	-4.5	-179.3	66.1	3.7	0	0	0	114.3
109	Q	98.5	Very high	98	Very high	137 Å²	137	92 Å²	92	64%	0.64	48%	0.482	S	S	*	.	T	Hydrogen-bonded Turn	trans	-104.2	16.4	173.9	-55.4	-51.5	-65.5	0	0	111.2	D107 V111	D107-Q109 PolarHBondContact O-N 2.88Å; D107-Q109 WeakPolarHBondContact OD1-CA 3.31Å; D107-Q109 PolarHBondContact OD1-N 3.26Å; Q109-V111 HydrophobicContact CB-CG2 4.14Å; Q109-V111 PolarHBondContact O-N 3.27Å
110	D	98	Very high	98	Very high	145 Å²	145	93.3 Å²	93.3	78%	0.775	48%	0.475	S	S	*	.	S	Bend	trans	58.6	23.6	-175.3	-62.1	-45.4	0	0	0	113.9	D107	D107-D110 PolarHBondContact O-N 3.04Å; D107-D110 PolarHBondContact OD1-N 3.22Å
111	V	98.7	Very high	97.9	Very high	73 Å²	73	93 Å²	93	44%	0.442	48%	0.476	S	S	.	.	P	Polyproline II helix	trans	-86.2	128.3	176.6	-179.5	0	0	0	0	109.8	I106 D107 Q109 H113	I106-V111 WeakPolarHBondContact CA-O 3.32Å; D107-V111 PolarHBondContact N-O 3.49Å; D107-V111 WeakPolarHBondContact OD1-CB 3.28Å; D107-V111 PolarHBondContact OD1-N 3.41Å; Q109-V111 HydrophobicContact CB-CG2 4.14Å; Q109-V111 PolarHBondContact O-N 3.27Å; V111-H113 PolarHBondContact O-CD2 2.82Å; V111-H113 VanDerWaalsContact O-CD2 3.25Å
112	Y	98.5	Very high	97.8	Very high	122 Å²	122	90.5 Å²	90.5	48%	0.478	47%	0.472	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-80.3	122.6	174	-178.5	-96	0	0	0	111.6	P104 I106 Q114	P104-Y112 HydrophobicContact CB-CE2 3.92Å; P104-Y112 WeakPolarHBondContact CB-OH 3.34Å; I106-Y112 HydrophobicContact CG1-CD2 4.14Å; Y112-Q114 VanDerWaalsContact CE1-NE2 3.31Å
113	H	98.3	Very high	97.7	Very high	58 Å²	58	93.1 Å²	93.1	27%	0.269	48%	0.481	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.7	128.9	175.4	-66.8	-89.1	0	0	0	110.4	P104 Y105 D107 V111	P104-H113 VanDerWaalsContact CA-O 3.28Å; P104-H113 WeakPolarHBondContact CA-O 3.24Å; P104-H113 WeakPolarHBondContact CB-O 3.36Å; Y105-H113 HydrophobicContact CD1-CB 4.05Å; Y105-H113 HydrophobicContact CD2-CB 4.45Å; Y105-H113 AromaticContact CD2-CD2 3.99Å; Y105-H113 HydrophobicContact CE1-CB 3.75Å; Y105-H113 HydrophobicContact CE2-CB 4.16Å; Y105-H113 AromaticContact CE2-CD2 3.47Å; Y105-H113 VanDerWaalsContact CE2-CD2 3.47Å; Y105-H113 WeakPolarHBondContact CE2-CD2 3.28Å; Y105-H113 AromaticContact CE2-CG 3.8Å; Y105-H113 HydrophobicContact CG-CB 4.38Å; Y105-H113 AromaticContact CZ-CD2 3.81Å; Y105-H113 AromaticContact CZ-CG 3.64Å; Y105-H113 PolarHBondContact N-O 2.88Å; Y105-H113 PolarHBondContact O-N 3.06Å; D107-H113 IonicContact OD2-CD2 3.81Å; D107-H113 IonicContact OD2-CE1 3.68Å; D107-H113 IonicContact OD2-NE2 2.78Å; D107-H113 PolarHBondContact OD2-NE2 3.07Å; V111-H113 PolarHBondContact O-CD2 2.82Å; V111-H113 VanDerWaalsContact O-CD2 3.25Å
114	Q	98.2	Very high	97.5	Very high	137 Å²	137	95.4 Å²	95.4	64%	0.64	49%	0.492	S	S	*	.	P	Polyproline II helix	trans	-68.7	151.1	178.1	-63.9	-64.4	-30.6	0	0	111	Y112	Y112-Q114 VanDerWaalsContact CE1-NE2 3.31Å
115	P	97.9	Very high	97.1	Very high	60 Å²	60	94.5 Å²	94.5	39%	0.39	49%	0.487	S	S	.	.	P	Polyproline II helix	trans	-62.2	146.9	172.3	26.7	-31.9	0	0	0	110.9	W101 I102	W101-P115 HydrophobicContact CZ2-CB 4.03Å; I102-P115 VanDerWaalsContact O-CA 3.29Å; I102-P115 WeakPolarHBondContact O-CA 3.29Å
116	S	97.6	Very high	96.6	Very high	57 Å²	57	91.3 Å²	91.3	40%	0.399	49%	0.486	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-145.7	166.4	178.2	59.8	0	0	0	0	111.6	I102	I102-S116 PolarHBondContact N-O 3.11Å; I102-S116 PolarHBondContact O-N 2.98Å; I102-S116 VanDerWaalsContact O-N 3.1Å
117	S	97.1	Very high	96	Very high	68 Å²	68	94.6 Å²	94.6	48%	0.476	49%	0.492	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-130.9	136.7	174.5	-64.6	0	0	0	0	109.9	L100	L100-S117 CarbonylContact O-C 3.56Å; L100-S117 VanDerWaalsContact O-CA 3.28Å; L100-S117 WeakPolarHBondContact O-CA 3.2Å
118	V	97.3	Very high	95.1	Very high	64 Å²	64	93.4 Å²	93.4	39%	0.388	49%	0.49	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.3	144.1	174.1	-60.7	0	0	0	0	110.2	A99 L100 I102	A99-V118 CarbonylContact C-O 3.57Å; A99-V118 VanDerWaalsContact CA-O 3.32Å; A99-V118 WeakPolarHBondContact CA-O 3.45Å; L100-V118 HydrophobicContact CB-CG2 3.79Å; L100-V118 HydrophobicContact CD2-CG2 4.28Å; L100-V118 HydrophobicContact CG-CG2 4.38Å; L100-V118 PolarHBondContact N-O 3.25Å; L100-V118 PolarHBondContact O-N 2.78Å; I102-V118 HydrophobicContact CD1-CG1 4.28Å
119	F	97.6	Very high	94	Very high	153 Å²	153	96.5 Å²	96.5	67%	0.671	50%	0.497	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-117	137.1	176.7	-65	-90.5	0	0	0	109.4	T97 A98 A99	T97-F119 HydrophobicContact CG2-CB 3.91Å; T97-F119 HydrophobicContact CG2-CD1 4.29Å; A98-F119 WeakPolarHBondContact O-CA 3.06Å; A99-F119 HydrophobicContact CB-CD1 3.67Å; A99-F119 HydrophobicContact CB-CE1 3.5Å; A99-F119 VanDerWaalsContact CB-CE1 3.5Å; A99-F119 HydrophobicContact CB-CZ 4.25Å
120	F	97.2	Very high	92.5	Very high	94 Å²	94	92 Å²	92	41%	0.412	48%	0.479	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-145.2	144.5	177.8	58.1	-85.1	0	0	0	111.4	T97 A98 L100 I122	T97-F120 CarbonylContact C-O 3.54Å; T97-F120 VanDerWaalsContact CA-O 3.31Å; T97-F120 WeakPolarHBondContact CA-O 3.47Å; T97-F120 WeakPolarHBondContact CG2-O 3.22Å; A98-F120 HydrophobicContact CB-CE1 4.26Å; A98-F120 HydrophobicContact CB-CE2 4.01Å; A98-F120 HydrophobicContact CB-CZ 3.84Å; A98-F120 PolarHBondContact N-O 3.03Å; A98-F120 PolarHBondContact O-N 2.83Å; L100-F120 HydrophobicContact CB-CE1 4.25Å; F120-I122 HydrophobicContact CD2-CG2 3.65Å; F120-I122 HydrophobicContact CE2-CG2 3.36Å; F120-I122 HydrophobicContact CZ-CG2 4.36Å; F120-I122 PolarHBondContact O-N 3.49Å
121	V	96.7	Very high	91	Very high	73 Å²	73	96.1 Å²	96.1	44%	0.442	48%	0.484	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.3	119.6	177.9	178.1	0	0	0	0	108.7	E95 Q96 K123	E95-V121 HydrophobicContact CB-CG1 4.22Å; Q96-V121 CarbonylContact O-C 3.58Å; V121-K123 VanDerWaalsContact CG1-C 3.49Å; V121-K123 WeakPolarHBondContact CG1-O 3.33Å
122	I	95.8	Very high	89.4	Confident	86 Å²	86	100 Å²	100	44%	0.441	50%	0.501	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.6	-25.7	174.1	55.8	166	0	0	0	112.2	Q96 A98 F120	Q96-I122 HydrophobicContact CB-CD1 4.46Å; Q96-I122 HydrophobicContact CB-CG1 4Å; Q96-I122 HydrophobicContact CG-CD1 3.82Å; Q96-I122 HydrophobicContact CG-CG1 3.87Å; Q96-I122 WeakPolarHBondContact O-CG1 3.32Å; Q96-I122 PolarHBondContact O-N 2.95Å; A98-I122 HydrophobicContact CB-CD1 4.27Å; A98-I122 HydrophobicContact CB-CG1 4.45Å; A98-I122 HydrophobicContact CB-CG2 3.62Å; F120-I122 HydrophobicContact CD2-CG2 3.65Å; F120-I122 HydrophobicContact CE2-CG2 3.36Å; F120-I122 HydrophobicContact CZ-CG2 4.36Å; F120-I122 PolarHBondContact O-N 3.49Å
123	K	95.1	Very high	87.6	Confident	116 Å²	116	104.5 Å²	104.5	50%	0.504	53%	0.533	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.8	115.1	172.5	-167.1	177.2	179.7	174.2	0	109	E95 Q96 V121	E95-K123 CarbonylContact C-O 3.57Å; E95-K123 VanDerWaalsContact CA-O 3.27Å; E95-K123 WeakPolarHBondContact CA-O 3.15Å; Q96-K123 HydrophobicContact CB-CB 3.67Å; Q96-K123 PolarHBondContact N-O 3.27Å; Q96-K123 PolarHBondContact O-N 3.12Å; V121-K123 VanDerWaalsContact CG1-C 3.49Å; V121-K123 WeakPolarHBondContact CG1-O 3.33Å
124	P	93.2	Very high	87.1	Confident	94 Å²	94	106.8 Å²	106.8	61%	0.61	55%	0.546	S	S	*	.			trans	-66.1	152.9	178.6	28.8	-34.4	0	0	0	110.5	A126	P124-A126 PolarHBondContact O-N 3.2Å
125	S	90.2	Very high	86.5	Confident	33 Å²	33	105.2 Å²	105.2	23%	0.231	54%	0.541	C	S	.	.			trans	-63.9	136	170.5	63	0	0	0	0	110	R92 T93	R92-S125 PolarHBondContact NE-OG 2.76Å; R92-S125 PolarHBondContact NH2-OG 3.13Å; T93-S125 VanDerWaalsContact O-CA 3.29Å; T93-S125 WeakPolarHBondContact O-CA 3.29Å; T93-S125 VanDerWaalsContact O-CB 3.26Å; T93-S125 WeakPolarHBondContact O-CB 3.5Å
126	A	88.5	Confident	85.9	Confident	55 Å²	55	107.7 Å²	107.7	46%	0.455	55%	0.55	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-139.9	150.3	-179.4	0	0	0	0	0	109.8	T93 P124 G128	T93-A126 WeakPolarHBondContact CB-O 3.45Å; T93-A126 PolarHBondContact N-O 2.95Å; T93-A126 PolarHBondContact O-N 3.26Å; P124-A126 PolarHBondContact O-N 3.2Å; A126-G128 PolarHBondContact O-N 3.34Å
127	W	86	Confident	85.2	Confident	178 Å²	178	110.7 Å²	110.7	67%	0.674	56%	0.559	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-67.3	118.1	169.3	-67.8	105	0	0	0	109	P90 R92	P90-W127 HydrophobicContact CB-CE3 3.85Å; P90-W127 HydrophobicContact CB-CZ3 4.27Å; P90-W127 WeakPolarHBondContact O-CZ3 3.38Å; R92-W127 HydrophobicContact CB-CD2 4.36Å; R92-W127 HydrophobicContact CB-CE3 3.86Å; R92-W127 HydrophobicContact CB-CH2 4.35Å; R92-W127 HydrophobicContact CB-CZ3 3.86Å; R92-W127 HydrophobicContact CG-CD2 4.49Å; R92-W127 HydrophobicContact CG-CE3 4.48Å
128	G	79.2	Confident	84.5	Confident	21 Å²	21	113.4 Å²	113.4	22%	0.216	56%	0.564	C	S	.	*	E	Extended strand (participates in β ladder)	trans	-92.7	157	177.6	0	0	0	0	0	111.5	L91 A126	L91-G128 WeakPolarHBondContact O-CA 3.27Å; L91-G128 PolarHBondContact O-N 2.72Å; A126-G128 PolarHBondContact O-N 3.34Å
129	K	75	Confident	83.6	Confident	203 Å²	203	116.7 Å²	116.7	88%	0.883	58%	0.576	S	S	*	*	P	Polyproline II helix	trans	-67.5	133.2	163.1	-67.3	-166	-179.5	-172.9	0	108.3	R131	K129-R131 PolarHBondContact O-N 2.86Å
130	P	66	Low	82.6	Confident	42 Å²	42	114.1 Å²	114.1	27%	0.273	57%	0.569	S	S	.	*	P	Polyproline II helix	trans	-57.8	134.4	173.4	19.6	-27.4	0	0	0	109.8	P88 I132	P88-P130 HydrophobicContact CB-CB 3.54Å; P88-P130 HydrophobicContact CB-CG 3.48Å; P88-P130 VanDerWaalsContact CB-CG 3.48Å; P88-P130 HydrophobicContact CG-CB 3.87Å; P88-P130 HydrophobicContact CG-CG 3.32Å; P130-I132 PolarHBondContact O-N 3.28Å
131	R	66.1	Low	81.5	Confident	232 Å²	232	115.6 Å²	115.6	88%	0.875	58%	0.581	S	S	*	*	P	Polyproline II helix	trans	-71	116.9	170.5	-71.6	-168.1	148.3	-164.6	-8.4	107.5	K129 N133	K129-R131 PolarHBondContact O-N 2.86Å; R131-N133 PolarHBondContact O-OD1 3.3Å
132	I	66.8	Low	80.2	Confident	154 Å²	154	119.2 Å²	119.2	79%	0.79	59%	0.592	S	S	*	*	P	Polyproline II helix	trans	-83.3	124.2	162.9	-56.7	173	0	0	0	104.5	P130	P130-I132 PolarHBondContact O-N 3.28Å
133	N	60.8	Low	78.8	Confident	216 Å²	216	122.2 Å²	122.2	100%	1.155	61%	0.606	S	S	*	*			trans	-90.2	0	179.9	-47.3	-18.1	0	0	0	109.8	R131	R131-N133 PolarHBondContact O-OD1 3.3Å

Retrieved 133 of 133 residues in 135.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).