A0A077ZM71_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZM71, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 104 aa.

						>A0A077ZM71_TRITR|A0A077ZM71
MARKPMVTRTIKVTQACVLCLDIEQGEPCTKEVTLSRTYKNDETLLKAAKAAVDTDTLKAVSISKSWVEEKLLGMPEDFFIAHATDIVRRKPDAEIPKQPRDPQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	66.1	Low	90.4	Very high	241 Å²	241	123.4 Å²	123.4	100%	1.187	62%	0.62	S	S	*	*				0	115.5	0	-157.8	178.2	-75.7	0	0	107
2	A	77.8	Confident	91	Very high	97 Å²	97	122.3 Å²	122.3	80%	0.802	61%	0.608	S	S	*	*	P	Polyproline II helix	trans	-66.7	136.7	-179.1	0	0	0	0	0	109.6	K4	A2-K4 PolarHBondContact O-N 3.13Å
3	R	84.1	Confident	91.5	Very high	247 Å²	247	113.5 Å²	113.5	93%	0.932	57%	0.565	S	S	*	*	P	Polyproline II helix	trans	-63.2	129.8	176.2	-73.3	-179	170.9	171.2	-2.6	108.3
4	K	91	Very high	91.9	Very high	158 Å²	158	105.6 Å²	105.6	69%	0.687	53%	0.526	S	S	*	.	P	Polyproline II helix	trans	-61.2	134.7	172.6	-69.6	-173	177.7	-174	0	108.8	A2	A2-K4 PolarHBondContact O-N 3.13Å
5	P	95.5	Very high	92.3	Very high	74 Å²	74	99.4 Å²	99.4	48%	0.481	50%	0.495	S	S	.	.	P	Polyproline II helix	trans	-65.2	143.1	175.4	29.8	-34.8	0	0	0	110.1	E77	P5-E77 HydrophobicContact CB-CG 4.2Å; P5-E77 WeakPolarHBondContact CB-OE2 3.17Å; P5-E77 HydrophobicContact CG-CB 4.32Å; P5-E77 HydrophobicContact CG-CG 4.4Å; P5-E77 WeakPolarHBondContact CG-OE2 3.18Å; P5-E77 PolarHBondContact O-N 2.93Å
6	M	96.4	Very high	92.7	Very high	95 Å²	95	93.2 Å²	93.2	47%	0.468	46%	0.464	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.9	133.8	-171.9	-65	-67.5	-69.2	0	0	109.7	T8 P76	M6-T8 HydrophobicContact CB-CG2 4.34Å; M6-P76 HydrophobicContact SD-CB 4.44Å; M6-P76 HydrophobicContact SD-CG 4.22Å
7	V	97.2	Very high	93	Very high	45 Å²	45	88.6 Å²	88.6	27%	0.273	44%	0.443	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.2	124.5	163.8	-178	0	0	0	0	107.5	G74 M75 E77 F80	V7-G74 CarbonylContact O-C 3.52Å; V7-G74 WeakPolarHBondContact O-CA 3.34Å; V7-M75 PolarHBondContact N-O 3.27Å; V7-M75 PolarHBondContact O-N 2.68Å; V7-E77 HydrophobicContact CG2-CB 4.49Å; V7-E77 HydrophobicContact CG2-CG 3.62Å; V7-F80 HydrophobicContact CB-CB 4.44Å; V7-F80 HydrophobicContact CB-CD2 4.48Å; V7-F80 HydrophobicContact CB-CG 4.38Å; V7-F80 HydrophobicContact CG1-CD2 4.17Å; V7-F80 HydrophobicContact CG1-CE2 4.38Å; V7-F80 HydrophobicContact CG1-CG 4.43Å; V7-F80 HydrophobicContact CG2-CB 3.88Å; V7-F80 HydrophobicContact CG2-CD1 4.07Å; V7-F80 HydrophobicContact CG2-CD2 4.4Å; V7-F80 HydrophobicContact CG2-CG 3.85Å
8	T	97.3	Very high	93.2	Very high	92 Å²	92	83.7 Å²	83.7	56%	0.564	42%	0.418	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-125.6	144	178	60.4	0	0	0	0	111.5	M6 L73	M6-T8 HydrophobicContact CB-CG2 4.34Å; T8-L73 CarbonylContact C-O 3.6Å; T8-L73 VanDerWaalsContact CA-O 3.26Å; T8-L73 WeakPolarHBondContact CA-O 3.4Å
9	R	96.3	Very high	93.4	Very high	177 Å²	177	82.5 Å²	82.5	67%	0.668	41%	0.413	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-147.4	134.4	172.7	-169.6	175.6	178.7	-150.8	0.8	111	I11 L73	R9-I11 HydrophobicContact CB-CG1 4.31Å; R9-I11 HydrophobicContact CG-CD1 4.36Å; R9-I11 HydrophobicContact CG-CG1 3.87Å; R9-L73 PolarHBondContact N-O 3.19Å; R9-L73 PolarHBondContact O-N 2.8Å
10	T	96.9	Very high	93.6	Very high	81 Å²	81	78.4 Å²	78.4	50%	0.497	39%	0.393	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-82	127	166.5	-51.9	0	0	0	0	109.4	E70 K71	T10-E70 HydrophobicContact CG2-CB 4.22Å; T10-K71 WeakPolarHBondContact CA-O 3.32Å
11	I	96	Very high	93.8	Very high	50 Å²	50	78.2 Å²	78.2	26%	0.256	39%	0.392	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.7	138.7	-178.3	-54.1	178.5	0	0	0	108.9	R9 V13 K71	R9-I11 HydrophobicContact CB-CG1 4.31Å; R9-I11 HydrophobicContact CG-CD1 4.36Å; R9-I11 HydrophobicContact CG-CG1 3.87Å; I11-V13 HydrophobicContact CG2-CG1 4.47Å; I11-K71 PolarHBondContact N-O 2.96Å; I11-K71 PolarHBondContact O-N 3.3Å
12	K	97.1	Very high	95.2	Very high	110 Å²	110	68.3 Å²	68.3	48%	0.478	34%	0.344	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.8	120.6	165.3	-72.9	-177.8	179.1	-174.8	0	109.5	R37 T38 V68 E69 E70	K12-R37 WeakPolarHBondContact O-CA 3.44Å; K12-R37 PolarHBondContact O-N 3.25Å; K12-T38 HydrophobicContact CB-CG2 4Å; K12-T38 HydrophobicContact CD-CG2 4.34Å; K12-V68 HydrophobicContact CB-CG1 4.24Å; K12-V68 HydrophobicContact CG-CG1 4.47Å; K12-E69 WeakPolarHBondContact CA-O 3.34Å; K12-E70 WeakPolarHBondContact CE-OE1 2.89Å; K12-E70 HydrophobicContact CG-CG 3.67Å; K12-E70 IonicContact NZ-OE1 3.72Å
13	V	97.3	Very high	96	Very high	8 Å²	8	68.2 Å²	68.2	5%	0.048	33%	0.329	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.6	148.6	174.1	-58.4	0	0	0	0	109.6	I11 T34 L35 V68 E69 K71	I11-V13 HydrophobicContact CG2-CG1 4.47Å; V13-T34 HydrophobicContact CB-CG2 3.91Å; V13-T34 HydrophobicContact CG1-CG2 4.21Å; V13-T34 HydrophobicContact CG2-CG2 4.01Å; V13-L35 WeakPolarHBondContact CA-O 3.41Å; V13-V68 WeakPolarHBondContact O-CA 3.2Å; V13-E69 HydrophobicContact CG2-CG 3.53Å; V13-E69 PolarHBondContact N-O 3.46Å; V13-E69 PolarHBondContact O-N 3.35Å; V13-K71 HydrophobicContact CG2-CD 3.95Å; V13-K71 HydrophobicContact CG2-CG 4.26Å
14	T	98.1	Very high	96.5	Very high	4 Å²	4	63.8 Å²	63.8	3%	0.025	32%	0.319	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.2	121.5	169.7	-56.2	0	0	0	0	108.1	L35 R37 T38 Y39 L45 W67	T14-L35 PolarHBondContact N-O 3.33Å; T14-L35 PolarHBondContact O-N 2.78Å; T14-R37 PolarHBondContact N-O 3.34Å; T14-R37 PolarHBondContact OG1-O 3.12Å; T14-T38 WeakPolarHBondContact OG1-CA 3.46Å; T14-Y39 HydrophobicContact CG2-CD2 4.18Å; T14-L45 HydrophobicContact CG2-CD1 3.75Å; T14-L45 HydrophobicContact CG2-CD2 4.07Å; T14-W67 CarbonylContact C-O 3.56Å; T14-W67 WeakPolarHBondContact CA-O 3.36Å
15	Q	97.6	Very high	96.6	Very high	12 Å²	12	62.8 Å²	62.8	6%	0.056	32%	0.317	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.9	137.4	166.3	-62.5	-61.4	-13.7	0	0	108.4	V33 T34 S66 W67 E69 K71	Q15-V33 WeakPolarHBondContact CA-O 3.33Å; Q15-V33 PolarHBondContact OE1-O 3Å; Q15-T34 VanDerWaalsContact CD-OG1 3.24Å; Q15-T34 PolarHBondContact NE2-OG1 3.43Å; Q15-T34 PolarHBondContact OE1-OG1 3.32Å; Q15-S66 CarbonylContact O-C 3.54Å; Q15-S66 WeakPolarHBondContact O-CA 3.15Å; Q15-W67 HydrophobicContact CB-CD2 3.59Å; Q15-W67 HydrophobicContact CB-CE3 3.89Å; Q15-W67 HydrophobicContact CB-CG 4.24Å; Q15-W67 HydrophobicContact CB-CH2 3.65Å; Q15-W67 HydrophobicContact CB-CZ2 3.32Å; Q15-W67 HydrophobicContact CB-CZ3 3.92Å; Q15-W67 HydrophobicContact CG-CD2 4.31Å; Q15-W67 HydrophobicContact CG-CH2 4.35Å; Q15-W67 HydrophobicContact CG-CZ2 3.59Å; Q15-W67 PolarHBondContact N-O 2.77Å; Q15-W67 PolarHBondContact O-N 3.42Å; Q15-E69 HydrophobicContact CG-CG 4.31Å; Q15-E69 PolarHBondContact NE2-OE1 2.96Å; Q15-K71 VanDerWaalsContact NE2-NZ 3.12Å
16	A	97.7	Very high	96.5	Very high	0 Å²	0	61.8 Å²	61.8	0%	0	32%	0.32	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.8	131.2	176.2	0	0	0	0	0	111.1	V18 E32 V33 L45 I63 K65	A16-V18 HydrophobicContact CB-CG2 4.17Å; A16-E32 WeakPolarHBondContact O-CA 3.38Å; A16-V33 HydrophobicContact CB-CG2 3.98Å; A16-V33 PolarHBondContact N-O 3.21Å; A16-V33 PolarHBondContact O-N 3.14Å; A16-L45 HydrophobicContact CB-CD1 4.32Å; A16-L45 HydrophobicContact CB-CD2 4.07Å; A16-L45 HydrophobicContact CB-CG 4.4Å; A16-I63 HydrophobicContact CB-CD1 4.36Å; A16-K65 CarbonylContact C-O 3.52Å; A16-K65 VanDerWaalsContact CA-O 3.31Å; A16-K65 WeakPolarHBondContact CA-O 3.48Å
17	C	97.6	Very high	96.3	Very high	16 Å²	16	62.9 Å²	62.9	11%	0.108	32%	0.324	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.1	110.2	162.6	-55.9	0	0	0	0	107.2	T30 S64 K65	C17-T30 HydrophobicContact CB-CG2 4.1Å; C17-S64 PolarHBondContact O-N 3.41Å; C17-K65 HydrophobicContact CB-CB 4.1Å; C17-K65 PolarHBondContact N-O 2.85Å; C17-K65 PolarHBondContact O-N 3.36Å
18	V	97.7	Very high	96.3	Very high	0 Å²	0	65.3 Å²	65.3	0%	0	34%	0.341	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.6	125.1	-176.2	-171.6	0	0	0	0	108.1	A16 T30 K31 V33 L46 A49 A60 I63	A16-V18 HydrophobicContact CB-CG2 4.17Å; V18-T30 WeakPolarHBondContact O-CA 3.35Å; V18-K31 PolarHBondContact N-O 2.82Å; V18-K31 PolarHBondContact O-N 3.31Å; V18-V33 HydrophobicContact CG2-CG2 3.66Å; V18-L46 HydrophobicContact CG1-CD1 4.47Å; V18-A49 HydrophobicContact CG1-CB 4.46Å; V18-A49 HydrophobicContact CG2-CB 3.87Å; V18-A60 HydrophobicContact CG1-CB 3.55Å; V18-I63 HydrophobicContact CG1-CD1 4.41Å; V18-I63 HydrophobicContact CG2-CD1 3.93Å
19	L	97.6	Very high	96.2	Very high	60 Å²	60	63 Å²	63	31%	0.314	33%	0.328	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-76.4	123.1	167.6	-177.2	67	0	0	0	107.9	P28 V61 S62	L19-P28 HydrophobicContact CD1-CB 4.16Å; L19-V61 PolarHBondContact O-N 2.75Å; L19-S62 PolarHBondContact N-O 2.83Å; L19-S62 PolarHBondContact O-N 3.02Å
20	C	97	Very high	96.2	Very high	1 Å²	1	58.8 Å²	58.8	1%	0.007	32%	0.322	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.9	154.6	179.1	-60.2	0	0	0	0	110.2	P28 C29 L58 K59	C20-P28 CarbonylContact O-C 3.56Å; C20-P28 WeakPolarHBondContact O-CA 3.48Å; C20-C29 WeakPolarHBondContact CA-O 3.5Å; C20-C29 PolarHBondContact N-O 2.84Å; C20-C29 PolarHBondContact O-N 3.23Å; C20-C29 VanDerWaalsContact O-O 3.12Å; C20-L58 HydrophobicContact CB-CD1 3.81Å; C20-L58 HydrophobicContact CB-CD2 4.42Å; C20-L58 HydrophobicContact CB-CG 4.02Å; C20-K59 CarbonylContact C-O 3.45Å; C20-K59 WeakPolarHBondContact CA-O 3.43Å
21	L	97.3	Very high	96.1	Very high	74 Å²	74	59.6 Å²	59.6	39%	0.387	32%	0.318	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.3	123	168.9	-174.9	68	0	0	0	108.5	K59 V61	L21-K59 PolarHBondContact N-O 3.03Å; L21-K59 PolarHBondContact O-N 2.96Å; L21-V61 HydrophobicContact CB-CG2 4Å
22	D	96.3	Very high	96.2	Very high	34 Å²	34	64 Å²	64	18%	0.182	34%	0.338	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-82	115.2	166.4	-168.1	-47.1	0	0	0	108.3	E24 Q25 G26 E27 T57 L58	D22-E24 PolarHBondContact OD1-N 2.78Å; D22-Q25 HydrophobicContact CB-CB 4.42Å; D22-Q25 PolarHBondContact OD1-N 2.82Å; D22-Q25 VanDerWaalsContact OD1-N 3.13Å; D22-G26 CarbonylContact O-C 3.58Å; D22-G26 WeakPolarHBondContact O-CA 3.46Å; D22-G26 PolarHBondContact O-N 2.89Å; D22-E27 PolarHBondContact N-O 2.99Å; D22-E27 PolarHBondContact O-N 2.89Å; D22-T57 CarbonylContact C-O 3.6Å; D22-L58 HydrophobicContact CB-CD1 4.25Å
23	I	94.8	Very high	96.1	Very high	94 Å²	94	59.7 Å²	59.7	48%	0.482	32%	0.321	S	S	.	.	T	Hydrogen-bonded Turn	trans	-74.5	-30.9	-176.2	-62.3	170.4	0	0	0	111	T57 K59	I23-T57 PolarHBondContact N-O 2.83Å; I23-K59 HydrophobicContact CD1-CG 3.64Å; I23-K59 HydrophobicContact CG1-CG 4.42Å
24	E	93.5	Very high	96.1	Very high	154 Å²	154	63.1 Å²	63.1	72%	0.72	34%	0.342	S	S	*	.	T	Hydrogen-bonded Turn	trans	-72.9	-42.6	-179.3	-66.4	-170.7	160.3	0	0	111	D22 T57	D22-E24 PolarHBondContact OD1-N 2.78Å; E24-T57 VanDerWaalsContact CD-CG2 3.48Å; E24-T57 HydrophobicContact CG-CG2 3.67Å; E24-T57 WeakPolarHBondContact OE1-CG2 2.99Å
25	Q	93.9	Very high	96.1	Very high	138 Å²	138	63.7 Å²	63.7	65%	0.645	35%	0.345	S	S	*	.	T	Hydrogen-bonded Turn	trans	-89	-21.2	-179.8	-60.4	-169.2	-19.4	0	0	112.9	D22 E27	D22-Q25 HydrophobicContact CB-CB 4.42Å; D22-Q25 PolarHBondContact OD1-N 2.82Å; D22-Q25 VanDerWaalsContact OD1-N 3.13Å; Q25-E27 HydrophobicContact CB-CB 4.37Å; Q25-E27 HydrophobicContact CB-CG 4.26Å; Q25-E27 PolarHBondContact O-N 2.75Å
26	G	92.2	Very high	95.8	Very high	53 Å²	53	66.5 Å²	66.5	55%	0.546	37%	0.366	S	S	.	.			trans	71.6	16.2	-172.9	0	0	0	0	0	113.4	D22	D22-G26 CarbonylContact O-C 3.58Å; D22-G26 WeakPolarHBondContact O-CA 3.46Å; D22-G26 PolarHBondContact O-N 2.89Å
27	E	93.6	Very high	95.6	Very high	118 Å²	118	75.6 Å²	75.6	55%	0.551	40%	0.4	S	S	*	.			trans	-105.7	139.7	-173.6	-66.9	-170.8	174.3	0	0	112.1	D22 Q25	D22-E27 PolarHBondContact N-O 2.99Å; D22-E27 PolarHBondContact O-N 2.89Å; Q25-E27 HydrophobicContact CB-CB 4.37Å; Q25-E27 HydrophobicContact CB-CG 4.26Å; Q25-E27 PolarHBondContact O-N 2.75Å
28	P	95.5	Very high	95.5	Very high	96 Å²	96	78.6 Å²	78.6	62%	0.623	42%	0.418	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-73.5	133.9	169.7	30.2	-31.8	0	0	0	110.1	L19 C20	L19-P28 HydrophobicContact CD1-CB 4.16Å; C20-P28 CarbonylContact O-C 3.56Å; C20-P28 WeakPolarHBondContact O-CA 3.48Å
29	C	95.3	Very high	95.4	Very high	43 Å²	43	81.9 Å²	81.9	29%	0.291	43%	0.431	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.7	155.5	173	65	0	0	0	0	111.4	C20 L58	C20-C29 WeakPolarHBondContact CA-O 3.5Å; C20-C29 PolarHBondContact N-O 2.84Å; C20-C29 PolarHBondContact O-N 3.23Å; C20-C29 VanDerWaalsContact O-O 3.12Å; C29-L58 VanDerWaalsContact SG-CD1 3.59Å
30	T	96.4	Very high	95.3	Very high	89 Å²	89	89 Å²	89	55%	0.546	46%	0.46	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.6	129.3	177.5	-59.2	0	0	0	0	109.7	C17 V18	C17-T30 HydrophobicContact CB-CG2 4.1Å; V18-T30 WeakPolarHBondContact O-CA 3.35Å
31	K	96.1	Very high	95.2	Very high	97 Å²	97	92.6 Å²	92.6	42%	0.422	48%	0.479	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.9	135.5	171.5	-74.8	-159.9	174.9	179.7	0	111.6	V18 V53 L58	V18-K31 PolarHBondContact N-O 2.82Å; V18-K31 PolarHBondContact O-N 3.31Å; K31-V53 HydrophobicContact CD-CG1 4.04Å; K31-L58 HydrophobicContact CD-CD2 3.7Å
32	E	97.1	Very high	95.1	Very high	144 Å²	144	93.3 Å²	93.3	67%	0.673	48%	0.483	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-87.5	131.4	168.4	-66.8	-170.4	170.5	0	0	110	A16	A16-E32 WeakPolarHBondContact O-CA 3.38Å
33	V	96.5	Very high	95.1	Very high	18 Å²	18	99 Å²	99	11%	0.109	51%	0.508	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.1	139.4	174.8	-63.5	0	0	0	0	111.7	Q15 A16 V18 L35 A49 V53	Q15-V33 WeakPolarHBondContact CA-O 3.33Å; Q15-V33 PolarHBondContact OE1-O 3Å; A16-V33 HydrophobicContact CB-CG2 3.98Å; A16-V33 PolarHBondContact N-O 3.21Å; A16-V33 PolarHBondContact O-N 3.14Å; V18-V33 HydrophobicContact CG2-CG2 3.66Å; V33-L35 HydrophobicContact CG2-CD1 4.21Å; V33-L35 HydrophobicContact CG2-CG 4.14Å; V33-A49 HydrophobicContact CG2-CB 4.43Å; V33-V53 HydrophobicContact CG1-CG2 3.28Å
34	T	97	Very high	95.2	Very high	81 Å²	81	97.5 Å²	97.5	50%	0.497	50%	0.504	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-100.3	114.4	168.9	-58.1	0	0	0	0	108.7	V13 Q15	V13-T34 HydrophobicContact CB-CG2 3.91Å; V13-T34 HydrophobicContact CG1-CG2 4.21Å; V13-T34 HydrophobicContact CG2-CG2 4.01Å; Q15-T34 VanDerWaalsContact CD-OG1 3.24Å; Q15-T34 PolarHBondContact NE2-OG1 3.43Å; Q15-T34 PolarHBondContact OE1-OG1 3.32Å
35	L	96.8	Very high	95.4	Very high	16 Å²	16	90.3 Å²	90.3	8%	0.084	47%	0.47	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.8	140.4	177.9	-64.3	172.4	0	0	0	110.4	V13 T14 V33 Y39 L45 A48 A49 A52	V13-L35 WeakPolarHBondContact CA-O 3.41Å; T14-L35 PolarHBondContact N-O 3.33Å; T14-L35 PolarHBondContact O-N 2.78Å; V33-L35 HydrophobicContact CG2-CD1 4.21Å; V33-L35 HydrophobicContact CG2-CG 4.14Å; L35-Y39 HydrophobicContact CB-CE2 3.89Å; L35-Y39 HydrophobicContact CD1-CE2 4.29Å; L35-L45 HydrophobicContact CD1-CD1 3.59Å; L35-A48 HydrophobicContact CD1-CB 3.98Å; L35-A49 HydrophobicContact CD1-CB 4.23Å; L35-A52 HydrophobicContact CD2-CB 3.89Å
36	S	93.2	Very high	95.5	Very high	71 Å²	71	85.2 Å²	85.2	50%	0.497	45%	0.447	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-67	145.2	173.1	72.4	0	0	0	0	110.1	Y39	S36-Y39 PolarHBondContact O-OH 3.45Å
37	R	92.1	Very high	95.8	Very high	191 Å²	191	90.6 Å²	90.6	72%	0.721	46%	0.455	S	S	*	.	S	Bend	trans	75.8	177.7	178.2	-44.3	172.4	-177.2	-164.5	-0.6	113.2	K12 T14	K12-R37 WeakPolarHBondContact O-CA 3.44Å; K12-R37 PolarHBondContact O-N 3.25Å; T14-R37 PolarHBondContact N-O 3.34Å; T14-R37 PolarHBondContact OG1-O 3.12Å
38	T	95.4	Very high	95.9	Very high	79 Å²	79	86 Å²	86	49%	0.485	44%	0.438	S	S	.	.			trans	-107.8	147.9	173.9	59.2	0	0	0	0	110	K12 T14 V68	K12-T38 HydrophobicContact CB-CG2 4Å; K12-T38 HydrophobicContact CD-CG2 4.34Å; T14-T38 WeakPolarHBondContact OG1-CA 3.46Å; T38-V68 HydrophobicContact CG2-CB 4.45Å; T38-V68 HydrophobicContact CG2-CG1 3.64Å; T38-V68 HydrophobicContact CG2-CG2 3.88Å
39	Y	96.5	Very high	96	Very high	69 Å²	69	81.5 Å²	81.5	27%	0.271	41%	0.408	S	S	.	.			trans	-113.8	149.2	-178	-63.2	-92.7	0	0	0	110.1	T14 L35 S36 L45 A48	T14-Y39 HydrophobicContact CG2-CD2 4.18Å; L35-Y39 HydrophobicContact CB-CE2 3.89Å; L35-Y39 HydrophobicContact CD1-CE2 4.29Å; S36-Y39 PolarHBondContact O-OH 3.45Å; Y39-L45 HydrophobicContact CD1-CB 4.48Å; Y39-L45 HydrophobicContact CD2-CB 4.47Å; Y39-L45 HydrophobicContact CD2-CD1 3.53Å; Y39-L45 HydrophobicContact CE2-CD1 3.86Å; Y39-L45 HydrophobicContact CG-CB 4.03Å; Y39-L45 HydrophobicContact CG-CD1 3.95Å; Y39-A48 HydrophobicContact CD1-CB 4.43Å; Y39-A48 HydrophobicContact CE1-CB 3.42Å; Y39-A48 VanDerWaalsContact CE1-CB 3.42Å; Y39-A48 WeakPolarHBondContact OH-CB 3.22Å
40	K	94.2	Very high	96.1	Very high	210 Å²	210	83.5 Å²	83.5	91%	0.913	41%	0.412	S	S	*	.	S	Bend	trans	-77.4	-32.8	-175.3	-68.3	-175.8	177.3	-177.7	0	112.3
41	N	95.2	Very high	96.1	Very high	76 Å²	76	83.8 Å²	83.8	41%	0.406	42%	0.423	S	S	.	.	S	Bend	trans	-155.1	165.5	-175.7	59.9	16.1	0	0	0	110.1	E43 T44 L45	N41-E43 PolarHBondContact O-N 2.81Å; N41-T44 PolarHBondContact N-OG1 3.21Å; N41-T44 PolarHBondContact O-N 3.45Å; N41-T44 PolarHBondContact O-OG1 3.28Å; N41-T44 WeakPolarHBondContact OD1-CB 3.18Å; N41-T44 VanDerWaalsContact OD1-CG2 3.27Å; N41-T44 WeakPolarHBondContact OD1-CG2 3.4Å; N41-T44 PolarHBondContact OD1-N 2.81Å; N41-T44 PolarHBondContact OD1-OG1 3.31Å; N41-L45 PolarHBondContact O-N 3.44Å; N41-L45 VanDerWaalsContact O-N 3.12Å
42	D	95.2	Very high	96	Very high	88 Å²	88	82.2 Å²	82.2	47%	0.471	43%	0.429	S	S	.	.	H	α-helix	trans	-64.8	-24	-177.9	-70.5	-21.6	0	0	0	113.1	L45 L46 I63	D42-L45 PolarHBondContact O-N 2.9Å; D42-L46 WeakPolarHBondContact O-CB 3.39Å; D42-L46 PolarHBondContact O-N 2.88Å; D42-I63 HydrophobicContact CB-CB 4.36Å; D42-I63 HydrophobicContact CB-CG1 4.35Å
43	E	95.9	Very high	95.9	Very high	154 Å²	154	76 Å²	76	72%	0.72	40%	0.4	S	S	*	.	H	α-helix	trans	-67.3	-48.5	175.8	-170.4	-174.3	173.3	0	0	111.9	N41 L45 L46 K47	N41-E43 PolarHBondContact O-N 2.81Å; E43-L45 VanDerWaalsContact C-N 3.29Å; E43-L45 PolarHBondContact O-N 3.05Å; E43-L46 PolarHBondContact O-N 3.35Å; E43-K47 PolarHBondContact O-N 3.42Å
44	T	97.2	Very high	95.9	Very high	63 Å²	63	78 Å²	78	39%	0.387	41%	0.41	S	S	.	.	H	α-helix	trans	-66.4	-33.9	175.8	54.3	0	0	0	0	111.9	N41 A48	N41-T44 PolarHBondContact N-OG1 3.21Å; N41-T44 PolarHBondContact O-N 3.45Å; N41-T44 PolarHBondContact O-OG1 3.28Å; N41-T44 WeakPolarHBondContact OD1-CB 3.18Å; N41-T44 VanDerWaalsContact OD1-CG2 3.27Å; N41-T44 WeakPolarHBondContact OD1-CG2 3.4Å; N41-T44 PolarHBondContact OD1-N 2.81Å; N41-T44 PolarHBondContact OD1-OG1 3.31Å; T44-A48 PolarHBondContact O-N 2.81Å
45	L	97.6	Very high	95.9	Very high	3 Å²	3	77.4 Å²	77.4	2%	0.016	41%	0.407	C	S	.	.	H	α-helix	trans	-66.5	-46.9	173.5	178.2	57.7	0	0	0	111.6	T14 A16 L35 Y39 N41 D42 E43 K47 A48 A49 I63 S66	T14-L45 HydrophobicContact CG2-CD1 3.75Å; T14-L45 HydrophobicContact CG2-CD2 4.07Å; A16-L45 HydrophobicContact CB-CD1 4.32Å; A16-L45 HydrophobicContact CB-CD2 4.07Å; A16-L45 HydrophobicContact CB-CG 4.4Å; L35-L45 HydrophobicContact CD1-CD1 3.59Å; Y39-L45 HydrophobicContact CD1-CB 4.48Å; Y39-L45 HydrophobicContact CD2-CB 4.47Å; Y39-L45 HydrophobicContact CD2-CD1 3.53Å; Y39-L45 HydrophobicContact CE2-CD1 3.86Å; Y39-L45 HydrophobicContact CG-CB 4.03Å; Y39-L45 HydrophobicContact CG-CD1 3.95Å; N41-L45 PolarHBondContact O-N 3.44Å; N41-L45 VanDerWaalsContact O-N 3.12Å; D42-L45 PolarHBondContact O-N 2.9Å; E43-L45 VanDerWaalsContact C-N 3.29Å; E43-L45 PolarHBondContact O-N 3.05Å; L45-K47 VanDerWaalsContact C-N 3.29Å; L45-K47 PolarHBondContact O-N 2.79Å; L45-A48 PolarHBondContact O-N 2.82Å; L45-A48 VanDerWaalsContact O-N 3.12Å; L45-A49 WeakPolarHBondContact O-CB 3.47Å; L45-A49 PolarHBondContact O-N 3.36Å; L45-I63 HydrophobicContact CD2-CD1 4.31Å; L45-I63 HydrophobicContact CD2-CG1 4.15Å; L45-I63 HydrophobicContact CD2-CG2 4.04Å; L45-I63 HydrophobicContact CG-CD1 4.04Å; L45-I63 HydrophobicContact CG-CG1 4.16Å; L45-S66 VanDerWaalsContact CD2-CB 3.42Å
46	L	97.4	Very high	95.8	Very high	31 Å²	31	83.9 Å²	83.9	16%	0.162	44%	0.441	C	S	.	.	H	α-helix	trans	-61.3	-37.9	178.7	-177	62.3	0	0	0	111.5	V18 D42 E43 A48 A49 K50 A60 V61 I63	V18-L46 HydrophobicContact CG1-CD1 4.47Å; D42-L46 WeakPolarHBondContact O-CB 3.39Å; D42-L46 PolarHBondContact O-N 2.88Å; E43-L46 PolarHBondContact O-N 3.35Å; L46-A48 VanDerWaalsContact C-N 3.32Å; L46-A48 PolarHBondContact O-N 3.27Å; L46-A49 PolarHBondContact O-N 2.82Å; L46-K50 HydrophobicContact CG-CD 4.44Å; L46-K50 WeakPolarHBondContact O-CB 3.44Å; L46-K50 WeakPolarHBondContact O-CG 3.19Å; L46-K50 PolarHBondContact O-N 3.49Å; L46-A60 HydrophobicContact CD1-CB 4.23Å; L46-V61 WeakPolarHBondContact CD2-O 3.41Å; L46-I63 HydrophobicContact CB-CD1 4.27Å; L46-I63 HydrophobicContact CB-CG1 4.09Å; L46-I63 HydrophobicContact CD1-CD1 4.03Å; L46-I63 HydrophobicContact CD1-CG1 4.38Å
47	K	97.3	Very high	95.9	Very high	166 Å²	166	82.8 Å²	82.8	72%	0.722	43%	0.432	S	S	*	.	H	α-helix	trans	-61.9	-41	175.2	-171.8	173.8	-177.3	174.2	0	112.2	E43 L45 A51	E43-K47 PolarHBondContact O-N 3.42Å; L45-K47 VanDerWaalsContact C-N 3.29Å; L45-K47 PolarHBondContact O-N 2.79Å; K47-A51 PolarHBondContact O-N 3.12Å
48	A	97	Very high	96.1	Very high	22 Å²	22	74 Å²	74	18%	0.182	40%	0.399	C	S	.	.	H	α-helix	trans	-71.5	-37.8	175.2	0	0	0	0	0	112.3	L35 Y39 T44 L45 L46 A51 A52	L35-A48 HydrophobicContact CD1-CB 3.98Å; Y39-A48 HydrophobicContact CD1-CB 4.43Å; Y39-A48 HydrophobicContact CE1-CB 3.42Å; Y39-A48 VanDerWaalsContact CE1-CB 3.42Å; Y39-A48 WeakPolarHBondContact OH-CB 3.22Å; T44-A48 PolarHBondContact O-N 2.81Å; L45-A48 PolarHBondContact O-N 2.82Å; L45-A48 VanDerWaalsContact O-N 3.12Å; L46-A48 VanDerWaalsContact C-N 3.32Å; L46-A48 PolarHBondContact O-N 3.27Å; A48-A51 PolarHBondContact O-N 3.29Å; A48-A52 PolarHBondContact O-N 2.92Å
49	A	96.6	Very high	96.1	Very high	0 Å²	0	74.1 Å²	74.1	0%	0	39%	0.393	C	S	.	.	H	α-helix	trans	-62.9	-43.4	174.8	0	0	0	0	0	111.6	V18 V33 L35 L45 L46 A51 A52 V53 I63	V18-A49 HydrophobicContact CG1-CB 4.46Å; V18-A49 HydrophobicContact CG2-CB 3.87Å; V33-A49 HydrophobicContact CG2-CB 4.43Å; L35-A49 HydrophobicContact CD1-CB 4.23Å; L45-A49 WeakPolarHBondContact O-CB 3.47Å; L45-A49 PolarHBondContact O-N 3.36Å; L46-A49 PolarHBondContact O-N 2.82Å; A49-A51 VanDerWaalsContact C-N 3.35Å; A49-A51 PolarHBondContact O-N 2.77Å; A49-A52 CarbonylContact O-C 3.53Å; A49-A52 WeakPolarHBondContact O-CA 3.08Å; A49-A52 PolarHBondContact O-N 2.95Å; A49-V53 WeakPolarHBondContact O-CB 3.27Å; A49-V53 WeakPolarHBondContact O-CG2 3.37Å; A49-V53 PolarHBondContact O-N 2.8Å; A49-I63 HydrophobicContact CB-CD1 4.27Å
50	K	96.9	Very high	96.2	Very high	86 Å²	86	71 Å²	71	37%	0.374	38%	0.382	S	S	.	.	H	α-helix	trans	-55.7	-47.8	173.1	-79.8	178.7	172.7	-173.9	0	111.8	L46 A52 V53 D54 A60	L46-K50 HydrophobicContact CG-CD 4.44Å; L46-K50 WeakPolarHBondContact O-CB 3.44Å; L46-K50 WeakPolarHBondContact O-CG 3.19Å; L46-K50 PolarHBondContact O-N 3.49Å; K50-A52 PolarHBondContact O-N 3.23Å; K50-A52 VanDerWaalsContact O-N 3.14Å; K50-V53 PolarHBondContact O-N 3.46Å; K50-D54 WeakPolarHBondContact CB-OD2 3.47Å; K50-D54 WeakPolarHBondContact CG-OD2 3.39Å; K50-D54 WeakPolarHBondContact O-CB 3.31Å; K50-D54 PolarHBondContact O-N 3.11Å; K50-A60 WeakPolarHBondContact CE-O 3.43Å; K50-A60 HydrophobicContact CG-CB 3.82Å
51	A	96.5	Very high	96.3	Very high	94 Å²	94	64.9 Å²	64.9	78%	0.777	36%	0.361	S	S	*	.	H	α-helix	trans	-61.6	-22.8	177	0	0	0	0	0	113.7	K47 A48 A49	K47-A51 PolarHBondContact O-N 3.12Å; A48-A51 PolarHBondContact O-N 3.29Å; A49-A51 VanDerWaalsContact C-N 3.35Å; A49-A51 PolarHBondContact O-N 2.77Å
52	A	94.8	Very high	96.3	Very high	65 Å²	65	63.4 Å²	63.4	54%	0.537	36%	0.357	S	S	.	.	H	α-helix	trans	-96.3	-27.1	179.5	0	0	0	0	0	114	L35 A48 A49 K50	L35-A52 HydrophobicContact CD2-CB 3.89Å; A48-A52 PolarHBondContact O-N 2.92Å; A49-A52 CarbonylContact O-C 3.53Å; A49-A52 WeakPolarHBondContact O-CA 3.08Å; A49-A52 PolarHBondContact O-N 2.95Å; K50-A52 PolarHBondContact O-N 3.23Å; K50-A52 VanDerWaalsContact O-N 3.14Å
53	V	95.3	Very high	96.5	Very high	12 Å²	12	60.4 Å²	60.4	7%	0.073	34%	0.341	C	S	.	.	H	α-helix	trans	-115.4	-29.7	-168.5	-177.8	0	0	0	0	113.4	K31 V33 A49 K50 T55 L58	K31-V53 HydrophobicContact CD-CG1 4.04Å; V33-V53 HydrophobicContact CG1-CG2 3.28Å; A49-V53 WeakPolarHBondContact O-CB 3.27Å; A49-V53 WeakPolarHBondContact O-CG2 3.37Å; A49-V53 PolarHBondContact O-N 2.8Å; K50-V53 PolarHBondContact O-N 3.46Å; V53-T55 PolarHBondContact O-N 3.31Å; V53-L58 HydrophobicContact CG1-CD2 3.76Å
54	D	96	Very high	96.5	Very high	61 Å²	61	57.3 Å²	57.3	33%	0.326	34%	0.336	S	S	.	.			trans	-65.3	124.2	-174	-74.4	-1.3	0	0	0	110.2	K50 L58 K59 A60	K50-D54 WeakPolarHBondContact CB-OD2 3.47Å; K50-D54 WeakPolarHBondContact CG-OD2 3.39Å; K50-D54 WeakPolarHBondContact O-CB 3.31Å; K50-D54 PolarHBondContact O-N 3.11Å; D54-L58 WeakPolarHBondContact CA-O 3.44Å; D54-K59 HydrophobicContact CB-CD 4.44Å; D54-A60 WeakPolarHBondContact OD1-CB 3.2Å; D54-A60 PolarHBondContact OD1-N 2.73Å
55	T	96.1	Very high	96.4	Very high	69 Å²	69	60.3 Å²	60.3	42%	0.423	34%	0.344	S	S	.	.			trans	-120	-176.3	167.8	65.8	0	0	0	0	108.5	V53 T57 L58 K59	V53-T55 PolarHBondContact O-N 3.31Å; T55-T57 PolarHBondContact O-N 3.42Å; T55-T57 PolarHBondContact OG1-N 3.1Å; T55-T57 PolarHBondContact OG1-OG1 2.85Å; T55-L58 PolarHBondContact N-O 3.33Å; T55-L58 VanDerWaalsContact O-O 3.13Å; T55-L58 WeakPolarHBondContact OG1-CB 3.45Å; T55-L58 PolarHBondContact OG1-N 3.09Å; T55-K59 WeakPolarHBondContact O-CE 3.29Å; T55-K59 PolarHBondContact O-NZ 2.91Å
56	D	95	Very high	96.4	Very high	151 Å²	151	62.5 Å²	62.5	81%	0.807	36%	0.36	S	S	*	.	S	Bend	trans	-64.9	-31	175.1	-65.6	-31	0	0	0	112.1
57	T	95.3	Very high	96.4	Very high	48 Å²	48	65.2 Å²	65.2	29%	0.294	37%	0.368	S	S	.	.	S	Bend	trans	-101.4	-17.9	-175.7	59.2	0	0	0	0	113.5	D22 I23 E24 T55	D22-T57 CarbonylContact C-O 3.6Å; I23-T57 PolarHBondContact N-O 2.83Å; E24-T57 VanDerWaalsContact CD-CG2 3.48Å; E24-T57 HydrophobicContact CG-CG2 3.67Å; E24-T57 WeakPolarHBondContact OE1-CG2 2.99Å; T55-T57 PolarHBondContact O-N 3.42Å; T55-T57 PolarHBondContact OG1-N 3.1Å; T55-T57 PolarHBondContact OG1-OG1 2.85Å
58	L	96.1	Very high	96.4	Very high	8 Å²	8	61.1 Å²	61.1	4%	0.042	36%	0.357	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.3	126.8	-175.9	-168.2	75.7	0	0	0	110.7	C20 D22 C29 K31 V53 D54 T55	C20-L58 HydrophobicContact CB-CD1 3.81Å; C20-L58 HydrophobicContact CB-CD2 4.42Å; C20-L58 HydrophobicContact CB-CG 4.02Å; D22-L58 HydrophobicContact CB-CD1 4.25Å; C29-L58 VanDerWaalsContact SG-CD1 3.59Å; K31-L58 HydrophobicContact CD-CD2 3.7Å; V53-L58 HydrophobicContact CG1-CD2 3.76Å; D54-L58 WeakPolarHBondContact CA-O 3.44Å; T55-L58 PolarHBondContact N-O 3.33Å; T55-L58 VanDerWaalsContact O-O 3.13Å; T55-L58 WeakPolarHBondContact OG1-CB 3.45Å; T55-L58 PolarHBondContact OG1-N 3.09Å
59	K	97	Very high	96.4	Very high	80 Å²	80	62.8 Å²	62.8	35%	0.348	36%	0.361	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.6	128.6	178.3	-60.7	-61.3	-178.1	-162.8	0	111.6	C20 L21 I23 D54 T55	C20-K59 CarbonylContact C-O 3.45Å; C20-K59 WeakPolarHBondContact CA-O 3.43Å; L21-K59 PolarHBondContact N-O 3.03Å; L21-K59 PolarHBondContact O-N 2.96Å; I23-K59 HydrophobicContact CD1-CG 3.64Å; I23-K59 HydrophobicContact CG1-CG 4.42Å; D54-K59 HydrophobicContact CB-CD 4.44Å; T55-K59 WeakPolarHBondContact O-CE 3.29Å; T55-K59 PolarHBondContact O-NZ 2.91Å
60	A	97.5	Very high	96.5	Very high	4 Å²	4	69 Å²	69	3%	0.033	39%	0.389	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.9	127	170.9	0	0	0	0	0	110.8	V18 L46 K50 D54	V18-A60 HydrophobicContact CG1-CB 3.55Å; L46-A60 HydrophobicContact CD1-CB 4.23Å; K50-A60 WeakPolarHBondContact CE-O 3.43Å; K50-A60 HydrophobicContact CG-CB 3.82Å; D54-A60 WeakPolarHBondContact OD1-CB 3.2Å; D54-A60 PolarHBondContact OD1-N 2.73Å
61	V	96	Very high	96.4	Very high	81 Å²	81	68.5 Å²	68.5	49%	0.491	39%	0.387	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105	-49.9	-174.1	-177.6	0	0	0	0	111	L19 L21 L46	L19-V61 PolarHBondContact O-N 2.75Å; L21-V61 HydrophobicContact CB-CG2 4Å; L46-V61 WeakPolarHBondContact CD2-O 3.41Å
62	S	96.6	Very high	96.5	Very high	45 Å²	45	70.1 Å²	70.1	32%	0.315	38%	0.382	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-154.2	164	-177	65.2	0	0	0	0	112.6	L19	L19-S62 PolarHBondContact N-O 2.83Å; L19-S62 PolarHBondContact O-N 3.02Å
63	I	97.7	Very high	96.5	Very high	25 Å²	25	71.1 Å²	71.1	13%	0.128	38%	0.378	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-91.4	121.8	170.6	-55.4	-57.1	0	0	0	108	A16 V18 D42 L45 L46 A49	A16-I63 HydrophobicContact CB-CD1 4.36Å; V18-I63 HydrophobicContact CG1-CD1 4.41Å; V18-I63 HydrophobicContact CG2-CD1 3.93Å; D42-I63 HydrophobicContact CB-CB 4.36Å; D42-I63 HydrophobicContact CB-CG1 4.35Å; L45-I63 HydrophobicContact CD2-CD1 4.31Å; L45-I63 HydrophobicContact CD2-CG1 4.15Å; L45-I63 HydrophobicContact CD2-CG2 4.04Å; L45-I63 HydrophobicContact CG-CD1 4.04Å; L45-I63 HydrophobicContact CG-CG1 4.16Å; L46-I63 HydrophobicContact CB-CD1 4.27Å; L46-I63 HydrophobicContact CB-CG1 4.09Å; L46-I63 HydrophobicContact CD1-CD1 4.03Å; L46-I63 HydrophobicContact CD1-CG1 4.38Å; A49-I63 HydrophobicContact CB-CD1 4.27Å
64	S	96	Very high	96.6	Very high	90 Å²	90	72.8 Å²	72.8	63%	0.629	40%	0.398	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-85.2	-39.6	175.1	171.9	0	0	0	0	111.6	C17	C17-S64 PolarHBondContact O-N 3.41Å
65	K	96.8	Very high	96.6	Very high	125 Å²	125	73.3 Å²	73.3	54%	0.543	40%	0.399	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-153.2	143.2	-180	-176.7	-179.9	177.7	-176.5	0	109.2	A16 C17 W67	A16-K65 CarbonylContact C-O 3.52Å; A16-K65 VanDerWaalsContact CA-O 3.31Å; A16-K65 WeakPolarHBondContact CA-O 3.48Å; C17-K65 HydrophobicContact CB-CB 4.1Å; C17-K65 PolarHBondContact N-O 2.85Å; C17-K65 PolarHBondContact O-N 3.36Å; K65-W67 HydrophobicContact CD-CE3 4.31Å; K65-W67 HydrophobicContact CD-CZ3 4.22Å; K65-W67 HydrophobicContact CG-CE3 4.2Å; K65-W67 HydrophobicContact CG-CZ3 4.35Å
66	S	97.2	Very high	96.7	Very high	49 Å²	49	72.4 Å²	72.4	34%	0.343	40%	0.395	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-140	150	170.3	66.4	0	0	0	0	111.1	Q15 L45	Q15-S66 CarbonylContact O-C 3.54Å; Q15-S66 WeakPolarHBondContact O-CA 3.15Å; L45-S66 VanDerWaalsContact CD2-CB 3.42Å
67	W	97.4	Very high	96.7	Very high	89 Å²	89	69.1 Å²	69.1	34%	0.337	38%	0.375	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-150.9	159.1	170.8	69	97.6	0	0	0	110.7	T14 Q15 K65	T14-W67 CarbonylContact C-O 3.56Å; T14-W67 WeakPolarHBondContact CA-O 3.36Å; Q15-W67 HydrophobicContact CB-CD2 3.59Å; Q15-W67 HydrophobicContact CB-CE3 3.89Å; Q15-W67 HydrophobicContact CB-CG 4.24Å; Q15-W67 HydrophobicContact CB-CH2 3.65Å; Q15-W67 HydrophobicContact CB-CZ2 3.32Å; Q15-W67 HydrophobicContact CB-CZ3 3.92Å; Q15-W67 HydrophobicContact CG-CD2 4.31Å; Q15-W67 HydrophobicContact CG-CH2 4.35Å; Q15-W67 HydrophobicContact CG-CZ2 3.59Å; Q15-W67 PolarHBondContact N-O 2.77Å; Q15-W67 PolarHBondContact O-N 3.42Å; K65-W67 HydrophobicContact CD-CE3 4.31Å; K65-W67 HydrophobicContact CD-CZ3 4.22Å; K65-W67 HydrophobicContact CG-CE3 4.2Å; K65-W67 HydrophobicContact CG-CZ3 4.35Å
68	V	97.6	Very high	96.8	Very high	80 Å²	80	72.5 Å²	72.5	49%	0.485	39%	0.391	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.2	134.1	177.2	177.1	0	0	0	0	109	K12 V13 T38	K12-V68 HydrophobicContact CB-CG1 4.24Å; K12-V68 HydrophobicContact CG-CG1 4.47Å; V13-V68 WeakPolarHBondContact O-CA 3.2Å; T38-V68 HydrophobicContact CG2-CB 4.45Å; T38-V68 HydrophobicContact CG2-CG1 3.64Å; T38-V68 HydrophobicContact CG2-CG2 3.88Å
69	E	97.1	Very high	96.8	Very high	57 Å²	57	77 Å²	77	27%	0.266	41%	0.41	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.9	151.9	173.3	64.2	-175.8	-169.7	0	0	110.6	K12 V13 Q15 K71	K12-E69 WeakPolarHBondContact CA-O 3.34Å; V13-E69 HydrophobicContact CG2-CG 3.53Å; V13-E69 PolarHBondContact N-O 3.46Å; V13-E69 PolarHBondContact O-N 3.35Å; Q15-E69 HydrophobicContact CG-CG 4.31Å; Q15-E69 PolarHBondContact NE2-OE1 2.96Å; E69-K71 HydrophobicContact CG-CG 4.36Å; E69-K71 WeakPolarHBondContact OE1-CD 3.43Å; E69-K71 WeakPolarHBondContact OE1-CE 3.46Å; E69-K71 IonicContact OE1-NZ 2.69Å; E69-K71 PolarHBondContact OE1-NZ 2.84Å
70	E	97.2	Very high	96.9	Very high	129 Å²	129	77.6 Å²	77.6	60%	0.603	41%	0.413	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-90.9	127	169.6	-74.5	-174.5	-177.4	0	0	109.4	T10 K12	T10-E70 HydrophobicContact CG2-CB 4.22Å; K12-E70 WeakPolarHBondContact CE-OE1 2.89Å; K12-E70 HydrophobicContact CG-CG 3.67Å; K12-E70 IonicContact NZ-OE1 3.72Å
71	K	96.2	Very high	96.8	Very high	77 Å²	77	83.2 Å²	83.2	34%	0.335	44%	0.441	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.6	128.2	175.9	-82.5	-176	159.1	153	0	110.5	T10 I11 V13 Q15 E69 L73	T10-K71 WeakPolarHBondContact CA-O 3.32Å; I11-K71 PolarHBondContact N-O 2.96Å; I11-K71 PolarHBondContact O-N 3.3Å; V13-K71 HydrophobicContact CG2-CD 3.95Å; V13-K71 HydrophobicContact CG2-CG 4.26Å; Q15-K71 VanDerWaalsContact NE2-NZ 3.12Å; E69-K71 HydrophobicContact CG-CG 4.36Å; E69-K71 WeakPolarHBondContact OE1-CD 3.43Å; E69-K71 WeakPolarHBondContact OE1-CE 3.46Å; E69-K71 IonicContact OE1-NZ 2.69Å; E69-K71 PolarHBondContact OE1-NZ 2.84Å; K71-L73 HydrophobicContact CB-CD2 4.29Å; K71-L73 HydrophobicContact CB-CG 4.32Å; K71-L73 PolarHBondContact O-N 3.45Å
72	L	97.4	Very high	96.9	Very high	127 Å²	127	83 Å²	83	67%	0.665	45%	0.448	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-81	110.8	166.1	177.3	61.5	0	0	0	108.2
73	L	96	Very high	96.9	Very high	86 Å²	86	86.9 Å²	86.9	45%	0.45	46%	0.461	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.6	148.6	177.9	-60.3	177	0	0	0	109.6	T8 R9 K71	T8-L73 CarbonylContact C-O 3.6Å; T8-L73 VanDerWaalsContact CA-O 3.26Å; T8-L73 WeakPolarHBondContact CA-O 3.4Å; R9-L73 PolarHBondContact N-O 3.19Å; R9-L73 PolarHBondContact O-N 2.8Å; K71-L73 HydrophobicContact CB-CD2 4.29Å; K71-L73 HydrophobicContact CB-CG 4.32Å; K71-L73 PolarHBondContact O-N 3.45Å
74	G	96.1	Very high	96.8	Very high	48 Å²	48	87.8 Å²	87.8	50%	0.495	47%	0.472	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-151.2	156.7	174.7	0	0	0	0	0	113.3	V7	V7-G74 CarbonylContact O-C 3.52Å; V7-G74 WeakPolarHBondContact O-CA 3.34Å
75	M	96.7	Very high	96.8	Very high	71 Å²	71	89.4 Å²	89.4	35%	0.35	48%	0.478	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-147	156.1	175.7	58.6	-179.7	48	0	0	110.3	V7 F79 F80	V7-M75 PolarHBondContact N-O 3.27Å; V7-M75 PolarHBondContact O-N 2.68Å; M75-F79 HydrophobicContact CB-CD1 4.28Å; M75-F79 HydrophobicContact CE-CD1 3.94Å; M75-F79 HydrophobicContact CE-CE1 3.87Å; M75-F79 HydrophobicContact CG-CD1 4.44Å; M75-F79 HydrophobicContact SD-CD1 3.64Å; M75-F79 HydrophobicContact SD-CE1 4.13Å; M75-F80 HydrophobicContact CG-CB 4.26Å; M75-F80 HydrophobicContact SD-CB 3.99Å; M75-F80 HydrophobicContact SD-CD2 4.08Å
76	P	97.3	Very high	96.6	Very high	51 Å²	51	91.2 Å²	91.2	33%	0.331	49%	0.494	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-58.4	144.7	173.7	-23.2	34.2	0	0	0	111.8	M6 D78 F79 F80	M6-P76 HydrophobicContact SD-CB 4.44Å; M6-P76 HydrophobicContact SD-CG 4.22Å; P76-D78 VanDerWaalsContact C-N 3.29Å; P76-D78 PolarHBondContact O-N 2.9Å; P76-F79 HydrophobicContact CB-CB 4.44Å; P76-F79 PolarHBondContact O-N 3.3Å; P76-F79 VanDerWaalsContact O-N 3.11Å; P76-F80 PolarHBondContact O-N 3.25Å
77	E	96.6	Very high	96.3	Very high	82 Å²	82	96.1 Å²	96.1	38%	0.383	52%	0.515	S	S	.	.	H	α-helix	trans	-57.1	-40.3	177.8	-82.1	-179.3	179.5	0	0	112.7	P5 V7 F79 F80 I81	P5-E77 HydrophobicContact CB-CG 4.2Å; P5-E77 WeakPolarHBondContact CB-OE2 3.17Å; P5-E77 HydrophobicContact CG-CB 4.32Å; P5-E77 HydrophobicContact CG-CG 4.4Å; P5-E77 WeakPolarHBondContact CG-OE2 3.18Å; P5-E77 PolarHBondContact O-N 2.93Å; V7-E77 HydrophobicContact CG2-CB 4.49Å; V7-E77 HydrophobicContact CG2-CG 3.62Å; E77-F79 VanDerWaalsContact C-N 3.27Å; E77-F79 PolarHBondContact O-N 3.16Å; E77-F80 WeakPolarHBondContact O-CB 3.4Å; E77-F80 PolarHBondContact O-N 3.31Å; E77-F80 VanDerWaalsContact O-N 3.09Å; E77-I81 VanDerWaalsContact O-CG1 3.29Å; E77-I81 WeakPolarHBondContact O-CG1 3.26Å; E77-I81 PolarHBondContact O-N 2.87Å
78	D	96.4	Very high	96	Very high	119 Å²	119	98.1 Å²	98.1	64%	0.636	54%	0.536	S	S	*	.	H	α-helix	trans	-59.1	-40.5	177.8	-57.1	-25.7	0	0	0	112	P76 A82	P76-D78 VanDerWaalsContact C-N 3.29Å; P76-D78 PolarHBondContact O-N 2.9Å; D78-A82 WeakPolarHBondContact O-CB 3.38Å; D78-A82 PolarHBondContact O-N 2.95Å; D78-A82 VanDerWaalsContact O-N 3.1Å
79	F	97.1	Very high	95.3	Very high	101 Å²	101	105.1 Å²	105.1	44%	0.443	55%	0.554	S	S	.	*	H	α-helix	trans	-69.2	-39.9	177.2	-174.8	-86.3	0	0	0	110.9	M75 P76 E77 A82 H83	M75-F79 HydrophobicContact CB-CD1 4.28Å; M75-F79 HydrophobicContact CE-CD1 3.94Å; M75-F79 HydrophobicContact CE-CE1 3.87Å; M75-F79 HydrophobicContact CG-CD1 4.44Å; M75-F79 HydrophobicContact SD-CD1 3.64Å; M75-F79 HydrophobicContact SD-CE1 4.13Å; P76-F79 HydrophobicContact CB-CB 4.44Å; P76-F79 PolarHBondContact O-N 3.3Å; P76-F79 VanDerWaalsContact O-N 3.11Å; E77-F79 VanDerWaalsContact C-N 3.27Å; E77-F79 PolarHBondContact O-N 3.16Å; F79-A82 PolarHBondContact O-N 2.69Å; F79-H83 AromaticContact CD1-ND1 3.81Å; F79-H83 AromaticContact CD2-CE1 3.53Å; F79-H83 AromaticContact CD2-ND1 3.82Å; F79-H83 AromaticContact CE1-CE1 3.99Å; F79-H83 AromaticContact CE1-ND1 3.69Å; F79-H83 AromaticContact CE2-CE1 3.19Å; F79-H83 WeakPolarHBondContact CE2-CE1 3.26Å; F79-H83 AromaticContact CE2-ND1 3.7Å; F79-H83 AromaticContact CE2-NE2 3.82Å; F79-H83 AromaticContact CG-ND1 3.88Å; F79-H83 AromaticContact CZ-CE1 3.44Å; F79-H83 VanDerWaalsContact CZ-CE1 3.44Å; F79-H83 WeakPolarHBondContact CZ-CE1 3.38Å; F79-H83 AromaticContact CZ-ND1 3.63Å; F79-H83 AromaticContact CZ-NE2 3.82Å; F79-H83 PolarHBondContact O-N 3.05Å; F79-H83 PolarHBondContact O-ND1 3.18Å
80	F	97.1	Very high	94.4	Very high	93 Å²	93	113.7 Å²	113.7	41%	0.408	58%	0.584	S	S	.	*	H	α-helix	trans	-61.1	-49.2	175.6	178.7	-97.4	0	0	0	111.2	V7 M75 P76 E77 A82 H83 A84	V7-F80 HydrophobicContact CB-CB 4.44Å; V7-F80 HydrophobicContact CB-CD2 4.48Å; V7-F80 HydrophobicContact CB-CG 4.38Å; V7-F80 HydrophobicContact CG1-CD2 4.17Å; V7-F80 HydrophobicContact CG1-CE2 4.38Å; V7-F80 HydrophobicContact CG1-CG 4.43Å; V7-F80 HydrophobicContact CG2-CB 3.88Å; V7-F80 HydrophobicContact CG2-CD1 4.07Å; V7-F80 HydrophobicContact CG2-CD2 4.4Å; V7-F80 HydrophobicContact CG2-CG 3.85Å; M75-F80 HydrophobicContact CG-CB 4.26Å; M75-F80 HydrophobicContact SD-CB 3.99Å; M75-F80 HydrophobicContact SD-CD2 4.08Å; P76-F80 PolarHBondContact O-N 3.25Å; E77-F80 WeakPolarHBondContact O-CB 3.4Å; E77-F80 PolarHBondContact O-N 3.31Å; E77-F80 VanDerWaalsContact O-N 3.09Å; F80-A82 VanDerWaalsContact C-N 3.28Å; F80-A82 PolarHBondContact O-N 2.77Å; F80-H83 PolarHBondContact O-N 2.92Å; F80-A84 HydrophobicContact CD1-CB 4.25Å; F80-A84 HydrophobicContact CD2-CB 4.39Å; F80-A84 HydrophobicContact CE1-CB 3.95Å; F80-A84 HydrophobicContact CE2-CB 4.1Å; F80-A84 HydrophobicContact CG-CB 4.47Å; F80-A84 HydrophobicContact CZ-CB 3.88Å; F80-A84 WeakPolarHBondContact O-CB 3.09Å; F80-A84 PolarHBondContact O-N 3.32Å
81	I	96.6	Very high	93.1	Very high	122 Å²	122	116.7 Å²	116.7	63%	0.626	60%	0.595	S	S	*	*	H	α-helix	trans	-60.1	-39	-179.9	-67.3	164.5	0	0	0	111.1	E77 H83	E77-I81 VanDerWaalsContact O-CG1 3.29Å; E77-I81 WeakPolarHBondContact O-CG1 3.26Å; E77-I81 PolarHBondContact O-N 2.87Å; I81-H83 VanDerWaalsContact C-N 3.35Å; I81-H83 PolarHBondContact O-N 3.17Å
82	A	97.5	Very high	91.8	Very high	76 Å²	76	118.9 Å²	118.9	63%	0.628	62%	0.617	S	S	*	*	H	α-helix	trans	-69.7	-25.9	-179.5	0	0	0	0	0	114.6	D78 F79 F80	D78-A82 WeakPolarHBondContact O-CB 3.38Å; D78-A82 PolarHBondContact O-N 2.95Å; D78-A82 VanDerWaalsContact O-N 3.1Å; F79-A82 PolarHBondContact O-N 2.69Å; F80-A82 VanDerWaalsContact C-N 3.28Å; F80-A82 PolarHBondContact O-N 2.77Å
83	H	97.5	Very high	90.2	Very high	128 Å²	128	120.5 Å²	120.5	59%	0.593	63%	0.626	S	S	*	*	H	α-helix	trans	-114.8	-13.4	-173.6	-61.4	83.7	0	0	0	113.9	F79 F80 I81	F79-H83 AromaticContact CD1-ND1 3.81Å; F79-H83 AromaticContact CD2-CE1 3.53Å; F79-H83 AromaticContact CD2-ND1 3.82Å; F79-H83 AromaticContact CE1-CE1 3.99Å; F79-H83 AromaticContact CE1-ND1 3.69Å; F79-H83 AromaticContact CE2-CE1 3.19Å; F79-H83 WeakPolarHBondContact CE2-CE1 3.26Å; F79-H83 AromaticContact CE2-ND1 3.7Å; F79-H83 AromaticContact CE2-NE2 3.82Å; F79-H83 AromaticContact CG-ND1 3.88Å; F79-H83 AromaticContact CZ-CE1 3.44Å; F79-H83 VanDerWaalsContact CZ-CE1 3.44Å; F79-H83 WeakPolarHBondContact CZ-CE1 3.38Å; F79-H83 AromaticContact CZ-ND1 3.63Å; F79-H83 AromaticContact CZ-NE2 3.82Å; F79-H83 PolarHBondContact O-N 3.05Å; F79-H83 PolarHBondContact O-ND1 3.18Å; F80-H83 PolarHBondContact O-N 2.92Å; I81-H83 VanDerWaalsContact C-N 3.35Å; I81-H83 PolarHBondContact O-N 3.17Å
84	A	96.1	Very high	88.5	Confident	44 Å²	44	120.8 Å²	120.8	36%	0.364	64%	0.641	S	S	.	*			trans	-80.1	158.2	179.3	0	0	0	0	0	111.9	F80	F80-A84 HydrophobicContact CD1-CB 4.25Å; F80-A84 HydrophobicContact CD2-CB 4.39Å; F80-A84 HydrophobicContact CE1-CB 3.95Å; F80-A84 HydrophobicContact CE2-CB 4.1Å; F80-A84 HydrophobicContact CG-CB 4.47Å; F80-A84 HydrophobicContact CZ-CB 3.88Å; F80-A84 WeakPolarHBondContact O-CB 3.09Å; F80-A84 PolarHBondContact O-N 3.32Å
85	T	95.6	Very high	86.6	Confident	124 Å²	124	127.5 Å²	127.5	76%	0.761	66%	0.66	S	S	*	*			trans	-114.3	140.6	170.8	55.9	0	0	0	0	109.8	I87	T85-I87 PolarHBondContact O-N 2.92Å
86	D	92.8	Very high	84.8	Confident	162 Å²	162	131.5 Å²	131.5	87%	0.866	68%	0.681	S	S	*	*			trans	-60	133.6	178.5	-74.7	-27.3	0	0	0	112.5
87	I	90.8	Very high	82.8	Confident	153 Å²	153	134.5 Å²	134.5	79%	0.785	70%	0.7	S	S	*	*			trans	-96.9	101.7	175.5	-57.9	177.5	0	0	0	108.6	T85 R89	T85-I87 PolarHBondContact O-N 2.92Å; I87-R89 PolarHBondContact O-N 3.04Å
88	V	89.7	Confident	81.2	Confident	131 Å²	131	140.4 Å²	140.4	79%	0.794	73%	0.725	S	S	*	*			trans	-77.6	108.9	169.8	-174.8	0	0	0	0	108.7	R90	V88-R90 PolarHBondContact O-N 3.26Å; V88-R90 VanDerWaalsContact O-N 3.16Å
89	R	83.1	Confident	79.5	Confident	226 Å²	226	143.2 Å²	143.2	85%	0.853	73%	0.734	S	S	*	*			trans	-66.4	115.2	171.6	-66	-173.3	-176.7	-162.9	2	108.3	I87 K91	I87-R89 PolarHBondContact O-N 3.04Å; R89-K91 PolarHBondContact O-N 3.09Å
90	R	78.7	Confident	77.9	Confident	238 Å²	238	143.8 Å²	143.8	90%	0.898	75%	0.748	S	S	*	*	P	Polyproline II helix	trans	-60.7	124.2	166.9	-65.4	-177.6	-177.1	174.5	0.2	107.1	V88	V88-R90 PolarHBondContact O-N 3.26Å; V88-R90 VanDerWaalsContact O-N 3.16Å
91	K	70.6	Confident	76.2	Confident	192 Å²	192	150.7 Å²	150.7	84%	0.835	77%	0.771	S	S	*	*	P	Polyproline II helix	trans	-57.7	133.5	165.6	-75.5	179.8	-179.7	172.8	0	106.5	R89 D93	R89-K91 PolarHBondContact O-N 3.09Å; K91-D93 PolarHBondContact O-N 3.45Å
92	P	68.9	Low	74.7	Confident	122 Å²	122	151.9 Å²	151.9	79%	0.792	78%	0.779	S	S	*	*	P	Polyproline II helix	trans	-58.3	131.8	171.3	22.5	-27.7	0	0	0	107.7	A94	P92-A94 PolarHBondContact O-N 3.37Å
93	D	63.7	Low	73.5	Confident	162 Å²	162	154.3 Å²	154.3	87%	0.866	79%	0.788	S	S	*	*	P	Polyproline II helix	trans	-50.5	125	178.7	-67	-43.9	0	0	0	108.4	K91 E95	K91-D93 PolarHBondContact O-N 3.45Å; D93-E95 PolarHBondContact O-N 3.41Å
94	A	58.7	Low	72	Confident	91 Å²	91	161 Å²	161	75%	0.752	82%	0.82	S	S	*	*	P	Polyproline II helix	trans	-53	126.4	178.3	0	0	0	0	0	108.7	P92 I96	P92-A94 PolarHBondContact O-N 3.37Å; A94-I96 PolarHBondContact O-N 3.22Å
95	E	56.6	Low	70.8	Confident	190 Å²	190	166.9 Å²	166.9	89%	0.888	84%	0.842	S	S	*	*			trans	-45.4	107	176.6	-116.4	174.3	160.3	0	0	109.7	D93 P97	D93-E95 PolarHBondContact O-N 3.41Å; E95-P97 VanDerWaalsContact O-CD 3.26Å; E95-P97 WeakPolarHBondContact O-CD 2.88Å
96	I	59.3	Low	69.5	Low	154 Å²	154	169.1 Å²	169.1	79%	0.79	85%	0.847	S	S	*	*			trans	-62.6	118.7	170.7	-60.7	170	0	0	0	105.6	A94 K98	A94-I96 PolarHBondContact O-N 3.22Å; I96-K98 PolarHBondContact O-N 2.85Å
97	P	56.3	Low	68.2	Low	114 Å²	114	169.5 Å²	169.5	74%	0.74	85%	0.846	S	S	*	*			trans	-57.2	118.1	-179.2	-23.3	33.1	0	0	0	109.5	E95 Q99	E95-P97 VanDerWaalsContact O-CD 3.26Å; E95-P97 WeakPolarHBondContact O-CD 2.88Å; P97-Q99 PolarHBondContact O-N 2.98Å; P97-Q99 VanDerWaalsContact O-N 3.09Å
98	K	61.5	Low	66.9	Low	207 Å²	207	170.5 Å²	170.5	90%	0.9	85%	0.849	S	S	*	*			trans	-63.3	112.7	171.2	-69.1	177.4	-178.2	170.7	0	107	I96	I96-K98 PolarHBondContact O-N 2.85Å
99	Q	62.3	Low	65.5	Low	177 Å²	177	172.9 Å²	172.9	83%	0.827	85%	0.853	S	S	*	*			trans	-58.2	137.9	172.5	-71.2	-173	-1.4	0	0	109	P97 R101	P97-Q99 PolarHBondContact O-N 2.98Å; P97-Q99 VanDerWaalsContact O-N 3.09Å; Q99-R101 PolarHBondContact O-N 2.93Å
100	P	63.6	Low	64.3	Low	114 Å²	114	169.4 Å²	169.4	74%	0.74	85%	0.853	S	S	*	*			trans	-56.2	128.3	176.3	-19.3	30.2	0	0	0	109.3	D102	P100-D102 PolarHBondContact O-N 3.49Å
101	R	59.4	Low	63.2	Low	238 Å²	238	164.5 Å²	164.5	90%	0.898	85%	0.849	S	S	*	*			trans	-78.6	115	164.3	-77.8	-176.8	-78	-176.7	-2.6	106.3	Q99	Q99-R101 PolarHBondContact O-N 2.93Å
102	D	66.6	Low	62.7	Low	146 Å²	146	162.4 Å²	162.4	78%	0.781	85%	0.85	S	S	*	*			trans	-56.9	132.5	172.9	-71.8	-44.3	0	0	0	109.6	P100 Q104	P100-D102 PolarHBondContact O-N 3.49Å; D102-Q104 PolarHBondContact O-N 2.93Å
103	P	72.3	Confident	62.2	Low	127 Å²	127	165.8 Å²	165.8	83%	0.825	86%	0.855	S	S	*	*			trans	-66	126.7	172.3	-14.6	28.2	0	0	0	109.9
104	Q	65.7	Low	62	Low	269 Å²	269	166.1 Å²	166.1	100%	1.257	85%	0.854	S	S	*	*			trans	-71	0	161.9	-76	-174.3	-67	0	0	111	D102	D102-Q104 PolarHBondContact O-N 2.93Å

Retrieved 104 of 104 residues in 113.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).