A0A077ZM89_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZM89, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 129 aa.

						>A0A077ZM89_TRITR|A0A077ZM89
MVPDEEAALNFLRKKGLLHTDSLCPSCGQAMRLGRGGKAWRCHKRSCDKELCVRTGTWFDDKAAEGAADNIQLESRVHDDQILRARAGAQQGYRSAVEQVPAASCMVNKPAPYLLIGQAGLLFSQRPTS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	46.9	Very low	70.7	Confident	236 Å²	236	106.5 Å²	106.5	100%	1.163	57%	0.569	S	S	*	*				0	118.6	0	-166	163.1	164.8	0	0	106	P3	M1-P3 VanDerWaalsContact O-CD 3.29Å; M1-P3 WeakPolarHBondContact O-CD 3.49Å
2	V	53.7	Low	71.2	Confident	94 Å²	94	102.5 Å²	102.5	57%	0.57	55%	0.547	S	S	*	.			trans	-76.7	113.7	179.7	-177.8	0	0	0	0	106.6	A7 A8	V2-A7 HydrophobicContact CG1-CB 3.9Å; V2-A8 HydrophobicContact CG1-CB 3.89Å
3	P	71.6	Confident	71.4	Confident	114 Å²	114	100.5 Å²	100.5	74%	0.74	53%	0.527	S	S	*	.			trans	-74.9	-32.4	-168.9	27.5	-32.2	0	0	0	112.6	M1	M1-P3 VanDerWaalsContact O-CD 3.29Å; M1-P3 WeakPolarHBondContact O-CD 3.49Å
4	D	81.1	Confident	71.5	Confident	100 Å²	100	105.1 Å²	105.1	54%	0.535	54%	0.541	S	S	.	.			trans	-110.8	129.7	-173.1	-60.9	-66.2	0	0	0	110.9	E6 A7 A8	D4-E6 PolarHBondContact O-N 2.75Å; D4-A7 HydrophobicContact CB-CB 4.03Å; D4-A7 PolarHBondContact O-N 2.8Å; D4-A8 PolarHBondContact O-N 3.08Å
5	E	76.7	Confident	71.8	Confident	145 Å²	145	107.2 Å²	107.2	68%	0.678	54%	0.544	S	S	*	.	H	α-helix	trans	-54	-40.4	171.2	-173.1	179.3	172.8	0	0	110.2	A7 A8 L9	E5-A7 VanDerWaalsContact C-N 3.35Å; E5-A7 PolarHBondContact O-N 3Å; E5-A8 PolarHBondContact O-N 3.35Å; E5-L9 HydrophobicContact CG-CD1 4.11Å; E5-L9 HydrophobicContact CG-CG 4.3Å; E5-L9 WeakPolarHBondContact O-CB 3.14Å; E5-L9 WeakPolarHBondContact O-CG 3.43Å; E5-L9 PolarHBondContact O-N 2.86Å
6	E	70.8	Confident	71.1	Confident	161 Å²	161	104.5 Å²	104.5	75%	0.752	55%	0.551	S	S	*	*	H	α-helix	trans	-61.3	-38.5	176.7	-64.6	-167.4	159.7	0	0	113.4	D4 L9 N10	D4-E6 PolarHBondContact O-N 2.75Å; E6-L9 PolarHBondContact O-N 3.08Å; E6-N10 WeakPolarHBondContact O-CB 3.31Å; E6-N10 PolarHBondContact O-N 3.46Å
7	A	76.7	Confident	71	Confident	43 Å²	43	105.2 Å²	105.2	36%	0.355	56%	0.555	S	S	.	*	H	α-helix	trans	-69.6	-39.2	176.8	0	0	0	0	0	111.4	V2 D4 E5 N10 F11	V2-A7 HydrophobicContact CG1-CB 3.9Å; D4-A7 HydrophobicContact CB-CB 4.03Å; D4-A7 PolarHBondContact O-N 2.8Å; E5-A7 VanDerWaalsContact C-N 3.35Å; E5-A7 PolarHBondContact O-N 3Å; A7-N10 PolarHBondContact O-N 3.48Å; A7-F11 WeakPolarHBondContact O-CB 2.9Å; A7-F11 PolarHBondContact O-N 2.71Å
8	A	78.1	Confident	70.6	Confident	33 Å²	33	100.4 Å²	100.4	27%	0.273	53%	0.529	S	S	.	.	H	α-helix	trans	-64.3	-44.3	173.8	0	0	0	0	0	111.1	V2 D4 E5 N10 F11 L12	V2-A8 HydrophobicContact CG1-CB 3.89Å; D4-A8 PolarHBondContact O-N 3.08Å; E5-A8 PolarHBondContact O-N 3.35Å; A8-N10 PolarHBondContact O-N 3Å; A8-F11 PolarHBondContact O-N 2.74Å; A8-L12 WeakPolarHBondContact O-CB 3.11Å; A8-L12 VanDerWaalsContact O-CG 3.23Å; A8-L12 WeakPolarHBondContact O-CG 3.43Å; A8-L12 PolarHBondContact O-N 3.34Å
9	L	72.9	Confident	69.9	Low	45 Å²	45	102.1 Å²	102.1	24%	0.236	53%	0.534	C	S	.	.	H	α-helix	trans	-59.9	-45.9	175.1	-69.8	173	0	0	0	110.8	E5 E6 L12 R13 L18	E5-L9 HydrophobicContact CG-CD1 4.11Å; E5-L9 HydrophobicContact CG-CG 4.3Å; E5-L9 WeakPolarHBondContact O-CB 3.14Å; E5-L9 WeakPolarHBondContact O-CG 3.43Å; E5-L9 PolarHBondContact O-N 2.86Å; E6-L9 PolarHBondContact O-N 3.08Å; L9-L12 PolarHBondContact O-N 3.16Å; L9-R13 WeakPolarHBondContact O-CB 3.43Å; L9-R13 WeakPolarHBondContact O-CG 3.29Å; L9-R13 PolarHBondContact O-N 3.44Å; L9-L18 HydrophobicContact CD2-CD1 3.42Å; L9-L18 VanDerWaalsContact CD2-CD1 3.42Å
10	N	73.6	Confident	69.3	Low	81 Å²	81	101.1 Å²	101.1	43%	0.433	53%	0.532	S	S	.	.	H	α-helix	trans	-62.4	-43.7	176.3	-172.1	-3.7	0	0	0	111.9	E6 A7 A8 L12 R13 K14	E6-N10 WeakPolarHBondContact O-CB 3.31Å; E6-N10 PolarHBondContact O-N 3.46Å; A7-N10 PolarHBondContact O-N 3.48Å; A8-N10 PolarHBondContact O-N 3Å; N10-L12 PolarHBondContact O-N 3.38Å; N10-R13 WeakPolarHBondContact O-CB 3.36Å; N10-R13 PolarHBondContact O-N 3.39Å; N10-K14 WeakPolarHBondContact O-CG 3.46Å; N10-K14 PolarHBondContact O-N 3.27Å; N10-K14 WeakPolarHBondContact OD1-CE 3.38Å
11	F	74.9	Confident	68.8	Low	120 Å²	120	101.8 Å²	101.8	53%	0.526	54%	0.537	S	S	.	.	H	α-helix	trans	-59.3	-46.8	175.3	178.1	-96.2	0	0	0	111.8	A7 A8 K14 K15	A7-F11 WeakPolarHBondContact O-CB 2.9Å; A7-F11 PolarHBondContact O-N 2.71Å; A8-F11 PolarHBondContact O-N 2.74Å; F11-K14 PolarHBondContact O-N 3.49Å; F11-K15 HydrophobicContact CD1-CG 4.37Å; F11-K15 HydrophobicContact CE1-CG 4Å; F11-K15 HydrophobicContact CZ-CD 4.49Å; F11-K15 HydrophobicContact CZ-CG 4.09Å; F11-K15 WeakPolarHBondContact O-CG 3.18Å; F11-K15 PolarHBondContact O-N 3.16Å
12	L	77.8	Confident	69.7	Low	58 Å²	58	90.9 Å²	90.9	30%	0.304	48%	0.483	S	S	.	.	H	α-helix	trans	-66.8	-36.4	178.5	-68.3	172.3	0	0	0	112.1	A8 L9 N10 K15 G16 L17 L18	A8-L12 WeakPolarHBondContact O-CB 3.11Å; A8-L12 VanDerWaalsContact O-CG 3.23Å; A8-L12 WeakPolarHBondContact O-CG 3.43Å; A8-L12 PolarHBondContact O-N 3.34Å; L9-L12 PolarHBondContact O-N 3.16Å; N10-L12 PolarHBondContact O-N 3.38Å; L12-K15 CarbonylContact O-C 3.57Å; L12-K15 PolarHBondContact O-N 2.78Å; L12-G16 PolarHBondContact O-N 3.46Å; L12-G16 VanDerWaalsContact O-N 3.16Å; L12-L17 HydrophobicContact CB-CB 4.39Å; L12-L17 HydrophobicContact CD2-CB 4.15Å; L12-L17 HydrophobicContact CD2-CD1 3.7Å; L12-L17 PolarHBondContact O-N 2.15Å; L12-L18 HydrophobicContact CB-CB 4.16Å; L12-L18 HydrophobicContact CB-CD1 3.54Å; L12-L18 HydrophobicContact CB-CG 3.69Å; L12-L18 HydrophobicContact CD1-CD1 3.61Å; L12-L18 HydrophobicContact CD1-CG 4.16Å; L12-L18 HydrophobicContact CG-CD1 4.23Å; L12-L18 PolarHBondContact O-N 3.23Å
13	R	73	Confident	70.6	Confident	76 Å²	76	91 Å²	91	29%	0.287	48%	0.48	S	S	.	.	H	α-helix	trans	-60.9	-47.6	171.4	-76.9	178	-174.5	-171.3	13.7	111.8	L9 N10 K15 G16 L18 T20 D21	L9-R13 WeakPolarHBondContact O-CB 3.43Å; L9-R13 WeakPolarHBondContact O-CG 3.29Å; L9-R13 PolarHBondContact O-N 3.44Å; N10-R13 WeakPolarHBondContact O-CB 3.36Å; N10-R13 PolarHBondContact O-N 3.39Å; R13-K15 PolarHBondContact O-N 3.35Å; R13-G16 PolarHBondContact O-N 2.7Å; R13-L18 WeakPolarHBondContact CA-O 3.33Å; R13-L18 HydrophobicContact CG-CB 4.06Å; R13-T20 HydrophobicContact CB-CG2 3.8Å; R13-T20 WeakPolarHBondContact CD-O 3.43Å; R13-T20 HydrophobicContact CG-CG2 4.28Å; R13-T20 PolarHBondContact NE-O 3.36Å; R13-T20 PolarHBondContact NH1-O 2.81Å; R13-D21 IonicContact NH1-OD1 2.73Å
14	K	72.5	Confident	70.8	Confident	166 Å²	166	85.6 Å²	85.6	72%	0.722	45%	0.445	S	S	*	.	H	α-helix	trans	-60.3	-32.3	174.7	-75.7	179.4	-179.8	-179.8	0	112.9	N10 F11 G16	N10-K14 WeakPolarHBondContact O-CG 3.46Å; N10-K14 PolarHBondContact O-N 3.27Å; N10-K14 WeakPolarHBondContact OD1-CE 3.38Å; F11-K14 PolarHBondContact O-N 3.49Å; K14-G16 VanDerWaalsContact C-N 3.27Å
15	K	76.4	Confident	70.4	Confident	136 Å²	136	85.3 Å²	85.3	59%	0.591	45%	0.449	S	S	*	.	T	Hydrogen-bonded Turn	trans	-81.4	-4	176.3	-67.6	-65.9	-177.1	-180	0	113.5	F11 L12 R13 L17	F11-K15 HydrophobicContact CD1-CG 4.37Å; F11-K15 HydrophobicContact CE1-CG 4Å; F11-K15 HydrophobicContact CZ-CD 4.49Å; F11-K15 HydrophobicContact CZ-CG 4.09Å; F11-K15 WeakPolarHBondContact O-CG 3.18Å; F11-K15 PolarHBondContact O-N 3.16Å; L12-K15 CarbonylContact O-C 3.57Å; L12-K15 PolarHBondContact O-N 2.78Å; R13-K15 PolarHBondContact O-N 3.35Å; K15-L17 HydrophobicContact CB-CD1 4.11Å; K15-L17 HydrophobicContact CB-CG 4.03Å; K15-L17 PolarHBondContact O-N 3.48Å
16	G	61.5	Low	70.4	Confident	64 Å²	64	81.6 Å²	81.6	66%	0.66	44%	0.439	S	S	*	.	T	Hydrogen-bonded Turn	trans	70.4	10.8	-175.5	0	0	0	0	0	113.9	L12 R13 K14	L12-G16 PolarHBondContact O-N 3.46Å; L12-G16 VanDerWaalsContact O-N 3.16Å; R13-G16 PolarHBondContact O-N 2.7Å; K14-G16 VanDerWaalsContact C-N 3.27Å
17	L	68.6	Low	70.8	Confident	116 Å²	116	75.6 Å²	75.6	61%	0.607	42%	0.415	S	S	*	.	S	Bend	trans	-81.5	-21	177.7	-63.9	175.6	0	0	0	112.1	L12 K15	L12-L17 HydrophobicContact CB-CB 4.39Å; L12-L17 HydrophobicContact CD2-CB 4.15Å; L12-L17 HydrophobicContact CD2-CD1 3.7Å; L12-L17 PolarHBondContact O-N 2.15Å; K15-L17 HydrophobicContact CB-CD1 4.11Å; K15-L17 HydrophobicContact CB-CG 4.03Å; K15-L17 PolarHBondContact O-N 3.48Å
18	L	63.2	Low	70.8	Confident	19 Å²	19	75.7 Å²	75.7	10%	0.099	42%	0.419	C	S	.	.	S	Bend	trans	-126.6	140.5	172	-70.4	179.3	0	0	0	109.2	L9 L12 R13 T20 V53	L9-L18 HydrophobicContact CD2-CD1 3.42Å; L9-L18 VanDerWaalsContact CD2-CD1 3.42Å; L12-L18 HydrophobicContact CB-CB 4.16Å; L12-L18 HydrophobicContact CB-CD1 3.54Å; L12-L18 HydrophobicContact CB-CG 3.69Å; L12-L18 HydrophobicContact CD1-CD1 3.61Å; L12-L18 HydrophobicContact CD1-CG 4.16Å; L12-L18 HydrophobicContact CG-CD1 4.23Å; L12-L18 PolarHBondContact O-N 3.23Å; R13-L18 WeakPolarHBondContact CA-O 3.33Å; R13-L18 HydrophobicContact CG-CB 4.06Å; L18-T20 PolarHBondContact O-N 3.34Å; L18-V53 HydrophobicContact CD2-CG1 4.23Å; L18-V53 WeakPolarHBondContact CD2-O 3.49Å
19	H	57.8	Low	70.9	Confident	133 Å²	133	79.2 Å²	79.2	62%	0.616	43%	0.43	S	S	*	.			trans	-64	126.9	175.1	-126.7	59.5	0	0	0	110.2	D21	H19-D21 PolarHBondContact O-N 3.36Å
20	T	58.5	Low	71.1	Confident	82 Å²	82	80.2 Å²	80.2	50%	0.503	45%	0.445	S	S	.	.	S	Bend	trans	-62.1	-42.5	-169.5	3.4	0	0	0	0	113.1	R13 L18	R13-T20 HydrophobicContact CB-CG2 3.8Å; R13-T20 WeakPolarHBondContact CD-O 3.43Å; R13-T20 HydrophobicContact CG-CG2 4.28Å; R13-T20 PolarHBondContact NE-O 3.36Å; R13-T20 PolarHBondContact NH1-O 2.81Å; L18-T20 PolarHBondContact O-N 3.34Å
21	D	58.8	Low	71.4	Confident	116 Å²	116	77 Å²	77	62%	0.62	43%	0.428	S	S	*	.	S	Bend	trans	-151.4	103.6	174.9	-71	-50.5	0	0	0	104.8	R13 H19 L23	R13-D21 IonicContact NH1-OD1 2.73Å; H19-D21 PolarHBondContact O-N 3.36Å; D21-L23 VanDerWaalsContact C-N 3.29Å; D21-L23 PolarHBondContact O-N 2.92Å
22	S	65	Low	71.5	Confident	6 Å²	6	80.6 Å²	80.6	4%	0.042	44%	0.438	C	S	.	.			trans	-67.9	88	-173.7	49.3	0	0	0	0	109.9	M31 W40	S22-M31 WeakPolarHBondContact O-CB 3.45Å; S22-M31 WeakPolarHBondContact O-CG 3.43Å; S22-M31 PolarHBondContact O-N 3.39Å; S22-M31 WeakPolarHBondContact OG-CB 3.31Å; S22-W40 WeakPolarHBondContact OG-CZ3 3.29Å
23	L	72.6	Confident	71.4	Confident	96 Å²	96	80.7 Å²	80.7	50%	0.503	44%	0.438	S	S	.	.	B	Isolated β-bridge	trans	-73.4	133.5	166.9	-59	176.2	0	0	0	107.8	D21 P25 G28 Q29	D21-L23 VanDerWaalsContact C-N 3.29Å; D21-L23 PolarHBondContact O-N 2.92Å; L23-P25 WeakPolarHBondContact O-CD 3.49Å; L23-P25 VanDerWaalsContact O-N 3.16Å; L23-G28 WeakPolarHBondContact CD2-O 3.48Å; L23-Q29 CarbonylContact C-O 3.5Å; L23-Q29 WeakPolarHBondContact CA-O 3.13Å
24	C	76.3	Confident	71.4	Confident	1 Å²	1	78.7 Å²	78.7	1%	0.007	44%	0.441	C	S	.	.			trans	-55.4	122.2	176	-160.5	0	0	0	0	106.8	S26 C27 G28 Q29 M31 C42 C47	C24-S26 PolarHBondContact O-N 2.92Å; C24-C27 HydrophobicContact CB-CB 4.37Å; C24-C27 WeakPolarHBondContact CB-SG 3.45Å; C24-C27 PolarHBondContact O-N 3.45Å; C24-C27 VanDerWaalsContact O-N 3.08Å; C24-G28 WeakPolarHBondContact O-CA 3.15Å; C24-G28 PolarHBondContact O-N 3.17Å; C24-Q29 PolarHBondContact N-O 3.4Å; C24-M31 HydrophobicContact CB-CG 4.27Å; C24-M31 HydrophobicContact CB-SD 4.49Å; C24-C42 HydrophobicContact CB-CB 4.17Å; C24-C42 VanDerWaalsContact SG-SG 3.69Å; C24-C47 VanDerWaalsContact CB-SG 3.5Å; C24-C47 WeakPolarHBondContact SG-CB 3.44Å; C24-C47 CovalentContact SG-SG 2.15Å; C24-C47 PolarHBondContact SG-SG 2.74Å
25	P	72.8	Confident	71.2	Confident	95 Å²	95	83.6 Å²	83.6	62%	0.617	46%	0.455	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.5	-22.6	-178.2	20.9	-32.8	0	0	0	113	L23 L51	L23-P25 WeakPolarHBondContact O-CD 3.49Å; L23-P25 VanDerWaalsContact O-N 3.16Å; P25-L51 HydrophobicContact CG-CD1 4.18Å
26	S	75.6	Confident	70.9	Confident	66 Å²	66	80.1 Å²	80.1	46%	0.462	46%	0.458	S	S	.	.	T	Hydrogen-bonded Turn	trans	-104.4	-5.8	178.2	42.5	0	0	0	0	115.7	C24 C47 K49	C24-S26 PolarHBondContact O-N 2.92Å; S26-C47 PolarHBondContact OG-SG 2.9Å; S26-K49 VanDerWaalsContact CB-NZ 3.32Å; S26-K49 WeakPolarHBondContact OG-CD 3.48Å; S26-K49 WeakPolarHBondContact OG-CE 3.33Å; S26-K49 PolarHBondContact OG-NZ 3.32Å
27	C	79.9	Confident	71.3	Confident	36 Å²	36	78.6 Å²	78.6	24%	0.243	44%	0.443	C	S	.	.	T	Hydrogen-bonded Turn	trans	-135.5	-2.7	173.8	79.1	0	0	0	0	115.7	C24 Q29 C42 K44 C47	C24-C27 HydrophobicContact CB-CB 4.37Å; C24-C27 WeakPolarHBondContact CB-SG 3.45Å; C24-C27 PolarHBondContact O-N 3.45Å; C24-C27 VanDerWaalsContact O-N 3.08Å; C27-Q29 PolarHBondContact O-N 3.1Å; C27-Q29 VanDerWaalsContact O-N 3.08Å; C27-Q29 VanDerWaalsContact SG-CB 3.58Å; C27-C42 PolarHBondContact SG-SG 3.44Å; C27-K44 HydrophobicContact CB-CD 4.4Å; C27-C47 PolarHBondContact SG-SG 3.3Å
28	G	77.4	Confident	71.4	Confident	44 Å²	44	81.4 Å²	81.4	45%	0.454	45%	0.45	S	S	.	.			trans	63.2	11.7	179.5	0	0	0	0	0	114.6	L23 C24	L23-G28 WeakPolarHBondContact CD2-O 3.48Å; C24-G28 WeakPolarHBondContact O-CA 3.15Å; C24-G28 PolarHBondContact O-N 3.17Å
29	Q	78.9	Confident	71.9	Confident	107 Å²	107	81.9 Å²	81.9	50%	0.5	46%	0.457	S	S	.	.	P	Polyproline II helix	trans	-90.6	145.1	179.1	-65.3	-65.4	-66.7	0	0	111.1	L23 C24 C27 M31	L23-Q29 CarbonylContact C-O 3.5Å; L23-Q29 WeakPolarHBondContact CA-O 3.13Å; C24-Q29 PolarHBondContact N-O 3.4Å; C27-Q29 PolarHBondContact O-N 3.1Å; C27-Q29 VanDerWaalsContact O-N 3.08Å; C27-Q29 VanDerWaalsContact SG-CB 3.58Å; Q29-M31 PolarHBondContact O-N 2.89Å
30	A	77.5	Confident	73	Confident	67 Å²	67	77.1 Å²	77.1	55%	0.554	43%	0.433	S	S	*	.	B	Isolated β-bridge	trans	-55.3	130.6	173.7	0	0	0	0	0	111.4
31	M	80.9	Confident	74	Confident	14 Å²	14	79.5 Å²	79.5	7%	0.069	43%	0.433	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-94	150.3	173.8	-56.4	172	75.5	0	0	109.3	S22 C24 Q29 W40 R41 C42 K49 L51	S22-M31 WeakPolarHBondContact O-CB 3.45Å; S22-M31 WeakPolarHBondContact O-CG 3.43Å; S22-M31 PolarHBondContact O-N 3.39Å; S22-M31 WeakPolarHBondContact OG-CB 3.31Å; C24-M31 HydrophobicContact CB-CG 4.27Å; C24-M31 HydrophobicContact CB-SD 4.49Å; Q29-M31 PolarHBondContact O-N 2.89Å; M31-W40 HydrophobicContact CB-CB 4.02Å; M31-W40 HydrophobicContact CB-CE3 4.32Å; M31-W40 HydrophobicContact CE-CB 3.63Å; M31-W40 WeakPolarHBondContact CE-O 3.18Å; M31-W40 HydrophobicContact SD-CB 4.15Å; M31-R41 CarbonylContact C-O 3.57Å; M31-R41 WeakPolarHBondContact CA-O 3.45Å; M31-R41 WeakPolarHBondContact CB-O 3.1Å; M31-C42 HydrophobicContact CG-CB 4.22Å; M31-K49 WeakPolarHBondContact CE-O 3.21Å; M31-L51 HydrophobicContact CE-CB 4.05Å; M31-L51 HydrophobicContact CE-CD1 3.94Å; M31-L51 HydrophobicContact CE-CG 3.81Å; M31-L51 HydrophobicContact SD-CD1 3.77Å; M31-L51 HydrophobicContact SD-CG 4.33Å
32	R	77.2	Confident	75.2	Confident	194 Å²	194	74.3 Å²	74.3	73%	0.732	41%	0.406	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-104.5	139.5	177.3	-174.7	-180	179.3	174.6	4	109.5	G34 W40 R41	R32-G34 PolarHBondContact O-N 3.08Å; R32-W40 CarbonylContact O-C 3.48Å; R32-W40 WeakPolarHBondContact O-CA 3.28Å; R32-R41 PolarHBondContact N-O 3.37Å; R32-R41 PolarHBondContact O-N 2.79Å
33	L	75.6	Confident	75.8	Confident	60 Å²	60	81.4 Å²	81.4	31%	0.314	44%	0.438	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-67.9	123.3	170.2	-168.8	61.9	0	0	0	110.1	W40 V53	L33-W40 HydrophobicContact CB-CE3 4.14Å; L33-W40 HydrophobicContact CB-CZ3 4.07Å; L33-W40 HydrophobicContact CD1-CD2 4.25Å; L33-W40 HydrophobicContact CD1-CE3 4.5Å; L33-V53 HydrophobicContact CD1-CB 4.48Å; L33-V53 HydrophobicContact CD1-CG2 3.17Å
34	G	72.7	Confident	76	Confident	34 Å²	34	81.9 Å²	81.9	35%	0.351	44%	0.436	S	S	.	.			trans	-65.8	166.3	178.3	0	0	0	0	0	113	R32 G36 G37 A39	R32-G34 PolarHBondContact O-N 3.08Å; G34-G36 PolarHBondContact O-N 3.48Å; G34-G37 PolarHBondContact O-N 2.84Å; G34-G37 VanDerWaalsContact O-N 3.1Å; G34-A39 PolarHBondContact N-O 3.08Å
35	R	69.1	Low	76	Confident	269 Å²	269	93.6 Å²	93.6	100%	1.015	48%	0.48	S	S	*	.	T	Hydrogen-bonded Turn	trans	-62.4	110.3	175.3	-63.8	-172.6	-155.2	-130.8	5.1	109
36	G	69.7	Low	76.4	Confident	63 Å²	63	93.4 Å²	93.4	65%	0.649	48%	0.481	S	S	*	.	T	Hydrogen-bonded Turn	trans	112.8	0.5	-178.8	0	0	0	0	0	115	G34 K38	G34-G36 PolarHBondContact O-N 3.48Å; G36-K38 VanDerWaalsContact O-CG 3.29Å; G36-K38 WeakPolarHBondContact O-CG 3.28Å; G36-K38 PolarHBondContact O-N 3.37Å; G36-K38 VanDerWaalsContact O-N 3.11Å
37	G	69.1	Low	76.5	Confident	33 Å²	33	91.3 Å²	91.3	34%	0.34	47%	0.466	S	S	.	.	S	Bend	trans	67.8	16.7	167.5	0	0	0	0	0	115.3	G34 V53	G34-G37 PolarHBondContact O-N 2.84Å; G34-G37 VanDerWaalsContact O-N 3.1Å; G37-V53 WeakPolarHBondContact O-CG2 3.09Å
38	K	70.8	Confident	76.2	Confident	175 Å²	175	94.8 Å²	94.8	76%	0.761	48%	0.482	S	S	*	.	S	Bend	trans	-95.2	-35.1	-174.6	-54.6	-170.7	-177.9	-178.1	0	113.3	G36 V53	G36-K38 VanDerWaalsContact O-CG 3.29Å; G36-K38 WeakPolarHBondContact O-CG 3.28Å; G36-K38 PolarHBondContact O-N 3.37Å; G36-K38 VanDerWaalsContact O-N 3.11Å; K38-V53 WeakPolarHBondContact O-CG2 3.4Å; K38-V53 PolarHBondContact O-N 3.23Å
39	A	74.9	Confident	76.2	Confident	29 Å²	29	97 Å²	97	24%	0.24	48%	0.48	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-139.8	142.3	-175.5	0	0	0	0	0	111.7	G34 L51	G34-A39 PolarHBondContact N-O 3.08Å; A39-L51 CarbonylContact C-O 3.56Å; A39-L51 VanDerWaalsContact CA-O 3.24Å; A39-L51 WeakPolarHBondContact CA-O 3.39Å
40	W	79.2	Confident	76.2	Confident	33 Å²	33	96.8 Å²	96.8	13%	0.125	48%	0.478	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-81.6	131.3	164.6	-63.1	101.6	0	0	0	109.1	S22 M31 R32 L33 E50 L51 V53	S22-W40 WeakPolarHBondContact OG-CZ3 3.29Å; M31-W40 HydrophobicContact CB-CB 4.02Å; M31-W40 HydrophobicContact CB-CE3 4.32Å; M31-W40 HydrophobicContact CE-CB 3.63Å; M31-W40 WeakPolarHBondContact CE-O 3.18Å; M31-W40 HydrophobicContact SD-CB 4.15Å; R32-W40 CarbonylContact O-C 3.48Å; R32-W40 WeakPolarHBondContact O-CA 3.28Å; L33-W40 HydrophobicContact CB-CE3 4.14Å; L33-W40 HydrophobicContact CB-CZ3 4.07Å; L33-W40 HydrophobicContact CD1-CD2 4.25Å; L33-W40 HydrophobicContact CD1-CE3 4.5Å; W40-E50 CarbonylContact O-C 3.59Å; W40-E50 WeakPolarHBondContact O-CA 3.39Å; W40-L51 HydrophobicContact CB-CB 4.41Å; W40-L51 PolarHBondContact N-O 2.84Å; W40-L51 PolarHBondContact O-N 2.82Å; W40-V53 HydrophobicContact CG-CG2 4.33Å
41	R	80.5	Confident	76	Confident	131 Å²	131	95.9 Å²	95.9	49%	0.494	46%	0.464	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.7	134.1	171.1	-175.2	-177.7	-70.1	-164.6	-8	109.6	M31 R32 H43 E50	M31-R41 CarbonylContact C-O 3.57Å; M31-R41 WeakPolarHBondContact CA-O 3.45Å; M31-R41 WeakPolarHBondContact CB-O 3.1Å; R32-R41 PolarHBondContact N-O 3.37Å; R32-R41 PolarHBondContact O-N 2.79Å; R41-H43 PolarHBondContact O-N 3.34Å; R41-E50 HydrophobicContact CB-CG 4.3Å; R41-E50 HydrophobicContact CG-CG 4.12Å; R41-E50 IonicContact CZ-OE1 3.7Å; R41-E50 IonicContact NE-OE1 3.88Å; R41-E50 PolarHBondContact NE-OE1 3.36Å; R41-E50 IonicContact NH2-OE1 2.69Å; R41-E50 PolarHBondContact NH2-OE1 2.83Å
42	C	82.7	Confident	75.5	Confident	7 Å²	7	98 Å²	98	5%	0.047	48%	0.48	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-63.7	136.3	172.8	-172.4	0	0	0	0	111.5	C24 C27 M31 K44 C47 K49	C24-C42 HydrophobicContact CB-CB 4.17Å; C24-C42 VanDerWaalsContact SG-SG 3.69Å; C27-C42 PolarHBondContact SG-SG 3.44Å; M31-C42 HydrophobicContact CG-CB 4.22Å; C42-K44 PolarHBondContact O-N 3.03Å; C42-K44 PolarHBondContact SG-N 3.09Å; C42-C47 HydrophobicContact CB-CB 3.67Å; C42-C47 WeakPolarHBondContact SG-CB 3.19Å; C42-K49 PolarHBondContact N-O 3.01Å
43	H	77.9	Confident	75	Confident	155 Å²	155	89.9 Å²	89.9	72%	0.718	45%	0.451	S	S	*	.	S	Bend	trans	-64.8	-29	176.3	-173	-96.9	0	0	0	112.8	R41 R45	R41-H43 PolarHBondContact O-N 3.34Å; H43-R45 PolarHBondContact O-N 3.22Å
44	K	77.3	Confident	74.4	Confident	106 Å²	106	94.6 Å²	94.6	46%	0.461	47%	0.465	S	S	.	.	S	Bend	trans	-72.9	114.2	-179.9	-165.5	-179.5	-169.1	-176	0	109.2	C27 C42 S46 C47 D48	C27-K44 HydrophobicContact CB-CD 4.4Å; C42-K44 PolarHBondContact O-N 3.03Å; C42-K44 PolarHBondContact SG-N 3.09Å; K44-S46 VanDerWaalsContact CD-OG 3.31Å; K44-S46 WeakPolarHBondContact CD-OG 3.35Å; K44-S46 WeakPolarHBondContact CE-OG 3.18Å; K44-S46 WeakPolarHBondContact CG-OG 3.42Å; K44-S46 PolarHBondContact O-N 2.76Å; K44-C47 HydrophobicContact CB-CB 4.14Å; K44-C47 PolarHBondContact O-N 3.47Å; K44-D48 PolarHBondContact O-N 3.13Å
45	R	76	Confident	73.6	Confident	247 Å²	247	98 Å²	98	93%	0.932	48%	0.479	S	S	*	.	T	Hydrogen-bonded Turn	trans	-53.7	-23.9	175.3	-68.5	-170.2	-175.5	-170	2.2	113.6	H43	H43-R45 PolarHBondContact O-N 3.22Å
46	S	81.3	Confident	72.8	Confident	92 Å²	92	88.4 Å²	88.4	64%	0.643	46%	0.464	S	S	*	.	T	Hydrogen-bonded Turn	trans	-89.2	-17.9	175.4	82.7	0	0	0	0	114.7	K44	K44-S46 VanDerWaalsContact CD-OG 3.31Å; K44-S46 WeakPolarHBondContact CD-OG 3.35Å; K44-S46 WeakPolarHBondContact CE-OG 3.18Å; K44-S46 WeakPolarHBondContact CG-OG 3.42Å; K44-S46 PolarHBondContact O-N 2.76Å
47	C	79.1	Confident	71.7	Confident	22 Å²	22	88.2 Å²	88.2	15%	0.149	45%	0.45	C	S	.	.	T	Hydrogen-bonded Turn	trans	-76.1	-41.4	173	-146.4	0	0	0	0	107.8	C24 S26 C27 C42 K44 K49	C24-C47 VanDerWaalsContact CB-SG 3.5Å; C24-C47 WeakPolarHBondContact SG-CB 3.44Å; C24-C47 CovalentContact SG-SG 2.15Å; C24-C47 PolarHBondContact SG-SG 2.74Å; S26-C47 PolarHBondContact OG-SG 2.9Å; C27-C47 PolarHBondContact SG-SG 3.3Å; C42-C47 HydrophobicContact CB-CB 3.67Å; C42-C47 WeakPolarHBondContact SG-CB 3.19Å; K44-C47 HydrophobicContact CB-CB 4.14Å; K44-C47 PolarHBondContact O-N 3.47Å; C47-K49 WeakPolarHBondContact O-CG 3.28Å; C47-K49 PolarHBondContact O-N 3.01Å
48	D	72.2	Confident	70.7	Confident	108 Å²	108	97.4 Å²	97.4	58%	0.578	48%	0.475	S	S	*	.			trans	34.5	22.6	-172	-149.8	30.3	0	0	0	116	K44	K44-D48 PolarHBondContact O-N 3.13Å
49	K	78.4	Confident	69.2	Low	92 Å²	92	97.8 Å²	97.8	40%	0.4	48%	0.477	S	S	.	.			trans	-79.3	131	179.5	-66.6	-153.4	176.2	174.5	0	108.5	S26 M31 C42 C47	S26-K49 VanDerWaalsContact CB-NZ 3.32Å; S26-K49 WeakPolarHBondContact OG-CD 3.48Å; S26-K49 WeakPolarHBondContact OG-CE 3.33Å; S26-K49 PolarHBondContact OG-NZ 3.32Å; M31-K49 WeakPolarHBondContact CE-O 3.21Å; C42-K49 PolarHBondContact N-O 3.01Å; C47-K49 WeakPolarHBondContact O-CG 3.28Å; C47-K49 PolarHBondContact O-N 3.01Å
50	E	77.9	Confident	67.9	Low	101 Å²	101	98.7 Å²	98.7	47%	0.472	48%	0.478	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111	133.7	170.2	-61.1	-168.5	129.9	0	0	109.1	W40 R41	W40-E50 CarbonylContact O-C 3.59Å; W40-E50 WeakPolarHBondContact O-CA 3.39Å; R41-E50 HydrophobicContact CB-CG 4.3Å; R41-E50 HydrophobicContact CG-CG 4.12Å; R41-E50 IonicContact CZ-OE1 3.7Å; R41-E50 IonicContact NE-OE1 3.88Å; R41-E50 PolarHBondContact NE-OE1 3.36Å; R41-E50 IonicContact NH2-OE1 2.69Å; R41-E50 PolarHBondContact NH2-OE1 2.83Å
51	L	73	Confident	66.5	Low	49 Å²	49	102.9 Å²	102.9	26%	0.257	50%	0.503	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.8	134.9	176	-63.7	177.6	0	0	0	109	P25 M31 A39 W40	P25-L51 HydrophobicContact CG-CD1 4.18Å; M31-L51 HydrophobicContact CE-CB 4.05Å; M31-L51 HydrophobicContact CE-CD1 3.94Å; M31-L51 HydrophobicContact CE-CG 3.81Å; M31-L51 HydrophobicContact SD-CD1 3.77Å; M31-L51 HydrophobicContact SD-CG 4.33Å; A39-L51 CarbonylContact C-O 3.56Å; A39-L51 VanDerWaalsContact CA-O 3.24Å; A39-L51 WeakPolarHBondContact CA-O 3.39Å; W40-L51 HydrophobicContact CB-CB 4.41Å; W40-L51 PolarHBondContact N-O 2.84Å; W40-L51 PolarHBondContact O-N 2.82Å
52	C	70.4	Confident	64.9	Low	59 Å²	59	106.1 Å²	106.1	40%	0.399	52%	0.52	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-60.4	143	172.4	-66.7	0	0	0	0	110.4	R54	C52-R54 PolarHBondContact O-N 2.73Å
53	V	66.9	Low	63.2	Low	22 Å²	22	108.9 Å²	108.9	13%	0.133	54%	0.544	C	S	.	.	S	Bend	trans	-65.6	-28.4	-177.1	171	0	0	0	0	112.4	L18 L33 G37 K38 W40	L18-V53 HydrophobicContact CD2-CG1 4.23Å; L18-V53 WeakPolarHBondContact CD2-O 3.49Å; L33-V53 HydrophobicContact CD1-CB 4.48Å; L33-V53 HydrophobicContact CD1-CG2 3.17Å; G37-V53 WeakPolarHBondContact O-CG2 3.09Å; K38-V53 WeakPolarHBondContact O-CG2 3.4Å; K38-V53 PolarHBondContact O-N 3.23Å; W40-V53 HydrophobicContact CG-CG2 4.33Å
54	R	63.6	Low	61.6	Low	160 Å²	160	104 Å²	104	60%	0.604	53%	0.53	S	S	*	.	S	Bend	trans	-110.5	95.6	176.5	-63.6	175.4	65	169.3	4.5	107.7	C52 T57	C52-R54 PolarHBondContact O-N 2.73Å; R54-T57 PolarHBondContact NE-OG1 3.48Å
55	T	55	Low	59.9	Low	104 Å²	104	109 Å²	109	64%	0.638	56%	0.555	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.9	121	166.2	-52.2	0	0	0	0	107.9	D60	T55-D60 WeakPolarHBondContact CA-OD2 3.37Å
56	G	52.9	Low	58.3	Low	68 Å²	68	100 Å²	100	70%	0.701	54%	0.54	S	S	*	.	T	Hydrogen-bonded Turn	trans	111.1	10.9	172.1	0	0	0	0	0	116.8	D60	G56-D60 PolarHBondContact N-OD2 2.95Å
57	T	46.7	Very low	56.6	Low	60 Å²	60	99.3 Å²	99.3	37%	0.368	54%	0.539	S	S	.	.	S	Bend	trans	-117.9	102	168.4	52.4	0	0	0	0	111.1	R54 F59	R54-T57 PolarHBondContact NE-OG1 3.48Å; T57-F59 PolarHBondContact O-N 3.14Å
58	W	48.1	Very low	54.9	Low	226 Å²	226	100.4 Å²	100.4	86%	0.856	55%	0.55	S	S	*	.	S	Bend	trans	39.6	-45.7	165.5	-164.4	-71.4	0	0	0	119.1	D60	W58-D60 PolarHBondContact O-N 3.4Å
59	F	39.5	Very low	53.6	Low	183 Å²	183	100.9 Å²	100.9	80%	0.803	55%	0.553	S	S	*	*			trans	-78.7	8.8	-178	-60.9	-71.1	0	0	0	114.7	T57 D61	T57-F59 PolarHBondContact O-N 3.14Å; F59-D61 VanDerWaalsContact C-N 3.26Å; F59-D61 PolarHBondContact O-N 3.23Å
60	D	48	Very low	51.9	Low	48 Å²	48	102 Å²	102	26%	0.257	56%	0.563	S	S	.	*			trans	-87.1	53.7	173.1	-71.8	-39.6	0	0	0	111.2	T55 G56 W58 K62	T55-D60 WeakPolarHBondContact CA-OD2 3.37Å; G56-D60 PolarHBondContact N-OD2 2.95Å; W58-D60 PolarHBondContact O-N 3.4Å; D60-K62 PolarHBondContact O-N 3.1Å
61	D	48.9	Very low	50.4	Low	121 Å²	121	103.5 Å²	103.5	65%	0.647	57%	0.573	S	S	*	*	S	Bend	trans	-76	-1	-179.6	-64.1	-55	0	0	0	113.7	F59	F59-D61 VanDerWaalsContact C-N 3.26Å; F59-D61 PolarHBondContact O-N 3.23Å
62	K	48	Very low	49.2	Very low	199 Å²	199	105.4 Å²	105.4	87%	0.865	58%	0.58	S	S	*	*	S	Bend	trans	-144.1	8.6	-171.5	-68	-63.4	163.6	-165.5	0	119.9	D60	D60-K62 PolarHBondContact O-N 3.1Å
63	A	46.7	Very low	48.3	Very low	65 Å²	65	107.5 Å²	107.5	54%	0.537	59%	0.587	S	S	.	*	S	Bend	trans	-146.1	31.4	-173.5	0	0	0	0	0	118.5
64	A	43.8	Very low	47.3	Very low	53 Å²	53	113.2 Å²	113.2	44%	0.438	61%	0.612	S	S	.	*			trans	-125.4	45.9	173.3	0	0	0	0	0	113.2	G66	A64-G66 PolarHBondContact O-N 3.49Å; A64-G66 VanDerWaalsContact O-N 3.16Å
65	E	42.1	Very low	46.8	Very low	209 Å²	209	108 Å²	108	98%	0.977	60%	0.6	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79.9	89.3	163.8	-141.4	177.4	136.2	0	0	107.7
66	G	42.4	Very low	46.9	Very low	60 Å²	60	110.4 Å²	110.4	62%	0.619	60%	0.598	S	S	*	*	T	Hydrogen-bonded Turn	trans	127.4	2.5	167.1	0	0	0	0	0	118.6	A64	A64-G66 PolarHBondContact O-N 3.49Å; A64-G66 VanDerWaalsContact O-N 3.16Å
67	A	44.7	Very low	47.2	Very low	76 Å²	76	111 Å²	111	63%	0.628	59%	0.587	S	S	*	*	T	Hydrogen-bonded Turn	trans	-116.6	-5.6	169.8	0	0	0	0	0	113.7	D69	A67-D69 VanDerWaalsContact C-N 3.29Å; A67-D69 PolarHBondContact O-N 3.41Å
68	A	43.8	Very low	48.1	Very low	45 Å²	45	114 Å²	114	37%	0.372	60%	0.597	S	S	.	*	H	α-helix	trans	-75.8	-15.2	177.3	0	0	0	0	0	113.4	N70 Q72	A68-N70 VanDerWaalsContact C-N 3.31Å; A68-N70 PolarHBondContact O-N 2.95Å; A68-Q72 VanDerWaalsContact O-CB 3.28Å; A68-Q72 WeakPolarHBondContact O-CB 3.4Å; A68-Q72 PolarHBondContact O-N 3.49Å
69	D	45.3	Very low	49.2	Very low	119 Å²	119	107.1 Å²	107.1	64%	0.636	58%	0.577	S	S	*	*	H	α-helix	trans	-66.7	-28.5	-171	-67	-54.8	0	0	0	113.8	A67 L73	A67-D69 VanDerWaalsContact C-N 3.29Å; A67-D69 PolarHBondContact O-N 3.41Å; D69-L73 PolarHBondContact O-N 2.86Å
70	N	43	Very low	50.8	Low	116 Å²	116	102 Å²	102	62%	0.62	56%	0.558	S	S	*	*	H	α-helix	trans	-85.2	-43.3	-176.5	-160.4	14.7	0	0	0	113.3	A68 Q72 L73 E74	A68-N70 VanDerWaalsContact C-N 3.31Å; A68-N70 PolarHBondContact O-N 2.95Å; N70-Q72 VanDerWaalsContact C-N 3.26Å; N70-Q72 PolarHBondContact O-N 3.46Å; N70-L73 PolarHBondContact O-N 3.37Å; N70-L73 VanDerWaalsContact O-N 3.16Å; N70-E74 PolarHBondContact O-N 3.38Å
71	I	46	Very low	52.1	Low	132 Å²	132	104.9 Å²	104.9	68%	0.677	57%	0.57	S	S	*	*	H	α-helix	trans	-65.8	-35.7	177.3	-59.9	175.6	0	0	0	110.1	L73 S75	I71-L73 VanDerWaalsContact C-N 3.29Å; I71-L73 PolarHBondContact O-N 2.95Å; I71-S75 PolarHBondContact O-N 2.97Å; I71-S75 VanDerWaalsContact O-N 3.09Å
72	Q	48.3	Very low	53.3	Low	89 Å²	89	102.5 Å²	102.5	42%	0.416	56%	0.556	S	S	.	*	H	α-helix	trans	-70.8	-25	177.6	-162	165.7	7.3	0	0	112.7	A68 N70 S75 R76	A68-Q72 VanDerWaalsContact O-CB 3.28Å; A68-Q72 WeakPolarHBondContact O-CB 3.4Å; A68-Q72 PolarHBondContact O-N 3.49Å; N70-Q72 VanDerWaalsContact C-N 3.26Å; N70-Q72 PolarHBondContact O-N 3.46Å; Q72-S75 PolarHBondContact O-OG 2.88Å; Q72-S75 VanDerWaalsContact O-OG 3.13Å; Q72-R76 VanDerWaalsContact O-CB 3.28Å; Q72-R76 WeakPolarHBondContact O-CB 3.46Å; Q72-R76 WeakPolarHBondContact O-CD 3.22Å; Q72-R76 WeakPolarHBondContact O-CG 3.48Å; Q72-R76 PolarHBondContact O-N 3.49Å
73	L	51.2	Low	54.6	Low	102 Å²	102	98.3 Å²	98.3	53%	0.534	54%	0.543	S	S	.	.	H	α-helix	trans	-71.5	-45.8	175.6	-160.6	73	0	0	0	111.1	D69 N70 I71 R76 V77	D69-L73 PolarHBondContact O-N 2.86Å; N70-L73 PolarHBondContact O-N 3.37Å; N70-L73 VanDerWaalsContact O-N 3.16Å; I71-L73 VanDerWaalsContact C-N 3.29Å; I71-L73 PolarHBondContact O-N 2.95Å; L73-R76 PolarHBondContact O-N 3.4Å; L73-V77 WeakPolarHBondContact O-CG2 3.33Å; L73-V77 PolarHBondContact O-N 3.34Å
74	E	46.1	Very low	56.1	Low	143 Å²	143	103.7 Å²	103.7	67%	0.668	55%	0.55	S	S	*	.	H	α-helix	trans	-65.3	-39.5	176.8	-67.4	-165	114.6	0	0	112.1	N70 V77 H78	N70-E74 PolarHBondContact O-N 3.38Å; E74-V77 PolarHBondContact O-N 3Å; E74-H78 PolarHBondContact O-N 2.87Å; E74-H78 VanDerWaalsContact O-N 3.08Å
75	S	53	Low	57.7	Low	50 Å²	50	104.3 Å²	104.3	35%	0.35	55%	0.554	S	S	.	*	H	α-helix	trans	-63.4	-44.5	175.2	78	0	0	0	0	111.2	I71 Q72 V77 H78 D79	I71-S75 PolarHBondContact O-N 2.97Å; I71-S75 VanDerWaalsContact O-N 3.09Å; Q72-S75 PolarHBondContact O-OG 2.88Å; Q72-S75 VanDerWaalsContact O-OG 3.13Å; S75-V77 VanDerWaalsContact C-N 3.32Å; S75-V77 PolarHBondContact O-N 3.34Å; S75-H78 CarbonylContact O-C 3.45Å; S75-H78 WeakPolarHBondContact O-CA 3.42Å; S75-H78 WeakPolarHBondContact O-CB 3.48Å; S75-H78 PolarHBondContact O-N 3.3Å; S75-H78 VanDerWaalsContact O-N 3.08Å; S75-D79 PolarHBondContact O-N 2.95Å
76	R	55.3	Low	59.4	Low	154 Å²	154	102.4 Å²	102.4	58%	0.581	54%	0.538	S	S	*	.	H	α-helix	trans	-60.1	-39.6	176.4	-80	172.7	172.7	178.4	2	112.8	Q72 L73 H78 D79 D80	Q72-R76 VanDerWaalsContact O-CB 3.28Å; Q72-R76 WeakPolarHBondContact O-CB 3.46Å; Q72-R76 WeakPolarHBondContact O-CD 3.22Å; Q72-R76 WeakPolarHBondContact O-CG 3.48Å; Q72-R76 PolarHBondContact O-N 3.49Å; L73-R76 PolarHBondContact O-N 3.4Å; R76-H78 VanDerWaalsContact C-N 3.3Å; R76-D79 PolarHBondContact O-N 3.24Å; R76-D80 WeakPolarHBondContact O-CB 3.39Å; R76-D80 PolarHBondContact O-N 2.89Å
77	V	60.9	Low	61	Low	80 Å²	80	102 Å²	102	49%	0.485	53%	0.529	S	S	.	.	H	α-helix	trans	-66.5	-35.7	176.6	171.9	0	0	0	0	110.9	L73 E74 S75 Q81	L73-V77 WeakPolarHBondContact O-CG2 3.33Å; L73-V77 PolarHBondContact O-N 3.34Å; E74-V77 PolarHBondContact O-N 3Å; S75-V77 VanDerWaalsContact C-N 3.32Å; S75-V77 PolarHBondContact O-N 3.34Å; V77-Q81 WeakPolarHBondContact O-CB 3.19Å; V77-Q81 VanDerWaalsContact O-CG 3.31Å; V77-Q81 WeakPolarHBondContact O-CG 3.35Å; V77-Q81 PolarHBondContact O-N 3.33Å; V77-Q81 PolarHBondContact O-NE2 2.81Å; V77-Q81 VanDerWaalsContact O-NE2 3.1Å
78	H	65.5	Low	62.7	Low	123 Å²	123	100.7 Å²	100.7	57%	0.569	52%	0.523	S	S	*	.	H	α-helix	trans	-69.2	-44.3	172.4	-117.3	84.8	0	0	0	112	E74 S75 R76 D80 Q81 I82	E74-H78 PolarHBondContact O-N 2.87Å; E74-H78 VanDerWaalsContact O-N 3.08Å; S75-H78 CarbonylContact O-C 3.45Å; S75-H78 WeakPolarHBondContact O-CA 3.42Å; S75-H78 WeakPolarHBondContact O-CB 3.48Å; S75-H78 PolarHBondContact O-N 3.3Å; S75-H78 VanDerWaalsContact O-N 3.08Å; R76-H78 VanDerWaalsContact C-N 3.3Å; H78-D80 PolarHBondContact O-N 2.78Å; H78-Q81 PolarHBondContact O-N 2.8Å; H78-I82 WeakPolarHBondContact O-CD1 3.33Å; H78-I82 WeakPolarHBondContact O-CG1 3.45Å; H78-I82 PolarHBondContact O-N 3.22Å
79	D	69.7	Low	64.2	Low	83 Å²	83	101.7 Å²	101.7	44%	0.444	53%	0.531	S	S	.	.	H	α-helix	trans	-62.3	-42.6	177.9	-71.4	-50.5	0	0	0	111.2	S75 R76 I82 L83	S75-D79 PolarHBondContact O-N 2.95Å; R76-D79 PolarHBondContact O-N 3.24Å; D79-I82 PolarHBondContact O-N 2.96Å; D79-L83 WeakPolarHBondContact O-CB 3.2Å; D79-L83 WeakPolarHBondContact O-CD1 3.44Å; D79-L83 PolarHBondContact O-N 3.29Å
80	D	74.3	Confident	65.6	Low	74 Å²	74	103 Å²	103	40%	0.396	53%	0.534	S	S	.	.	H	α-helix	trans	-65.7	-38.9	177.4	-164.6	-97.8	0	0	0	111.7	R76 H78 L83 R84	R76-D80 WeakPolarHBondContact O-CB 3.39Å; R76-D80 PolarHBondContact O-N 2.89Å; H78-D80 PolarHBondContact O-N 2.78Å; D80-L83 PolarHBondContact O-N 3.16Å; D80-R84 WeakPolarHBondContact O-CB 3.49Å; D80-R84 VanDerWaalsContact O-CG 3.29Å; D80-R84 WeakPolarHBondContact O-CG 3.39Å; D80-R84 PolarHBondContact O-N 2.99Å; D80-R84 IonicContact OD1-CZ 2.95Å; D80-R84 IonicContact OD1-NE 2.74Å; D80-R84 PolarHBondContact OD1-NE 3.38Å; D80-R84 IonicContact OD1-NH2 2.71Å; D80-R84 PolarHBondContact OD1-NH2 2.86Å
81	Q	75.2	Confident	67	Low	110 Å²	110	104 Å²	104	51%	0.514	54%	0.535	S	S	.	.	H	α-helix	trans	-63.7	-41.9	171.8	-77.5	176.6	82.6	0	0	112.2	V77 H78 R84 A85	V77-Q81 WeakPolarHBondContact O-CB 3.19Å; V77-Q81 VanDerWaalsContact O-CG 3.31Å; V77-Q81 WeakPolarHBondContact O-CG 3.35Å; V77-Q81 PolarHBondContact O-N 3.33Å; V77-Q81 PolarHBondContact O-NE2 2.81Å; V77-Q81 VanDerWaalsContact O-NE2 3.1Å; H78-Q81 PolarHBondContact O-N 2.8Å; Q81-R84 PolarHBondContact O-N 3.26Å; Q81-A85 WeakPolarHBondContact O-CB 3.46Å; Q81-A85 PolarHBondContact O-N 2.69Å
82	I	74	Confident	68.4	Low	70 Å²	70	99.9 Å²	99.9	36%	0.359	52%	0.524	S	S	.	.	H	α-helix	trans	-65.4	-42.6	176	-68.3	163.5	0	0	0	110.6	H78 D79 A85 R86	H78-I82 WeakPolarHBondContact O-CD1 3.33Å; H78-I82 WeakPolarHBondContact O-CG1 3.45Å; H78-I82 PolarHBondContact O-N 3.22Å; D79-I82 PolarHBondContact O-N 2.96Å; I82-A85 PolarHBondContact O-N 2.93Å; I82-R86 WeakPolarHBondContact O-CB 3.32Å; I82-R86 WeakPolarHBondContact O-CG 3.24Å; I82-R86 PolarHBondContact O-N 2.81Å
83	L	76.2	Confident	69.4	Low	112 Å²	112	103.8 Å²	103.8	59%	0.586	54%	0.536	S	S	*	.	H	α-helix	trans	-62.4	-44.5	175.9	-97.9	96.7	0	0	0	111.4	D79 D80 R86 A87	D79-L83 WeakPolarHBondContact O-CB 3.2Å; D79-L83 WeakPolarHBondContact O-CD1 3.44Å; D79-L83 PolarHBondContact O-N 3.29Å; D80-L83 PolarHBondContact O-N 3.16Å; L83-R86 PolarHBondContact O-N 3.28Å; L83-A87 WeakPolarHBondContact O-CB 3.43Å; L83-A87 PolarHBondContact O-N 3.38Å
84	R	78.2	Confident	70.4	Confident	178 Å²	178	107 Å²	107	67%	0.672	54%	0.541	S	S	*	.	H	α-helix	trans	-63.2	-42.6	175.7	-73.2	178	-164.8	-177.2	5.5	112.2	D80 Q81 R86 A87 G88	D80-R84 WeakPolarHBondContact O-CB 3.49Å; D80-R84 VanDerWaalsContact O-CG 3.29Å; D80-R84 WeakPolarHBondContact O-CG 3.39Å; D80-R84 PolarHBondContact O-N 2.99Å; D80-R84 IonicContact OD1-CZ 2.95Å; D80-R84 IonicContact OD1-NE 2.74Å; D80-R84 PolarHBondContact OD1-NE 3.38Å; D80-R84 IonicContact OD1-NH2 2.71Å; D80-R84 PolarHBondContact OD1-NH2 2.86Å; Q81-R84 PolarHBondContact O-N 3.26Å; R84-R86 VanDerWaalsContact C-N 3.31Å; R84-R86 PolarHBondContact O-N 2.71Å; R84-A87 PolarHBondContact O-N 3.22Å; R84-G88 PolarHBondContact O-N 3.02Å
85	A	75.8	Confident	71.7	Confident	65 Å²	65	102.6 Å²	102.6	54%	0.537	53%	0.527	S	S	.	.	H	α-helix	trans	-61.2	-41.4	176	0	0	0	0	0	111.5	Q81 I82 A89	Q81-A85 WeakPolarHBondContact O-CB 3.46Å; Q81-A85 PolarHBondContact O-N 2.69Å; I82-A85 PolarHBondContact O-N 2.93Å; A85-A89 WeakPolarHBondContact O-CB 3.41Å; A85-A89 PolarHBondContact O-N 3.25Å
86	R	78.6	Confident	72.4	Confident	169 Å²	169	102.8 Å²	102.8	64%	0.638	53%	0.531	S	S	*	.	H	α-helix	trans	-66	-43.7	175	-74.3	176.3	176.5	-176.2	0.8	112.5	I82 L83 R84 A89 Q90	I82-R86 WeakPolarHBondContact O-CB 3.32Å; I82-R86 WeakPolarHBondContact O-CG 3.24Å; I82-R86 PolarHBondContact O-N 2.81Å; L83-R86 PolarHBondContact O-N 3.28Å; R84-R86 VanDerWaalsContact C-N 3.31Å; R84-R86 PolarHBondContact O-N 2.71Å; R86-A89 PolarHBondContact O-N 3.31Å; R86-Q90 WeakPolarHBondContact O-CB 3.4Å; R86-Q90 WeakPolarHBondContact O-CG 3.41Å; R86-Q90 PolarHBondContact O-N 2.87Å
87	A	76.8	Confident	72.9	Confident	52 Å²	52	98.7 Å²	98.7	43%	0.43	52%	0.523	S	S	.	.	H	α-helix	trans	-62.7	-43.5	177.5	0	0	0	0	0	111.6	L83 R84 Q90 Q91	L83-A87 WeakPolarHBondContact O-CB 3.43Å; L83-A87 PolarHBondContact O-N 3.38Å; R84-A87 PolarHBondContact O-N 3.22Å; A87-Q90 PolarHBondContact O-N 3.25Å; A87-Q91 WeakPolarHBondContact O-CB 3.35Å; A87-Q91 PolarHBondContact O-N 3.01Å
88	G	79.6	Confident	73.3	Confident	48 Å²	48	101.8 Å²	101.8	50%	0.495	53%	0.532	S	S	.	.	H	α-helix	trans	-61.9	-43.3	174.6	0	0	0	0	0	112.8	R84 Q91 G92	R84-G88 PolarHBondContact O-N 3.02Å; G88-Q91 PolarHBondContact O-N 3.29Å; G88-G92 PolarHBondContact O-N 3.31Å
89	A	74.2	Confident	73.3	Confident	67 Å²	67	103.1 Å²	103.1	55%	0.554	54%	0.539	S	S	*	.	H	α-helix	trans	-64.3	-42.2	175.8	0	0	0	0	0	112.4	A85 R86 Q91 G92 Y93	A85-A89 WeakPolarHBondContact O-CB 3.41Å; A85-A89 PolarHBondContact O-N 3.25Å; R86-A89 PolarHBondContact O-N 3.31Å; A89-Q91 VanDerWaalsContact C-N 3.34Å; A89-Q91 PolarHBondContact O-N 3.32Å; A89-G92 PolarHBondContact O-N 2.82Å; A89-Y93 PolarHBondContact O-N 3.47Å
90	Q	74.8	Confident	72.8	Confident	146 Å²	146	103 Å²	103	68%	0.682	54%	0.541	S	S	*	.	H	α-helix	trans	-64.1	-38.5	175.5	-77.4	-171.6	-39.9	0	0	112.1	R86 A87 Y93 R94	R86-Q90 WeakPolarHBondContact O-CB 3.4Å; R86-Q90 WeakPolarHBondContact O-CG 3.41Å; R86-Q90 PolarHBondContact O-N 2.87Å; A87-Q90 PolarHBondContact O-N 3.25Å; Q90-Y93 PolarHBondContact O-N 2.9Å; Q90-R94 WeakPolarHBondContact O-CB 3.34Å; Q90-R94 PolarHBondContact O-N 3.33Å
91	Q	73.1	Confident	72.2	Confident	138 Å²	138	103.9 Å²	103.9	65%	0.645	55%	0.551	S	S	*	*	H	α-helix	trans	-70.6	-35.7	177.9	-169.2	147.2	-0.5	0	0	112.4	A87 G88 A89 R94 S95	A87-Q91 WeakPolarHBondContact O-CB 3.35Å; A87-Q91 PolarHBondContact O-N 3.01Å; G88-Q91 PolarHBondContact O-N 3.29Å; A89-Q91 VanDerWaalsContact C-N 3.34Å; A89-Q91 PolarHBondContact O-N 3.32Å; Q91-R94 PolarHBondContact O-N 3.29Å; Q91-S95 WeakPolarHBondContact O-CB 3.42Å; Q91-S95 PolarHBondContact O-N 3.29Å; Q91-S95 PolarHBondContact O-OG 3.49Å
92	G	75.4	Confident	71.4	Confident	44 Å²	44	103 Å²	103	45%	0.454	56%	0.562	S	S	.	*	H	α-helix	trans	-61.8	-45.9	169.5	0	0	0	0	0	112.2	G88 A89 S95 A96	G88-G92 PolarHBondContact O-N 3.31Å; A89-G92 PolarHBondContact O-N 2.82Å; G92-S95 PolarHBondContact O-N 2.92Å; G92-A96 WeakPolarHBondContact O-CB 3.29Å; G92-A96 PolarHBondContact O-N 3.38Å
93	Y	70.4	Confident	70.4	Confident	172 Å²	172	103.5 Å²	103.5	68%	0.675	58%	0.577	S	S	*	*	H	α-helix	trans	-61.8	-45.7	175.6	-179.4	-100.2	0	0	0	112.2	A89 Q90 S95 A96 V97	A89-Y93 PolarHBondContact O-N 3.47Å; Q90-Y93 PolarHBondContact O-N 2.9Å; Y93-S95 PolarHBondContact O-N 3.44Å; Y93-A96 PolarHBondContact O-N 2.62Å; Y93-V97 HydrophobicContact CD1-CG1 4.49Å; Y93-V97 HydrophobicContact CE1-CG1 4.03Å; Y93-V97 HydrophobicContact CE2-CG1 4.27Å; Y93-V97 PolarHBondContact O-N 3.11Å
94	R	71	Confident	69.2	Low	169 Å²	169	102.4 Å²	102.4	64%	0.638	58%	0.579	S	S	*	*	H	α-helix	trans	-61.7	-42.9	178.2	-170.4	176.4	179.4	172.7	4.4	112.1	Q90 Q91 A96 V97 E98	Q90-R94 WeakPolarHBondContact O-CB 3.34Å; Q90-R94 PolarHBondContact O-N 3.33Å; Q91-R94 PolarHBondContact O-N 3.29Å; R94-A96 VanDerWaalsContact C-N 3.33Å; R94-A96 PolarHBondContact O-N 3.24Å; R94-V97 WeakPolarHBondContact O-CG2 3.36Å; R94-V97 PolarHBondContact O-N 2.89Å; R94-E98 IonicContact NE-OE2 3.12Å; R94-E98 PolarHBondContact O-N 3.02Å; R94-E98 VanDerWaalsContact O-N 3.1Å
95	S	73.2	Confident	67.3	Low	51 Å²	51	99.3 Å²	99.3	36%	0.357	58%	0.583	S	S	.	*	H	α-helix	trans	-66.8	-36.4	177.3	-55.7	0	0	0	0	111.8	Q91 G92 Y93 Q99	Q91-S95 WeakPolarHBondContact O-CB 3.42Å; Q91-S95 PolarHBondContact O-N 3.29Å; Q91-S95 PolarHBondContact O-OG 3.49Å; G92-S95 PolarHBondContact O-N 2.92Å; Y93-S95 PolarHBondContact O-N 3.44Å; S95-Q99 VanDerWaalsContact O-CG 3.28Å; S95-Q99 WeakPolarHBondContact O-CG 3.23Å; S95-Q99 PolarHBondContact O-N 2.86Å; S95-Q99 VanDerWaalsContact O-N 3.14Å; S95-Q99 PolarHBondContact O-NE2 3.38Å
96	A	67.9	Low	65.7	Low	54 Å²	54	104.3 Å²	104.3	45%	0.446	60%	0.597	S	S	.	*	H	α-helix	trans	-66.1	-40.5	176.5	0	0	0	0	0	112.1	G92 Y93 R94 Q99 V100	G92-A96 WeakPolarHBondContact O-CB 3.29Å; G92-A96 PolarHBondContact O-N 3.38Å; Y93-A96 PolarHBondContact O-N 2.62Å; R94-A96 VanDerWaalsContact C-N 3.33Å; R94-A96 PolarHBondContact O-N 3.24Å; A96-Q99 PolarHBondContact O-N 3.26Å; A96-V100 WeakPolarHBondContact O-CG2 3.15Å; A96-V100 PolarHBondContact O-N 3.1Å
97	V	65.8	Low	64.1	Low	68 Å²	68	102.4 Å²	102.4	41%	0.412	60%	0.604	S	S	.	*	H	α-helix	trans	-71.6	-34.2	177.6	-61.7	0	0	0	0	112.9	Y93 R94 Q99 V100	Y93-V97 HydrophobicContact CD1-CG1 4.49Å; Y93-V97 HydrophobicContact CE1-CG1 4.03Å; Y93-V97 HydrophobicContact CE2-CG1 4.27Å; Y93-V97 PolarHBondContact O-N 3.11Å; R94-V97 WeakPolarHBondContact O-CG2 3.36Å; R94-V97 PolarHBondContact O-N 2.89Å; V97-Q99 VanDerWaalsContact C-N 3.28Å; V97-Q99 PolarHBondContact O-N 3.41Å; V97-V100 WeakPolarHBondContact O-CB 3.18Å; V97-V100 PolarHBondContact O-N 3.42Å
98	E	70	Confident	62.4	Low	144 Å²	144	106.7 Å²	106.7	67%	0.673	62%	0.62	S	S	*	*	H	α-helix	trans	-70.5	-25.4	174.5	-81.2	-174.2	76	0	0	112.8	R94 V100	R94-E98 IonicContact NE-OE2 3.12Å; R94-E98 PolarHBondContact O-N 3.02Å; R94-E98 VanDerWaalsContact O-N 3.1Å; E98-V100 VanDerWaalsContact C-N 3.31Å
99	Q	64.8	Low	60.2	Low	152 Å²	152	113.9 Å²	113.9	71%	0.71	64%	0.637	S	S	*	*	T	Hydrogen-bonded Turn	trans	-80.8	-9.4	173.8	-73.1	167.5	45.4	0	0	113.3	S95 A96 V97 P101	S95-Q99 VanDerWaalsContact O-CG 3.28Å; S95-Q99 WeakPolarHBondContact O-CG 3.23Å; S95-Q99 PolarHBondContact O-N 2.86Å; S95-Q99 VanDerWaalsContact O-N 3.14Å; S95-Q99 PolarHBondContact O-NE2 3.38Å; A96-Q99 PolarHBondContact O-N 3.26Å; V97-Q99 VanDerWaalsContact C-N 3.28Å; V97-Q99 PolarHBondContact O-N 3.41Å; Q99-P101 WeakPolarHBondContact O-CD 3.42Å
100	V	59.9	Low	58.6	Low	80 Å²	80	116.6 Å²	116.6	49%	0.485	65%	0.649	S	S	.	*	S	Bend	trans	-69.2	114.4	170.7	-178.5	0	0	0	0	107.3	A96 V97 E98 A102	A96-V100 WeakPolarHBondContact O-CG2 3.15Å; A96-V100 PolarHBondContact O-N 3.1Å; V97-V100 WeakPolarHBondContact O-CB 3.18Å; V97-V100 PolarHBondContact O-N 3.42Å; E98-V100 VanDerWaalsContact C-N 3.31Å; V100-A102 PolarHBondContact O-N 3.05Å
101	P	60.5	Low	56.8	Low	93 Å²	93	112.8 Å²	112.8	60%	0.604	64%	0.643	S	S	*	*			trans	-59.4	133.4	176.4	24.5	-32.1	0	0	0	108.7	Q99 A103 S104	Q99-P101 WeakPolarHBondContact O-CD 3.42Å; P101-A103 PolarHBondContact O-N 3.38Å; P101-S104 PolarHBondContact O-N 3.27Å
102	A	58.6	Low	55.3	Low	91 Å²	91	112.3 Å²	112.3	75%	0.752	65%	0.652	S	S	*	*	G	3₁₀ helix	trans	-52.5	-15.6	179.6	0	0	0	0	0	113.9	V100 S104	V100-A102 PolarHBondContact O-N 3.05Å; A102-S104 VanDerWaalsContact C-N 3.27Å; A102-S104 PolarHBondContact O-N 2.8Å
103	A	53.6	Low	53.6	Low	81 Å²	81	119.3 Å²	119.3	67%	0.669	67%	0.666	S	S	*	*	G	3₁₀ helix	trans	-67.8	-14.7	173.5	0	0	0	0	0	114.7	P101 C105	P101-A103 PolarHBondContact O-N 3.38Å; A103-C105 PolarHBondContact O-N 3.05Å
104	S	50.3	Low	52.1	Low	89 Å²	89	116.9 Å²	116.9	62%	0.622	66%	0.664	S	S	*	*	G	3₁₀ helix	trans	-75	-4.1	177.2	-163.5	0	0	0	0	114	P101 A102 M106	P101-S104 PolarHBondContact O-N 3.27Å; A102-S104 VanDerWaalsContact C-N 3.27Å; A102-S104 PolarHBondContact O-N 2.8Å; S104-M106 PolarHBondContact O-N 3.21Å
105	C	40.2	Very low	50.8	Low	113 Å²	113	117.8 Å²	117.8	76%	0.764	68%	0.68	S	S	*	*	G	3₁₀ helix	trans	-80.1	-2.2	178	-55.6	0	0	0	0	113.7	A103	A103-C105 PolarHBondContact O-N 3.05Å
106	M	40.4	Very low	49	Very low	169 Å²	169	121.8 Å²	121.8	83%	0.833	70%	0.696	S	S	*	*			trans	-107.4	84.2	177.7	-64.6	-166.3	166.3	0	0	110.7	S104	S104-M106 PolarHBondContact O-N 3.21Å
107	V	46.5	Very low	47.5	Very low	129 Å²	129	122.1 Å²	122.1	78%	0.782	71%	0.705	S	S	*	*	S	Bend	trans	-164.6	114.8	141.2	162.9	0	0	0	0	109.1
108	N	40.9	Very low	46.2	Very low	143 Å²	143	128.3 Å²	128.3	77%	0.765	73%	0.729	S	S	*	*			trans	45.2	110.7	152.9	-87.1	-85.4	0	0	0	119.9	P110	N108-P110 WeakPolarHBondContact O-CD 3.29Å
109	K	32.7	Very low	44.8	Very low	199 Å²	199	126.5 Å²	126.5	87%	0.865	74%	0.739	S	S	*	*	P	Polyproline II helix	trans	-55.9	116	143.7	-82.2	176.2	172.1	178.4	0	108.8	A111	K109-A111 PolarHBondContact O-N 3.34Å
110	P	39.9	Very low	43.5	Very low	123 Å²	123	122.4 Å²	122.4	80%	0.799	74%	0.737	S	S	*	*	P	Polyproline II helix	trans	-69.1	122.5	154.9	28.9	-29.8	0	0	0	107.8	N108	N108-P110 WeakPolarHBondContact O-CD 3.29Å
111	A	38.4	Very low	42.6	Very low	66 Å²	66	126.4 Å²	126.4	55%	0.545	76%	0.755	S	S	.	*	P	Polyproline II helix	trans	-54.9	142.7	173.2	0	0	0	0	0	110.7	K109 Y113	K109-A111 PolarHBondContact O-N 3.34Å; A111-Y113 VanDerWaalsContact C-N 3.28Å; A111-Y113 HydrophobicContact CB-CD2 3.88Å; A111-Y113 HydrophobicContact CB-CE2 4.29Å; A111-Y113 PolarHBondContact O-N 2.91Å
112	P	41.4	Very low	41.7	Very low	129 Å²	129	130.5 Å²	130.5	84%	0.838	77%	0.771	S	S	*	*			trans	-77.7	82.8	176.9	33	-31.9	0	0	0	108.5
113	Y	39.2	Very low	40.6	Very low	190 Å²	190	135.5 Å²	135.5	75%	0.745	78%	0.776	S	S	*	*			trans	-114.9	114.6	168.8	-83	-76.1	0	0	0	110.5	A111	A111-Y113 VanDerWaalsContact C-N 3.28Å; A111-Y113 HydrophobicContact CB-CD2 3.88Å; A111-Y113 HydrophobicContact CB-CE2 4.29Å; A111-Y113 PolarHBondContact O-N 2.91Å
114	L	39.7	Very low	39.9	Very low	122 Å²	122	136.5 Å²	136.5	64%	0.639	78%	0.779	S	S	*	*			trans	65.5	85.8	135	-74.1	162.6	0	0	0	116.4	I116	L114-I116 HydrophobicContact CB-CD1 4.2Å; L114-I116 HydrophobicContact CB-CG1 3.98Å; L114-I116 HydrophobicContact CD1-CD1 4.22Å; L114-I116 HydrophobicContact CD2-CD1 3.83Å; L114-I116 HydrophobicContact CD2-CG1 3.51Å; L114-I116 HydrophobicContact CG-CD1 4.3Å; L114-I116 HydrophobicContact CG-CG1 4.23Å; L114-I116 PolarHBondContact O-N 3.19Å
115	L	42.5	Very low	39.4	Very low	187 Å²	187	140.8 Å²	140.8	98%	0.979	79%	0.789	S	S	*	*			trans	-78.7	83.8	143.3	-79.1	163	0	0	0	108.3
116	I	36.9	Very low	39.5	Very low	136 Å²	136	146.5 Å²	146.5	70%	0.697	79%	0.794	S	S	*	*			trans	-82.2	137.2	158.5	-54.1	165.4	0	0	0	107.1	L114	L114-I116 HydrophobicContact CB-CD1 4.2Å; L114-I116 HydrophobicContact CB-CG1 3.98Å; L114-I116 HydrophobicContact CD1-CD1 4.22Å; L114-I116 HydrophobicContact CD2-CD1 3.83Å; L114-I116 HydrophobicContact CD2-CG1 3.51Å; L114-I116 HydrophobicContact CG-CD1 4.3Å; L114-I116 HydrophobicContact CG-CG1 4.23Å; L114-I116 PolarHBondContact O-N 3.19Å
117	G	36.1	Very low	39.4	Very low	61 Å²	61	143.9 Å²	143.9	63%	0.629	79%	0.79	S	S	*	*			trans	93.8	90	165.5	0	0	0	0	0	112.3
118	Q	37.1	Very low	39.5	Very low	197 Å²	197	144.2 Å²	144.2	92%	0.921	79%	0.792	S	S	*	*				32.5	102.5	84.9	-71.2	-169.9	42.9	0	0	113.4
119	A	41.2	Very low	40.2	Very low	107 Å²	107	146.4 Å²	146.4	88%	0.884	82%	0.819	S	S	*	*			trans	-27	140	153.1	0	0	0	0	0	114.4
120	G	37.9	Very low	40.6	Very low	65 Å²	65	143.8 Å²	143.8	67%	0.67	82%	0.816	S	S	*	*			trans	132.8	84.3	153.3	0	0	0	0	0	113.2
121	L	40.4	Very low	40.6	Very low	165 Å²	165	144.8 Å²	144.8	86%	0.864	82%	0.817	S	S	*	*				166.7	92.8	122.3	-85.8	155.7	0	0	0	107.4	F123	L121-F123 VanDerWaalsContact C-N 3.26Å; L121-F123 PolarHBondContact O-N 3.43Å
122	L	42	Very low	40.8	Very low	179 Å²	179	149.2 Å²	149.2	94%	0.937	83%	0.832	S	S	*	*			trans	-56.8	97.6	155.4	-75.5	159.8	0	0	0	106.9	S124	L122-S124 PolarHBondContact O-N 3.3Å
123	F	36.5	Very low	40.7	Very low	196 Å²	196	150.4 Å²	150.4	86%	0.86	83%	0.832	S	S	*	*			trans	-70.4	115	169.1	-150.9	-99.5	0	0	0	107.2	L121 Q125	L121-F123 VanDerWaalsContact C-N 3.26Å; L121-F123 PolarHBondContact O-N 3.43Å; F123-Q125 PolarHBondContact O-N 2.92Å
124	S	37.7	Very low	40.8	Very low	102 Å²	102	147.9 Å²	147.9	71%	0.713	84%	0.837	S	S	*	*			trans	-51.2	127.8	177.8	-173.9	0	0	0	0	111.2	L122 R126	L122-S124 PolarHBondContact O-N 3.3Å; S124-R126 PolarHBondContact O-N 3.45Å
125	Q	40.7	Very low	40.9	Very low	178 Å²	178	149.7 Å²	149.7	83%	0.832	85%	0.851	S	S	*	*			trans	-67.4	126.1	167.7	-62.4	-164.3	26.2	0	0	109.4	F123	F123-Q125 PolarHBondContact O-N 2.92Å
126	R	40.7	Very low	40.8	Very low	234 Å²	234	147 Å²	147	88%	0.883	84%	0.841	S	S	*	*			trans	-126.9	112.7	151.9	-103.8	-171.9	-164.3	-170.6	5.7	108.3	S124	S124-R126 PolarHBondContact O-N 3.45Å
127	P	40	Very low	41.1	Very low	113 Å²	113	147.8 Å²	147.8	73%	0.734	85%	0.852	S	S	*	*			trans	-91.2	126.9	163.9	32.3	-24.8	0	0	0	108.9
128	T	46.9	Very low	41.5	Very low	136 Å²	136	155.1 Å²	155.1	83%	0.834	87%	0.871	S	S	*	*			trans	-135.2	121.1	153.4	50.3	0	0	0	0	108
129	S	56.7	Low	41.9	Very low	189 Å²	189	151.3 Å²	151.3	100%	1.322	87%	0.867	S	S	*	*			trans	-51.5	0	163.1	177.9	0	0	0	0	112.6

Retrieved 129 of 129 residues in 68.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).