A0A077ZMD5_TRITR Loading...

Short neurotoxin 1

AlphaFold DB , UniProt , Accession A0A077ZMD5, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 46 aa.

						>A0A077ZMD5_TRITR|A0A077ZMD5
MWISTEDENQAESLVKCTGTDKKESGYKRGLEDHLGAVTRKGARCL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47.4	Very low	59.2	Low	231 Å²	231	135.5 Å²	135.5	100%	1.138	69%	0.686	S	S	*	*				0	90.6	0	-167.3	162.9	-176.2	0	0	106.4
2	W	55.9	Low	59.7	Low	260 Å²	260	133.1 Å²	133.1	99%	0.985	67%	0.67	S	S	*	*			trans	-84.6	112.5	173.2	-87.8	-63.2	0	0	0	106.6	S4	W2-S4 PolarHBondContact O-N 3.19Å
3	I	58.1	Low	60.2	Low	123 Å²	123	127.9 Å²	127.9	63%	0.631	65%	0.654	S	S	*	*			trans	-75.2	115.8	170.2	-61	171.1	0	0	0	105.2	D7	I3-D7 HydrophobicContact CG2-CB 3.6Å
4	S	57.3	Low	60.6	Low	84 Å²	84	126.5 Å²	126.5	59%	0.587	65%	0.648	S	S	*	*			trans	-59	138.1	178.6	-61.1	0	0	0	0	109.5	W2 E6 D7	W2-S4 PolarHBondContact O-N 3.19Å; S4-E6 PolarHBondContact O-N 3.44Å; S4-D7 WeakPolarHBondContact O-CB 3.24Å; S4-D7 PolarHBondContact O-N 3.42Å
5	T	61.9	Low	60.9	Low	113 Å²	113	124.1 Å²	124.1	69%	0.693	64%	0.641	S	S	*	*	H	α-helix	trans	-53.8	-15.3	-179.6	-33.1	0	0	0	0	113.8	D7	T5-D7 VanDerWaalsContact C-N 3.31Å; T5-D7 PolarHBondContact O-N 2.84Å
6	E	60.8	Low	61.4	Low	158 Å²	158	125.8 Å²	125.8	74%	0.738	64%	0.642	S	S	*	*	H	α-helix	trans	-67.9	-25.6	174.3	-153.4	167.2	98.8	0	0	113.4	S4 Q10	S4-E6 PolarHBondContact O-N 3.44Å; E6-Q10 PolarHBondContact O-N 3.04Å
7	D	59.1	Low	61.6	Low	102 Å²	102	124.5 Å²	124.5	55%	0.545	65%	0.646	S	S	.	*	H	α-helix	trans	-74.7	-36.3	177.3	-119.6	-90.7	0	0	0	112	I3 S4 T5 N9 Q10 A11	I3-D7 HydrophobicContact CG2-CB 3.6Å; S4-D7 WeakPolarHBondContact O-CB 3.24Å; S4-D7 PolarHBondContact O-N 3.42Å; T5-D7 VanDerWaalsContact C-N 3.31Å; T5-D7 PolarHBondContact O-N 2.84Å; D7-N9 VanDerWaalsContact C-N 3.29Å; D7-N9 PolarHBondContact O-N 2.96Å; D7-Q10 PolarHBondContact O-N 3.45Å; D7-A11 PolarHBondContact O-N 3.36Å
8	E	59.7	Low	61.6	Low	131 Å²	131	122.7 Å²	122.7	61%	0.612	64%	0.641	S	S	*	*	H	α-helix	trans	-63.5	-37.1	178.8	-67.3	-172.3	97.8	0	0	111.6	A11 E12	E8-A11 PolarHBondContact O-N 3.48Å; E8-E12 PolarHBondContact O-N 3.23Å
9	N	62	Low	61.2	Low	117 Å²	117	118.9 Å²	118.9	63%	0.626	64%	0.636	S	S	*	*	H	α-helix	trans	-73.4	-31.3	179.4	-153.6	31.4	0	0	0	112.1	D7 S13	D7-N9 VanDerWaalsContact C-N 3.29Å; D7-N9 PolarHBondContact O-N 2.96Å; N9-S13 PolarHBondContact O-N 3.37Å; N9-S13 WeakPolarHBondContact O-CB 3.43Å
10	Q	64	Low	61	Low	119 Å²	119	117.2 Å²	117.2	56%	0.556	63%	0.63	S	S	*	*	H	α-helix	trans	-69.4	-39.2	171.5	-69.9	-156	46.7	0	0	111.8	E6 D7 S13 L14	E6-Q10 PolarHBondContact O-N 3.04Å; D7-Q10 PolarHBondContact O-N 3.45Å; Q10-S13 PolarHBondContact O-N 3.5Å; Q10-L14 WeakPolarHBondContact O-CB 3.34Å; Q10-L14 WeakPolarHBondContact O-CG 3.48Å; Q10-L14 PolarHBondContact O-N 2.71Å
11	A	64.9	Low	60.9	Low	53 Å²	53	116.6 Å²	116.6	44%	0.438	63%	0.626	S	S	.	*	H	α-helix	trans	-63.6	-45.2	175.1	0	0	0	0	0	112	D7 E8 S13 L14 V15	D7-A11 PolarHBondContact O-N 3.36Å; E8-A11 PolarHBondContact O-N 3.48Å; A11-S13 VanDerWaalsContact C-N 3.34Å; A11-S13 PolarHBondContact O-N 2.85Å; A11-L14 PolarHBondContact O-N 3.31Å; A11-V15 WeakPolarHBondContact O-CG2 3.33Å; A11-V15 PolarHBondContact O-N 2.64Å
12	E	65.7	Low	61.4	Low	106 Å²	106	115.5 Å²	115.5	50%	0.495	62%	0.615	S	S	.	*	H	α-helix	trans	-62.6	-39.5	174.9	-89	-151.7	75.9	0	0	112.7	E8 V15 K16	E8-E12 PolarHBondContact O-N 3.23Å; E12-V15 PolarHBondContact O-N 2.85Å; E12-K16 PolarHBondContact O-N 3.04Å; E12-K16 IonicContact OE1-NZ 2.96Å; E12-K16 PolarHBondContact OE1-NZ 3.41Å; E12-K16 WeakPolarHBondContact O-CG 3.31Å
13	S	66.4	Low	61.3	Low	66 Å²	66	110.6 Å²	110.6	46%	0.462	60%	0.601	S	S	.	*	H	α-helix	trans	-66	-39.9	177	-164.5	0	0	0	0	111.6	N9 Q10 A11 K16 C17	N9-S13 PolarHBondContact O-N 3.37Å; N9-S13 WeakPolarHBondContact O-CB 3.43Å; Q10-S13 PolarHBondContact O-N 3.5Å; A11-S13 VanDerWaalsContact C-N 3.34Å; A11-S13 PolarHBondContact O-N 2.85Å; S13-K16 PolarHBondContact O-N 3.02Å; S13-C17 VanDerWaalsContact O-CB 3.24Å; S13-C17 WeakPolarHBondContact O-CB 3.34Å; S13-C17 PolarHBondContact O-N 3Å; S13-C17 PolarHBondContact O-SG 2.91Å
14	L	65.4	Low	61.2	Low	108 Å²	108	110.8 Å²	110.8	57%	0.565	60%	0.599	S	S	*	*	H	α-helix	trans	-64.4	-40.9	174.6	-78.2	165.2	0	0	0	112.3	Q10 A11 C17 T18	Q10-L14 WeakPolarHBondContact O-CB 3.34Å; Q10-L14 WeakPolarHBondContact O-CG 3.48Å; Q10-L14 PolarHBondContact O-N 2.71Å; A11-L14 PolarHBondContact O-N 3.31Å; L14-C17 PolarHBondContact O-N 3.31Å; L14-T18 WeakPolarHBondContact O-CB 3.34Å; L14-T18 PolarHBondContact O-OG1 2.99Å; L14-T18 PolarHBondContact O-N 2.98Å; L14-T18 WeakPolarHBondContact O-CG2 3.43Å; L14-T18 VanDerWaalsContact O-CB 3.31Å
15	V	65.2	Low	61.2	Low	90 Å²	90	112.1 Å²	112.1	55%	0.545	61%	0.609	S	S	.	*	H	α-helix	trans	-67.4	-38.6	177.4	174.1	0	0	0	0	111.6	A11 E12	A11-V15 WeakPolarHBondContact O-CG2 3.33Å; A11-V15 PolarHBondContact O-N 2.64Å; E12-V15 PolarHBondContact O-N 2.85Å
16	K	68.7	Low	61	Low	151 Å²	151	109.4 Å²	109.4	66%	0.657	60%	0.603	S	S	*	*	H	α-helix	trans	-69.2	-41.2	174.5	-73.2	170.9	-173.7	151.8	0	112.2	E12 S13	E12-K16 PolarHBondContact O-N 3.04Å; E12-K16 IonicContact OE1-NZ 2.96Å; E12-K16 PolarHBondContact OE1-NZ 3.41Å; E12-K16 WeakPolarHBondContact O-CG 3.31Å; S13-K16 PolarHBondContact O-N 3.02Å
17	C	64.3	Low	60.8	Low	104 Å²	104	110.1 Å²	110.1	70%	0.703	60%	0.6	S	S	*	*	H	α-helix	trans	-74.7	-36.6	-178.7	-72.4	0	0	0	0	113.3	S13 L14 G19	S13-C17 VanDerWaalsContact O-CB 3.24Å; S13-C17 WeakPolarHBondContact O-CB 3.34Å; S13-C17 PolarHBondContact O-N 3Å; S13-C17 PolarHBondContact O-SG 2.91Å; L14-C17 PolarHBondContact O-N 3.31Å; C17-G19 PolarHBondContact O-N 3.36Å
18	T	62.1	Low	60.8	Low	92 Å²	92	111.7 Å²	111.7	56%	0.564	60%	0.602	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.8	-2.1	178	54.7	0	0	0	0	112.9	L14 T20	L14-T18 WeakPolarHBondContact O-CB 3.34Å; L14-T18 PolarHBondContact O-OG1 2.99Å; L14-T18 PolarHBondContact O-N 2.98Å; L14-T18 WeakPolarHBondContact O-CG2 3.43Å; L14-T18 VanDerWaalsContact O-CB 3.31Å; T18-T20 PolarHBondContact O-N 3.38Å; T18-T20 PolarHBondContact OG1-OG1 2.65Å
19	G	54.3	Low	60.8	Low	52 Å²	52	115.3 Å²	115.3	54%	0.536	61%	0.61	S	S	.	*	T	Hydrogen-bonded Turn	trans	50.2	40.9	170	0	0	0	0	0	111.6	C17 D21	C17-G19 PolarHBondContact O-N 3.36Å; G19-D21 PolarHBondContact O-N 2.92Å
20	T	56.6	Low	60.8	Low	84 Å²	84	111.8 Å²	111.8	52%	0.515	60%	0.602	S	S	.	*			trans	-71.8	65.1	168.7	9.5	0	0	0	0	107.5	T18 K22	T18-T20 PolarHBondContact O-N 3.38Å; T18-T20 PolarHBondContact OG1-OG1 2.65Å; T20-K22 PolarHBondContact O-N 3.16Å; T20-K22 VanDerWaalsContact O-N 3.16Å
21	D	58.4	Low	60.7	Low	105 Å²	105	110.8 Å²	110.8	56%	0.561	60%	0.599	S	S	*	*			trans	-47.2	120.7	160.2	-149.7	-102	0	0	0	104.5	G19 K23	G19-D21 PolarHBondContact O-N 2.92Å; D21-K23 WeakPolarHBondContact OD1-CG 3.49Å; D21-K23 WeakPolarHBondContact OD1-CE 3.15Å; D21-K23 PolarHBondContact O-N 3.48Å; D21-K23 WeakPolarHBondContact OD1-CD 3.19Å
22	K	57.9	Low	60.6	Low	208 Å²	208	114.7 Å²	114.7	90%	0.904	61%	0.608	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63.2	31.8	176.3	-73.4	176.6	173.7	171.4	0	112.6	T20	T20-K22 PolarHBondContact O-N 3.16Å; T20-K22 VanDerWaalsContact O-N 3.16Å
23	K	55.6	Low	60.5	Low	157 Å²	157	115.7 Å²	115.7	68%	0.683	62%	0.617	S	S	*	*	T	Hydrogen-bonded Turn	trans	-88.6	5.2	167.2	-79.4	-173.2	-173.7	176.9	0	113.6	D21 S25 G26	D21-K23 WeakPolarHBondContact OD1-CG 3.49Å; D21-K23 WeakPolarHBondContact OD1-CE 3.15Å; D21-K23 PolarHBondContact O-N 3.48Å; D21-K23 WeakPolarHBondContact OD1-CD 3.19Å; K23-S25 VanDerWaalsContact O-N 3.12Å; K23-S25 PolarHBondContact O-N 3.26Å; K23-G26 PolarHBondContact O-N 3.03Å
24	E	56	Low	60.3	Low	126 Å²	126	118.6 Å²	118.6	59%	0.589	62%	0.623	S	S	*	*	H	α-helix	trans	-61.5	-18.4	173.1	-157.3	-176.7	95.8	0	0	113.2	G26 Y27 K28	E24-G26 PolarHBondContact O-N 3.27Å; E24-Y27 PolarHBondContact O-N 3.12Å; E24-K28 PolarHBondContact O-N 3.4Å; E24-K28 VanDerWaalsContact O-N 3.11Å
25	S	57.2	Low	60	Low	113 Å²	113	118.6 Å²	118.6	79%	0.79	62%	0.623	S	S	*	*	H	α-helix	trans	-63.4	-25.4	171.5	-79.4	0	0	0	0	113.9	K23	K23-S25 VanDerWaalsContact O-N 3.12Å; K23-S25 PolarHBondContact O-N 3.26Å
26	G	57.5	Low	59.7	Low	55 Å²	55	115.9 Å²	115.9	57%	0.567	61%	0.614	S	S	*	*	H	α-helix	trans	-84.8	-34.8	173.7	0	0	0	0	0	113	K23 E24	K23-G26 PolarHBondContact O-N 3.03Å; E24-G26 PolarHBondContact O-N 3.27Å
27	Y	56.7	Low	59.4	Low	174 Å²	174	111.2 Å²	111.2	68%	0.682	60%	0.603	S	S	*	*	H	α-helix	trans	-71.1	-36	-176.9	-124.8	-94.4	0	0	0	112.3	E24 R29 G30 L31	E24-Y27 PolarHBondContact O-N 3.12Å; Y27-R29 VanDerWaalsContact C-N 3.34Å; Y27-R29 PolarHBondContact O-N 2.98Å; Y27-G30 PolarHBondContact O-N 3.29Å; Y27-L31 HydrophobicContact CD1-CD1 4.25Å; Y27-L31 PolarHBondContact O-N 3.03Å; Y27-L31 WeakPolarHBondContact O-CB 3.34Å
28	K	58.3	Low	59.1	Low	135 Å²	135	109.9 Å²	109.9	59%	0.587	59%	0.592	S	S	*	*	H	α-helix	trans	-61.4	-40.2	-179.4	-146.6	175.3	-173.3	178.7	0	112.7	E24 L31 E32	E24-K28 PolarHBondContact O-N 3.4Å; E24-K28 VanDerWaalsContact O-N 3.11Å; K28-L31 PolarHBondContact O-N 3.11Å; K28-E32 WeakPolarHBondContact O-CG 3.38Å; K28-E32 PolarHBondContact O-N 2.95Å
29	R	60.2	Low	58.9	Low	206 Å²	206	109.9 Å²	109.9	78%	0.777	59%	0.592	S	S	*	*	H	α-helix	trans	-70.2	-35	179.1	-151.9	175	-164	-146.3	2.3	112.8	Y27 D33	Y27-R29 VanDerWaalsContact C-N 3.34Å; Y27-R29 PolarHBondContact O-N 2.98Å; R29-D33 PolarHBondContact O-N 3.26Å
30	G	61	Low	59	Low	44 Å²	44	117.9 Å²	117.9	45%	0.454	61%	0.606	S	S	.	*	H	α-helix	trans	-72.5	-35	174.8	0	0	0	0	0	113	Y27 H34	Y27-G30 PolarHBondContact O-N 3.29Å; G30-H34 WeakPolarHBondContact O-CB 3.48Å; G30-H34 PolarHBondContact O-N 3.37Å
31	L	62.1	Low	59.1	Low	98 Å²	98	122.6 Å²	122.6	51%	0.513	62%	0.619	S	S	.	*	H	α-helix	trans	-71.3	-39.3	177.2	-124	153.9	0	0	0	111.8	Y27 K28 H34 L35	Y27-L31 HydrophobicContact CD1-CD1 4.25Å; Y27-L31 PolarHBondContact O-N 3.03Å; Y27-L31 WeakPolarHBondContact O-CB 3.34Å; K28-L31 PolarHBondContact O-N 3.11Å; L31-H34 PolarHBondContact O-N 3.47Å; L31-L35 PolarHBondContact O-N 2.81Å; L31-L35 VanDerWaalsContact O-CB 3.25Å; L31-L35 WeakPolarHBondContact O-CB 3.46Å
32	E	63.2	Low	58.9	Low	134 Å²	134	119.7 Å²	119.7	63%	0.626	61%	0.614	S	S	*	*	H	α-helix	trans	-63.8	-41.3	174	-72.4	179	126.9	0	0	112.4	K28 G36	K28-E32 WeakPolarHBondContact O-CG 3.38Å; K28-E32 PolarHBondContact O-N 2.95Å; E32-G36 PolarHBondContact O-N 3.47Å
33	D	64.1	Low	58.7	Low	127 Å²	127	114.2 Å²	114.2	68%	0.679	61%	0.607	S	S	*	*	H	α-helix	trans	-66.3	-42.2	176.1	-166.3	-99.5	0	0	0	111.6	R29 G36 A37	R29-D33 PolarHBondContact O-N 3.26Å; D33-G36 PolarHBondContact O-N 3.05Å; D33-A37 WeakPolarHBondContact O-CB 3.21Å; D33-A37 PolarHBondContact O-N 2.89Å
34	H	62	Low	58.5	Low	128 Å²	128	118 Å²	118	59%	0.593	62%	0.617	S	S	*	*	H	α-helix	trans	-69.2	-41.6	177.5	-156.9	68.7	0	0	0	112.3	G30 L31 G36 A37 V38	G30-H34 WeakPolarHBondContact O-CB 3.48Å; G30-H34 PolarHBondContact O-N 3.37Å; L31-H34 PolarHBondContact O-N 3.47Å; H34-G36 VanDerWaalsContact C-N 3.34Å; H34-G36 PolarHBondContact O-N 3.2Å; H34-A37 PolarHBondContact O-N 3.47Å; H34-V38 WeakPolarHBondContact O-CG2 3.25Å; H34-V38 PolarHBondContact O-N 2.8Å
35	L	58.6	Low	58	Low	107 Å²	107	117.1 Å²	117.1	56%	0.56	62%	0.624	S	S	*	*	H	α-helix	trans	-66.1	-37.6	177	-145.5	78.8	0	0	0	111	L31 A37 V38 T39	L31-L35 PolarHBondContact O-N 2.81Å; L31-L35 VanDerWaalsContact O-CB 3.25Å; L31-L35 WeakPolarHBondContact O-CB 3.46Å; L35-A37 VanDerWaalsContact C-N 3.32Å; L35-A37 PolarHBondContact O-N 2.98Å; L35-V38 PolarHBondContact O-N 3.15Å; L35-T39 VanDerWaalsContact O-CB 3.29Å; L35-T39 WeakPolarHBondContact O-CB 3.29Å; L35-T39 PolarHBondContact O-N 2.95Å; L35-T39 PolarHBondContact O-OG1 3.42Å
36	G	60.1	Low	57.4	Low	34 Å²	34	123.4 Å²	123.4	35%	0.351	65%	0.647	S	S	.	*	H	α-helix	trans	-65.9	-30.1	173.3	0	0	0	0	0	114.1	E32 D33 H34	E32-G36 PolarHBondContact O-N 3.47Å; D33-G36 PolarHBondContact O-N 3.05Å; H34-G36 VanDerWaalsContact C-N 3.34Å; H34-G36 PolarHBondContact O-N 3.2Å
37	A	60.6	Low	57.4	Low	52 Å²	52	126.8 Å²	126.8	43%	0.43	65%	0.651	S	S	.	*	H	α-helix	trans	-78.4	-41	174.7	0	0	0	0	0	112.6	D33 H34 L35	D33-A37 WeakPolarHBondContact O-CB 3.21Å; D33-A37 PolarHBondContact O-N 2.89Å; H34-A37 PolarHBondContact O-N 3.47Å; L35-A37 VanDerWaalsContact C-N 3.32Å; L35-A37 PolarHBondContact O-N 2.98Å
38	V	59.3	Low	57.5	Low	76 Å²	76	124.3 Å²	124.3	46%	0.461	65%	0.65	S	S	.	*	H	α-helix	trans	-73.3	-34.2	-179.5	-178.7	0	0	0	0	111.1	H34 L35 R40 K41 G42	H34-V38 WeakPolarHBondContact O-CG2 3.25Å; H34-V38 PolarHBondContact O-N 2.8Å; L35-V38 PolarHBondContact O-N 3.15Å; V38-R40 VanDerWaalsContact C-N 3.28Å; V38-R40 PolarHBondContact O-N 3.3Å; V38-K41 PolarHBondContact O-N 3.46Å; V38-K41 VanDerWaalsContact O-N 3.15Å; V38-G42 PolarHBondContact O-N 2.65Å
39	T	58.1	Low	57.4	Low	93 Å²	93	123.7 Å²	123.7	57%	0.571	65%	0.653	S	S	*	*	H	α-helix	trans	-66	-27.4	178.2	-53.9	0	0	0	0	112.8	L35	L35-T39 VanDerWaalsContact O-CB 3.29Å; L35-T39 WeakPolarHBondContact O-CB 3.29Å; L35-T39 PolarHBondContact O-N 2.95Å; L35-T39 PolarHBondContact O-OG1 3.42Å
40	R	56.7	Low	57.3	Low	220 Å²	220	118.9 Å²	118.9	83%	0.83	65%	0.646	S	S	*	*	H	α-helix	trans	-82	-18.1	174.6	-76.9	-169.4	-83.4	-162.8	-3.1	114.6	V38	V38-R40 VanDerWaalsContact C-N 3.28Å; V38-R40 PolarHBondContact O-N 3.3Å
41	K	58.5	Low	57	Low	183 Å²	183	123.6 Å²	123.6	80%	0.796	66%	0.658	S	S	*	*	H	α-helix	trans	-100.8	-21.3	173.6	-81.8	-175	174.8	179.8	0	113.7	V38	V38-K41 PolarHBondContact O-N 3.46Å; V38-K41 VanDerWaalsContact O-N 3.15Å
42	G	53.3	Low	56.7	Low	44 Å²	44	125.3 Å²	125.3	45%	0.454	67%	0.667	S	S	.	*	H	α-helix	trans	-85.8	-16.9	-177.4	0	0	0	0	0	115.9	V38 R44 C45	V38-G42 PolarHBondContact O-N 2.65Å; G42-R44 PolarHBondContact O-N 3.08Å; G42-R44 VanDerWaalsContact O-N 3.08Å; G42-C45 PolarHBondContact O-N 3.44Å
43	A	53.7	Low	56.2	Low	92 Å²	92	124.6 Å²	124.6	76%	0.76	67%	0.67	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.5	9.2	176.9	0	0	0	0	0	114.3
44	R	52.2	Low	55.6	Low	237 Å²	237	124.5 Å²	124.5	89%	0.894	67%	0.67	S	S	*	*	T	Hydrogen-bonded Turn	trans	-110.5	11.4	176.9	-122	-177.3	-168	-158.5	2.9	113.8	G42	G42-R44 PolarHBondContact O-N 3.08Å; G42-R44 VanDerWaalsContact O-N 3.08Å
45	C	45.1	Very low	55.1	Low	108 Å²	108	124.2 Å²	124.2	73%	0.73	68%	0.676	S	S	*	*			trans	-127.4	52.4	178.2	-67.6	0	0	0	0	111.6	G42	G42-C45 PolarHBondContact O-N 3.44Å
46	L	44.8	Very low	54.8	Low	244 Å²	244	125.7 Å²	125.7	100%	1.277	69%	0.687	S	S	*	*			trans	-152.1	0	149	-86	-178.3	0	0	0	107.9

Retrieved 46 of 46 residues in 55.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).