A0A077ZMF4_TRITR Loading...

SF3b10 domain containing protein

AlphaFold DB , UniProt , Accession A0A077ZMF4, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 39 aa.

>A0A077ZMF4_TRITR|A0A077ZMF4
MSFMAVVENETRARMRFIFLQRMIQPCGPPPERPDETET
Structure Viewer
Loading PAE data...
(Predicted Aligned Error values between residue pairs)
Error loading PAE data: please refresh the page.

 

Download Structure   PDB   PAE   Table  
Site Residue pLDDT pLDDT confidence pLDDT10 pLDDT10 confidence SASA SASA [Ų] SASA10 SASA10 [Ų] RSA RSA unformatted RSA10 RSA10 unformatted Surface Surface10 (not used) Disorder (not used) Disorder Sec. str. Secondary structure Isomer Phi (φ) Psi (ψ) Omega (ω) Chi 1 (χ1) Chi 2 (χ2) Chi 3 (χ3) Chi 4 (χ4) Chi 5 (χ5) Tau (τ) Contacts (colored by PAE) Contact details
1M85.3Confident95.6Very high93 Ų9392.5 Ų92.546%0.45849%0.494SS..  0-330-130.6168.9-157.400113.8F3 M4 A5 R16 F19M1-F3 VanDerWaalsContact C-N 3.34Å; M1-F3 PolarHBondContact O-N 2.94Å; M1-M4 PolarHBondContact O-N 3Å; M1-A5 WeakPolarHBondContact O-CB 3.38Å; M1-A5 PolarHBondContact O-N 3.48Å; M1-A5 VanDerWaalsContact O-N 3.08Å; M1-R16 HydrophobicContact CE-CB 4.08Å; M1-R16 HydrophobicContact CE-CG 3.38Å; M1-R16 HydrophobicContact SD-CB 4.44Å; M1-R16 HydrophobicContact SD-CG 3.22Å; M1-R16 WeakPolarHBondContact SD-CG 3.22Å; M1-F19 HydrophobicContact CE-CB 4.45Å; M1-F19 HydrophobicContact CE-CD2 3.29Å; M1-F19 HydrophobicContact CE-CE2 3.83Å; M1-F19 HydrophobicContact CE-CG 4.23Å; M1-F19 HydrophobicContact CG-CE2 4.35Å
2S93.5Very high95.7Very high60 Ų6095.8 Ų95.842%0.4250%0.495SS..Hα-helixtrans-61.5-40177.2-48.60000112.9M4 A5 V6S2-M4 PolarHBondContact O-N 2.68Å; S2-A5 PolarHBondContact O-N 3.08Å; S2-V6 WeakPolarHBondContact O-CG2 2.97Å; S2-V6 PolarHBondContact O-N 2.81Å
3F97Very high95.8Very high152 Ų15293.8 Ų93.867%0.66750%0.501SS*.Hα-helixtrans-54.2-55.2176-179.5-100.9000112.2M1 A5 V6 V7M1-F3 VanDerWaalsContact C-N 3.34Å; M1-F3 PolarHBondContact O-N 2.94Å; F3-A5 VanDerWaalsContact C-N 3.33Å; F3-A5 PolarHBondContact O-N 3.35Å; F3-V6 PolarHBondContact O-N 3.46Å; F3-V7 HydrophobicContact CD1-CG2 4.33Å; F3-V7 HydrophobicContact CE1-CG2 3.99Å; F3-V7 HydrophobicContact CE2-CG2 4.24Å; F3-V7 HydrophobicContact CZ-CG2 3.94Å; F3-V7 WeakPolarHBondContact O-CG2 3.31Å; F3-V7 PolarHBondContact O-N 3.26Å
4M96.7Very high95.9Very high88 Ų8896.8 Ų96.843%0.43350%0.502SS..Hα-helixtrans-62.3-38178.2-64.4-62.8-171.300112.7M1 S2 V6 V7 E8 M15 F19M1-M4 PolarHBondContact O-N 3Å; S2-M4 PolarHBondContact O-N 2.68Å; M4-V6 VanDerWaalsContact C-N 3.32Å; M4-V6 PolarHBondContact O-N 2.75Å; M4-V7 PolarHBondContact O-N 3.01Å; M4-E8 WeakPolarHBondContact O-CB 3.42Å; M4-E8 WeakPolarHBondContact O-CG 3.39Å; M4-E8 PolarHBondContact O-N 3.34Å; M4-M15 HydrophobicContact CB-CE 4.08Å; M4-F19 HydrophobicContact CB-CZ 4.18Å; M4-F19 HydrophobicContact CG-CZ 4.2Å
5A97.2Very high96Very high7 Ų790.9 Ų90.96%0.05847%0.471CS..Hα-helixtrans-63.1-37.6176.400000112.6M1 S2 F3 N9 E10 R12 M15M1-A5 WeakPolarHBondContact O-CB 3.38Å; M1-A5 PolarHBondContact O-N 3.48Å; M1-A5 VanDerWaalsContact O-N 3.08Å; S2-A5 PolarHBondContact O-N 3.08Å; F3-A5 VanDerWaalsContact C-N 3.33Å; F3-A5 PolarHBondContact O-N 3.35Å; A5-N9 PolarHBondContact O-N 3.25Å; A5-E10 CarbonylContact C-O 3.57Å; A5-E10 WeakPolarHBondContact CB-O 3.44Å; A5-E10 PolarHBondContact O-N 3.16Å; A5-R12 HydrophobicContact CB-CG 3.94Å; A5-M15 HydrophobicContact CB-CG 4.06Å
6V97.1Very high96.1Very high120 Ų12093.4 Ų93.473%0.72747%0.472SS*.Hα-helixtrans-71.1-45.2175.3173.20000111.1S2 F3 M4 N9S2-V6 WeakPolarHBondContact O-CG2 2.97Å; S2-V6 PolarHBondContact O-N 2.81Å; F3-V6 PolarHBondContact O-N 3.46Å; M4-V6 VanDerWaalsContact C-N 3.32Å; M4-V6 PolarHBondContact O-N 2.75Å; V6-N9 PolarHBondContact O-N 2.95Å
7V97.7Very high96.1Very high88 Ų8895 Ų9553%0.53348%0.476SS..Hα-helixtrans-61.4-45.6-179.51710000111.6F3 M4 N9F3-V7 HydrophobicContact CD1-CG2 4.33Å; F3-V7 HydrophobicContact CE1-CG2 3.99Å; F3-V7 HydrophobicContact CE2-CG2 4.24Å; F3-V7 HydrophobicContact CZ-CG2 3.94Å; F3-V7 WeakPolarHBondContact O-CG2 3.31Å; F3-V7 PolarHBondContact O-N 3.26Å; M4-V7 PolarHBondContact O-N 3.01Å; V7-N9 VanDerWaalsContact C-N 3.26Å; V7-N9 PolarHBondContact O-N 3.49Å
8E96.4Very high96.1Very high114 Ų11492.1 Ų92.153%0.53346%0.462SS..THydrogen-bonded Turntrans-81-3.4-179.1-64-64.1149.200113.3M4 E10 M15M4-E8 WeakPolarHBondContact O-CB 3.42Å; M4-E8 WeakPolarHBondContact O-CG 3.39Å; M4-E8 PolarHBondContact O-N 3.34Å; E8-E10 HydrophobicContact CB-CB 4.26Å; E8-E10 HydrophobicContact CB-CG 4.16Å; E8-E10 PolarHBondContact O-N 3.39Å; E8-M15 HydrophobicContact CB-CE 4.32Å; E8-M15 HydrophobicContact CB-SD 3.87Å; E8-M15 HydrophobicContact CG-CE 3.78Å; E8-M15 HydrophobicContact CG-SD 4Å
9N96.8Very high96.1Very high149 Ų14991.6 Ų91.680%0.79746%0.456SS*.THydrogen-bonded Turntrans52.142.4-172.2-170.542.4000112.8A5 V6 V7A5-N9 PolarHBondContact O-N 3.25Å; V6-N9 PolarHBondContact O-N 2.95Å; V7-N9 VanDerWaalsContact C-N 3.26Å; V7-N9 PolarHBondContact O-N 3.49Å
10E96.8Very high96.1Very high57 Ų5792.9 Ų92.927%0.26646%0.464SS..  trans-123.1151.6-175.9-76.9-69.5-167.300111.1A5 E8 R14 M15A5-E10 CarbonylContact C-O 3.57Å; A5-E10 WeakPolarHBondContact CB-O 3.44Å; A5-E10 PolarHBondContact O-N 3.16Å; E8-E10 HydrophobicContact CB-CB 4.26Å; E8-E10 HydrophobicContact CB-CG 4.16Å; E8-E10 PolarHBondContact O-N 3.39Å; E10-R14 IonicContact OE1-CZ 2.68Å; E10-R14 IonicContact OE1-NE 2.71Å; E10-R14 PolarHBondContact OE1-NE 3.28Å; E10-R14 IonicContact OE1-NH2 2.75Å; E10-R14 PolarHBondContact OE1-NH2 2.71Å; E10-R14 WeakPolarHBondContact OE2-CD 3.36Å; E10-R14 WeakPolarHBondContact OE2-CG 2.96Å; E10-R14 IonicContact OE2-CZ 3.01Å; E10-R14 IonicContact OE2-NE 2.89Å; E10-R14 PolarHBondContact OE2-NE 3.43Å; E10-M15 HydrophobicContact CB-CG 3.86Å; E10-M15 HydrophobicContact CB-SD 3.78Å; E10-M15 HydrophobicContact CG-SD 4.26Å
11T97.4Very high96.1Very high89 Ų8993.3 Ų93.355%0.54647%0.465SS..  trans-65.3150.1175.9690000110.6A13 R14 M15T11-A13 PolarHBondContact O-N 3.42Å; T11-A13 VanDerWaalsContact O-N 3.12Å; T11-R14 PolarHBondContact O-N 3.28Å; T11-R14 WeakPolarHBondContact OG1-CB 3.33Å; T11-R14 PolarHBondContact OG1-N 3.33Å; T11-R14 VanDerWaalsContact OG1-N 3.12Å; T11-M15 PolarHBondContact O-N 3.12Å
12R96.7Very high96.6Very high133 Ų13397.7 Ų97.750%0.50248%0.476SS..Hα-helixtrans-55.7-32.7175.2-66.6177.267.9-175.93.3112.3A5 R16A5-R12 HydrophobicContact CB-CG 3.94Å; R12-R16 VanDerWaalsContact O-CG 3.28Å; R12-R16 WeakPolarHBondContact O-CG 3.4Å; R12-R16 PolarHBondContact O-N 2.96Å
13A97.4Very high96.7Very high69 Ų69101.5 Ų101.557%0.5749%0.489SS*.Hα-helixtrans-69.5-42.8176.400000111.8T11 R16 F17T11-A13 PolarHBondContact O-N 3.42Å; T11-A13 VanDerWaalsContact O-N 3.12Å; A13-R16 WeakPolarHBondContact O-CB 3.43Å; A13-R16 PolarHBondContact O-N 2.91Å; A13-F17 PolarHBondContact O-N 3.12Å
14R97.1Very high96.6Very high136 Ų136101.5 Ų101.551%0.51349%0.494SS..Hα-helixtrans-65.6-43.8176.7179144.1156.4145.6-8.2112.4E10 T11 R16 F17 I18E10-R14 IonicContact OE1-CZ 2.68Å; E10-R14 IonicContact OE1-NE 2.71Å; E10-R14 PolarHBondContact OE1-NE 3.28Å; E10-R14 IonicContact OE1-NH2 2.75Å; E10-R14 PolarHBondContact OE1-NH2 2.71Å; E10-R14 WeakPolarHBondContact OE2-CD 3.36Å; E10-R14 WeakPolarHBondContact OE2-CG 2.96Å; E10-R14 IonicContact OE2-CZ 3.01Å; E10-R14 IonicContact OE2-NE 2.89Å; E10-R14 PolarHBondContact OE2-NE 3.43Å; T11-R14 PolarHBondContact O-N 3.28Å; T11-R14 WeakPolarHBondContact OG1-CB 3.33Å; T11-R14 PolarHBondContact OG1-N 3.33Å; T11-R14 VanDerWaalsContact OG1-N 3.12Å; R14-R16 VanDerWaalsContact C-N 3.28Å; R14-R16 PolarHBondContact O-N 3.23Å; R14-F17 WeakPolarHBondContact O-CB 3.36Å; R14-F17 PolarHBondContact O-N 3.38Å; R14-F17 VanDerWaalsContact O-N 3.12Å; R14-I18 HydrophobicContact CG-CD1 3.9Å; R14-I18 HydrophobicContact CG-CG1 4.46Å; R14-I18 WeakPolarHBondContact O-CG1 3.48Å; R14-I18 PolarHBondContact O-N 2.89Å
15M97.3Very high96.4Very high9 Ų9101.9 Ų101.94%0.04450%0.495CS..Hα-helixtrans-60.8-36.7174.4-71.9-52.3-67.600112.9M4 A5 E8 E10 T11 I18 F19M4-M15 HydrophobicContact CB-CE 4.08Å; A5-M15 HydrophobicContact CB-CG 4.06Å; E8-M15 HydrophobicContact CB-CE 4.32Å; E8-M15 HydrophobicContact CB-SD 3.87Å; E8-M15 HydrophobicContact CG-CE 3.78Å; E8-M15 HydrophobicContact CG-SD 4Å; E10-M15 HydrophobicContact CB-CG 3.86Å; E10-M15 HydrophobicContact CB-SD 3.78Å; E10-M15 HydrophobicContact CG-SD 4.26Å; T11-M15 PolarHBondContact O-N 3.12Å; M15-I18 HydrophobicContact SD-CD1 4.18Å; M15-F19 HydrophobicContact CE-CD1 4.42Å; M15-F19 HydrophobicContact CE-CE1 3.5Å; M15-F19 VanDerWaalsContact CE-CE1 3.5Å; M15-F19 HydrophobicContact CE-CE2 4.46Å; M15-F19 HydrophobicContact CE-CZ 3.51Å; M15-F19 WeakPolarHBondContact O-CB 3.32Å; M15-F19 VanDerWaalsContact O-CG 3.26Å; M15-F19 WeakPolarHBondContact O-CG 3.38Å; M15-F19 PolarHBondContact O-N 3.31Å
16R96.6Very high96.4Very high130 Ų130106.6 Ų106.649%0.49153%0.525SS..Hα-helixtrans-61-48.4172.1-76.6170174.4174.3-4.4111.8M1 R12 A13 R14 I18 F19 L20M1-R16 HydrophobicContact CE-CB 4.08Å; M1-R16 HydrophobicContact CE-CG 3.38Å; M1-R16 HydrophobicContact SD-CB 4.44Å; M1-R16 HydrophobicContact SD-CG 3.22Å; M1-R16 WeakPolarHBondContact SD-CG 3.22Å; R12-R16 VanDerWaalsContact O-CG 3.28Å; R12-R16 WeakPolarHBondContact O-CG 3.4Å; R12-R16 PolarHBondContact O-N 2.96Å; A13-R16 WeakPolarHBondContact O-CB 3.43Å; A13-R16 PolarHBondContact O-N 2.91Å; R14-R16 VanDerWaalsContact C-N 3.28Å; R14-R16 PolarHBondContact O-N 3.23Å; R16-I18 PolarHBondContact O-N 3.03Å; R16-F19 PolarHBondContact O-N 2.99Å; R16-L20 VanDerWaalsContact O-CG 3.32Å; R16-L20 WeakPolarHBondContact O-CG 3.28Å; R16-L20 PolarHBondContact O-N 2.97Å
17F97.1Very high96.3Very high121 Ų121106.9 Ų106.953%0.53153%0.531SS..Hα-helixtrans-58.8-48.1179.1-179.6-104.1000111.3A13 R14 F19 L20 Q21A13-F17 PolarHBondContact O-N 3.12Å; R14-F17 WeakPolarHBondContact O-CB 3.36Å; R14-F17 PolarHBondContact O-N 3.38Å; R14-F17 VanDerWaalsContact O-N 3.12Å; F17-F19 PolarHBondContact O-N 3.33Å; F17-L20 PolarHBondContact O-N 3.49Å; F17-Q21 HydrophobicContact CD1-CG 4.43Å; F17-Q21 VanDerWaalsContact CD1-OE1 3.29Å; F17-Q21 HydrophobicContact CE1-CG 4.11Å; F17-Q21 HydrophobicContact CE2-CG 4.39Å; F17-Q21 HydrophobicContact CZ-CG 4.08Å; F17-Q21 WeakPolarHBondContact O-CG 3.38Å; F17-Q21 PolarHBondContact O-N 3.24Å
18I95.8Very high96Very high43 Ų43104.1 Ų104.122%0.22152%0.521CS..Hα-helixtrans-58.4-47.8177.1-67.4165.7000110.9R14 M15 R16 L20 Q21 R22R14-I18 HydrophobicContact CG-CD1 3.9Å; R14-I18 HydrophobicContact CG-CG1 4.46Å; R14-I18 WeakPolarHBondContact O-CG1 3.48Å; R14-I18 PolarHBondContact O-N 2.89Å; M15-I18 HydrophobicContact SD-CD1 4.18Å; R16-I18 PolarHBondContact O-N 3.03Å; I18-L20 PolarHBondContact O-N 3.31Å; I18-Q21 PolarHBondContact O-N 3.2Å; I18-R22 HydrophobicContact CG2-CG 4.46Å; I18-R22 VanDerWaalsContact O-CG 3.31Å; I18-R22 WeakPolarHBondContact O-CG 3.26Å; I18-R22 PolarHBondContact O-N 2.94Å
19F95.5Very high95.7Very high82 Ų82103.6 Ų103.636%0.3653%0.527SS..Hα-helixtrans-64.1-41.1-179.6-69.1-8.2000112.3M1 M4 M15 R16 F17 Q21 R22 M23M1-F19 HydrophobicContact CE-CB 4.45Å; M1-F19 HydrophobicContact CE-CD2 3.29Å; M1-F19 HydrophobicContact CE-CE2 3.83Å; M1-F19 HydrophobicContact CE-CG 4.23Å; M1-F19 HydrophobicContact CG-CE2 4.35Å; M4-F19 HydrophobicContact CB-CZ 4.18Å; M4-F19 HydrophobicContact CG-CZ 4.2Å; M15-F19 HydrophobicContact CE-CD1 4.42Å; M15-F19 HydrophobicContact CE-CE1 3.5Å; M15-F19 VanDerWaalsContact CE-CE1 3.5Å; M15-F19 HydrophobicContact CE-CE2 4.46Å; M15-F19 HydrophobicContact CE-CZ 3.51Å; M15-F19 WeakPolarHBondContact O-CB 3.32Å; M15-F19 VanDerWaalsContact O-CG 3.26Å; M15-F19 WeakPolarHBondContact O-CG 3.38Å; M15-F19 PolarHBondContact O-N 3.31Å; R16-F19 PolarHBondContact O-N 2.99Å; F17-F19 PolarHBondContact O-N 3.33Å; F19-Q21 VanDerWaalsContact C-N 3.35Å; F19-Q21 PolarHBondContact O-N 3.25Å; F19-R22 PolarHBondContact O-N 2.95Å; F19-M23 WeakPolarHBondContact O-CG 3.38Å; F19-M23 PolarHBondContact O-N 3.02Å
20L96.5Very high95.4Very high117 Ų117101.5 Ų101.561%0.61352%0.522SS*.Hα-helixtrans-61.4-42.9174.7-71.3171.7000111.7R16 F17 I18 R22 M23R16-L20 VanDerWaalsContact O-CG 3.32Å; R16-L20 WeakPolarHBondContact O-CG 3.28Å; R16-L20 PolarHBondContact O-N 2.97Å; F17-L20 PolarHBondContact O-N 3.49Å; I18-L20 PolarHBondContact O-N 3.31Å; L20-R22 VanDerWaalsContact C-N 3.29Å; L20-R22 PolarHBondContact O-N 3.33Å; L20-M23 HydrophobicContact CD2-SD 4.18Å; L20-M23 WeakPolarHBondContact O-CB 3.39Å; L20-M23 PolarHBondContact O-N 3.41Å; L20-M23 VanDerWaalsContact O-N 3.16Å
21Q96.6Very high95.1Very high103 Ų103104.3 Ų104.348%0.48155%0.545SS..Hα-helixtrans-61.7-38176.2-72.4-175.3-67.500112.3F17 I18 F19 M23 I24F17-Q21 HydrophobicContact CD1-CG 4.43Å; F17-Q21 VanDerWaalsContact CD1-OE1 3.29Å; F17-Q21 HydrophobicContact CE1-CG 4.11Å; F17-Q21 HydrophobicContact CE2-CG 4.39Å; F17-Q21 HydrophobicContact CZ-CG 4.08Å; F17-Q21 WeakPolarHBondContact O-CG 3.38Å; F17-Q21 PolarHBondContact O-N 3.24Å; I18-Q21 PolarHBondContact O-N 3.2Å; F19-Q21 VanDerWaalsContact C-N 3.35Å; F19-Q21 PolarHBondContact O-N 3.25Å; Q21-M23 PolarHBondContact O-N 3.12Å; Q21-I24 PolarHBondContact O-N 3.45Å
22R95.4Very high94.6Very high184 Ų184107.6 Ų107.669%0.69455%0.554SS**Hα-helixtrans-70.7-11.5178.4-66.4-68179.593.41.5113.8I18 F19 L20 I24 P26I18-R22 HydrophobicContact CG2-CG 4.46Å; I18-R22 VanDerWaalsContact O-CG 3.31Å; I18-R22 WeakPolarHBondContact O-CG 3.26Å; I18-R22 PolarHBondContact O-N 2.94Å; F19-R22 PolarHBondContact O-N 2.95Å; L20-R22 VanDerWaalsContact C-N 3.29Å; L20-R22 PolarHBondContact O-N 3.33Å; R22-I24 VanDerWaalsContact C-N 3.34Å; R22-P26 WeakPolarHBondContact O-CA 3.35Å
23M96.3Very high94Very high140 Ų140108.9 Ų108.969%0.6956%0.559SS**THydrogen-bonded Turntrans-77-17176.6-65-179.67700113.8F19 L20 Q21 Q25F19-M23 WeakPolarHBondContact O-CG 3.38Å; F19-M23 PolarHBondContact O-N 3.02Å; L20-M23 HydrophobicContact CD2-SD 4.18Å; L20-M23 WeakPolarHBondContact O-CB 3.39Å; L20-M23 PolarHBondContact O-N 3.41Å; L20-M23 VanDerWaalsContact O-N 3.16Å; Q21-M23 PolarHBondContact O-N 3.12Å; M23-Q25 VanDerWaalsContact C-N 3.28Å; M23-Q25 PolarHBondContact O-N 2.97Å
24I94.2Very high93.2Very high152 Ų152110.6 Ų110.678%0.77956%0.564SS**SBendtrans-57.9-45.3179.2-65.3169000110.3Q21 R22Q21-I24 PolarHBondContact O-N 3.45Å; R22-I24 VanDerWaalsContact C-N 3.34Å
25Q93.2Very high92.1Very high96 Ų96110.2 Ų110.245%0.44957%0.572SS.*  trans-157.477.6-178.6-167.1175.671.100110.3M23 C27 G28 P29M23-Q25 VanDerWaalsContact C-N 3.28Å; M23-Q25 PolarHBondContact O-N 2.97Å; Q25-C27 PolarHBondContact O-N 3.39Å; Q25-G28 WeakPolarHBondContact CG-O 3.46Å; Q25-G28 PolarHBondContact O-N 3.18Å; Q25-P29 VanDerWaalsContact CD-CA 3.46Å; Q25-P29 VanDerWaalsContact CD-N 3.27Å; Q25-P29 VanDerWaalsContact NE2-CA 3.34Å
26P95.9Very high90.7Very high106 Ų106114.6 Ų114.669%0.68859%0.593SS**THydrogen-bonded Turntrans-65.9-26.3-17225.6-34.7000113.4R22R22-P26 WeakPolarHBondContact O-CA 3.35Å
27C94.9Very high89.2Confident126 Ų126113 Ų11385%0.85160%0.598SS**THydrogen-bonded Turntrans-103.36-176.9-54.80000113.9Q25Q25-C27 PolarHBondContact O-N 3.39Å
28G91.5Very high87.1Confident31 Ų31115 Ų11532%0.3261%0.609SS.*  trans79179.7-171.700000114Q25Q25-G28 WeakPolarHBondContact CG-O 3.46Å; Q25-G28 PolarHBondContact O-N 3.18Å
29P91.1Very high84.8Confident103 Ų103122.6 Ų122.667%0.66966%0.657SS**SBendtrans-58.6145.7-177.823.4-32.6000111.4Q25Q25-P29 VanDerWaalsContact CD-CA 3.46Å; Q25-P29 VanDerWaalsContact CD-N 3.27Å; Q25-P29 VanDerWaalsContact NE2-CA 3.34Å
30P90.1Very high84.2Confident104 Ų104124.6 Ų124.668%0.67567%0.672SS**PPolyproline II helixtrans-58.9151.5172.828.2-34.2000109.7
31P90.2Very high83.6Confident117 Ų117125 Ų12576%0.7668%0.675SS**PPolyproline II helixtrans-58.6146.9170.827.6-34.4000110R33P31-R33 PolarHBondContact O-N 2.94Å
32E87.9Confident82.9Confident158 Ų158126.2 Ų126.274%0.73869%0.686SS**PPolyproline II helixtrans-56128.5174.4-66174.8-179.900109.3
33R83.7Confident82.1Confident160 Ų160122.8 Ų122.860%0.60469%0.685SS**PPolyproline II helixtrans-69143.7174.3-68.3-178.4-97.2-174.8-2108.5P31 D35 E36P31-R33 PolarHBondContact O-N 2.94Å; R33-D35 PolarHBondContact O-N 3.38Å; R33-E36 HydrophobicContact CB-CB 4.33Å; R33-E36 HydrophobicContact CB-CG 3.86Å; R33-E36 WeakPolarHBondContact CB-OE2 3.35Å; R33-E36 IonicContact CZ-OE1 3.48Å; R33-E36 PolarHBondContact N-OE2 3.47Å; R33-E36 VanDerWaalsContact N-OE2 3.08Å; R33-E36 VanDerWaalsContact NE-CD 3.27Å; R33-E36 IonicContact NE-OE1 3.14Å; R33-E36 PolarHBondContact NE-OE1 3.08Å; R33-E36 IonicContact NE-OE2 2.81Å; R33-E36 PolarHBondContact NE-OE2 3.47Å; R33-E36 IonicContact NH2-OE1 3.83Å; R33-E36 PolarHBondContact NH2-OE1 3.48Å; R33-E36 PolarHBondContact O-N 3.24Å
34P80Confident81.2Confident104 Ų104121.8 Ų121.868%0.67569%0.685SS**THydrogen-bonded Turntrans-56.9-22.8178.223.5-33.2000112.5
35D74.3Confident80.4Confident129 Ų129119.7 Ų119.769%0.6968%0.679SS**THydrogen-bonded Turntrans-90.2-6179.9-43.5-50.8000113.9R33R33-D35 PolarHBondContact O-N 3.38Å
36E67.5Low79.5Confident100 Ų100121.4 Ų121.447%0.46770%0.695SS.*SBendtrans-95.5-4.4-176.8-72.5173.5157.800113.4R33R33-E36 HydrophobicContact CB-CB 4.33Å; R33-E36 HydrophobicContact CB-CG 3.86Å; R33-E36 WeakPolarHBondContact CB-OE2 3.35Å; R33-E36 IonicContact CZ-OE1 3.48Å; R33-E36 PolarHBondContact N-OE2 3.47Å; R33-E36 VanDerWaalsContact N-OE2 3.08Å; R33-E36 VanDerWaalsContact NE-CD 3.27Å; R33-E36 IonicContact NE-OE1 3.14Å; R33-E36 PolarHBondContact NE-OE1 3.08Å; R33-E36 IonicContact NE-OE2 2.81Å; R33-E36 PolarHBondContact NE-OE2 3.47Å; R33-E36 IonicContact NH2-OE1 3.83Å; R33-E36 PolarHBondContact NH2-OE1 3.48Å; R33-E36 PolarHBondContact O-N 3.24Å
37T65.3Low78.2Confident97 Ų97122.6 Ų122.660%0.59570%0.696SS**SBendtrans-102.30.517239.50000113.3
38E53.6Low76.8Confident164 Ų164122.3 Ų122.377%0.76668%0.683SS**  trans-140.159.5178-62.1-170.4165.100112.8
39T46.3Very low75.5Confident201 Ų201130.6 Ų130.6100%1.23372%0.716SS**  trans-175.30151.1-67.40000109.3

Retrieved 39 of 39 residues in 18.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).