A0A077ZMF8_TRITR Loading...

Remark: the protein is only the half of the lengt h of PTH11

AlphaFold DB , UniProt , Accession A0A077ZMF8, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 138 aa.

						>A0A077ZMF8_TRITR|A0A077ZMF8
MRAMRISKGTLHTWKQLAILRWRLVLSGWVQPEDDVQDGIERISGPYTPPPHELRQVERERTSVRSATKLVAPSHLGPQRFDGLRVRTCRSVHEVPGVVHSGMVVTLVAETVVGAPFVRDLCGGRLDVGPYNAHQRSA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	42.9	Very low	43.9	Very low	248 Å²	248	144.5 Å²	144.5	100%	1.222	73%	0.725	S	S	*	*				0	111.7	0	-69.7	172.3	-178.7	0	0	108.5
2	R	39	Very low	44.8	Very low	257 Å²	257	141.8 Å²	141.8	97%	0.97	71%	0.708	S	S	*	*			trans	-96.9	104.4	-175	-146.7	178	-164.8	-175.9	4	108.2	M4	R2-M4 PolarHBondContact O-N 3.49Å
3	A	40.6	Very low	45.7	Very low	92 Å²	92	136.5 Å²	136.5	76%	0.76	69%	0.688	S	S	*	*			trans	-65.8	114.2	176.6	0	0	0	0	0	109.5	R5	A3-R5 PolarHBondContact O-N 2.83Å
4	M	34.3	Very low	45.8	Very low	173 Å²	173	139.4 Å²	139.4	85%	0.852	69%	0.687	S	S	*	*			trans	-69.2	99.7	175.5	-172.4	157.1	155.9	0	0	108.1	R2 I6	R2-M4 PolarHBondContact O-N 3.49Å; M4-I6 PolarHBondContact O-N 3.29Å
5	R	41.3	Very low	46.7	Very low	240 Å²	240	138.5 Å²	138.5	91%	0.906	68%	0.677	S	S	*	*			trans	-68	95.4	174.4	-69.9	-175.1	-161.1	162	4.6	108.2	A3 S7	A3-R5 PolarHBondContact O-N 2.83Å; R5-S7 PolarHBondContact O-N 2.86Å; R5-S7 VanDerWaalsContact O-N 3.15Å
6	I	44.9	Very low	47.8	Very low	108 Å²	108	133.8 Å²	133.8	55%	0.554	65%	0.654	S	S	*	*			trans	-66.2	113.8	168.1	-57.3	172.7	0	0	0	106.2	M4 L11	M4-I6 PolarHBondContact O-N 3.29Å; I6-L11 HydrophobicContact CG2-CD1 4.16Å
7	S	44.7	Very low	48.6	Very low	78 Å²	78	132.5 Å²	132.5	55%	0.545	65%	0.65	S	S	.	*			trans	-56.8	141.5	179.7	-179.5	0	0	0	0	110.2	R5 G9 T10 L11	R5-S7 PolarHBondContact O-N 2.86Å; R5-S7 VanDerWaalsContact O-N 3.15Å; S7-G9 PolarHBondContact O-N 3.29Å; S7-T10 PolarHBondContact O-N 3.47Å; S7-T10 PolarHBondContact O-OG1 3.36Å; S7-L11 PolarHBondContact O-N 2.99Å
8	K	53.3	Low	49.3	Very low	197 Å²	197	128.4 Å²	128.4	86%	0.857	64%	0.641	S	S	*	*	H	α-helix	trans	-52.7	-29.5	175.9	-73	179	177.8	176.2	0	112.2	L11 H12	K8-L11 PolarHBondContact O-N 3.39Å; K8-H12 PolarHBondContact O-N 3Å
9	G	44.9	Very low	50.2	Low	45 Å²	45	126.8 Å²	126.8	46%	0.464	63%	0.633	S	S	.	*	H	α-helix	trans	-62	-42.5	176.2	0	0	0	0	0	113.1	S7 H12 T13	S7-G9 PolarHBondContact O-N 3.29Å; G9-H12 PolarHBondContact O-N 3.32Å; G9-T13 PolarHBondContact O-N 2.77Å
10	T	48.2	Very low	51	Low	59 Å²	59	125 Å²	125	36%	0.362	63%	0.625	S	S	.	*	H	α-helix	trans	-66.6	-42.2	177	7.1	0	0	0	0	110.8	S7 H12 T13 W14	S7-T10 PolarHBondContact O-N 3.47Å; S7-T10 PolarHBondContact O-OG1 3.36Å; T10-H12 PolarHBondContact O-N 3.06Å; T10-T13 PolarHBondContact O-N 2.84Å; T10-T13 VanDerWaalsContact O-N 3.1Å; T10-T13 PolarHBondContact O-OG1 2.99Å; T10-W14 PolarHBondContact O-N 3.15Å
11	L	49	Very low	51.3	Low	92 Å²	92	125.7 Å²	125.7	48%	0.482	62%	0.62	S	S	.	*	H	α-helix	trans	-60	-32.9	178.4	-119.2	117	0	0	0	112.8	I6 S7 K8 K15	I6-L11 HydrophobicContact CG2-CD1 4.16Å; S7-L11 PolarHBondContact O-N 2.99Å; K8-L11 PolarHBondContact O-N 3.39Å; L11-K15 WeakPolarHBondContact O-CG 3.2Å; L11-K15 PolarHBondContact O-N 3.46Å
12	H	54.1	Low	52.1	Low	113 Å²	113	122.2 Å²	122.2	52%	0.523	59%	0.594	S	S	.	*	H	α-helix	trans	-68.8	-43.1	175.3	-165.7	63.1	0	0	0	111.8	K8 G9 T10 K15 Q16	K8-H12 PolarHBondContact O-N 3Å; G9-H12 PolarHBondContact O-N 3.32Å; T10-H12 PolarHBondContact O-N 3.06Å; H12-K15 PolarHBondContact O-N 2.68Å; H12-Q16 PolarHBondContact NE2-NE2 3.04Å; H12-Q16 WeakPolarHBondContact O-CG 3.21Å; H12-Q16 PolarHBondContact O-N 2.95Å
13	T	56.6	Low	53.1	Low	73 Å²	73	117 Å²	117	45%	0.448	57%	0.574	S	S	.	*	H	α-helix	trans	-65.3	-41.7	179	57	0	0	0	0	111.9	G9 T10 K15 Q16 L17	G9-T13 PolarHBondContact O-N 2.77Å; T10-T13 PolarHBondContact O-N 2.84Å; T10-T13 VanDerWaalsContact O-N 3.1Å; T10-T13 PolarHBondContact O-OG1 2.99Å; T13-K15 VanDerWaalsContact C-N 3.34Å; T13-K15 PolarHBondContact O-N 3.14Å; T13-Q16 PolarHBondContact O-N 3.19Å; T13-L17 PolarHBondContact O-N 3.4Å
14	W	47	Very low	53.8	Low	177 Å²	177	115.2 Å²	115.2	67%	0.67	55%	0.552	S	S	*	*	H	α-helix	trans	-61.1	-40.6	175.5	-71.7	104.2	0	0	0	112.4	T10 L17 A18	T10-W14 PolarHBondContact O-N 3.15Å; W14-L17 PolarHBondContact O-N 2.82Å; W14-A18 WeakPolarHBondContact O-CB 3.15Å; W14-A18 PolarHBondContact O-N 3.11Å
15	K	60	Low	54.7	Low	126 Å²	126	109 Å²	109	55%	0.548	52%	0.524	S	S	.	.	H	α-helix	trans	-64.6	-42.9	175.8	-77	-177.1	177.8	-174.9	0	112.1	L11 H12 T13 L17 A18 I19	L11-K15 WeakPolarHBondContact O-CG 3.2Å; L11-K15 PolarHBondContact O-N 3.46Å; H12-K15 PolarHBondContact O-N 2.68Å; T13-K15 VanDerWaalsContact C-N 3.34Å; T13-K15 PolarHBondContact O-N 3.14Å; K15-L17 VanDerWaalsContact C-N 3.33Å; K15-A18 PolarHBondContact O-N 2.78Å; K15-I19 VanDerWaalsContact O-CG1 3.3Å; K15-I19 WeakPolarHBondContact O-CG1 3.48Å; K15-I19 PolarHBondContact O-N 3.36Å
16	Q	64.6	Low	55.5	Low	63 Å²	63	103.3 Å²	103.3	29%	0.294	51%	0.51	S	S	.	.	H	α-helix	trans	-63.5	-41.6	176.4	-72.8	-170.9	-22.7	0	0	111.5	H12 T13 A18 I19 L20	H12-Q16 PolarHBondContact NE2-NE2 3.04Å; H12-Q16 WeakPolarHBondContact O-CG 3.21Å; H12-Q16 PolarHBondContact O-N 2.95Å; T13-Q16 PolarHBondContact O-N 3.19Å; Q16-A18 VanDerWaalsContact C-N 3.34Å; Q16-A18 PolarHBondContact O-N 3.42Å; Q16-I19 PolarHBondContact O-N 3.47Å; Q16-L20 WeakPolarHBondContact O-CB 3.39Å; Q16-L20 PolarHBondContact O-N 2.95Å
17	L	61.6	Low	56.2	Low	112 Å²	112	101.8 Å²	101.8	59%	0.586	51%	0.509	S	S	*	.	H	α-helix	trans	-62.1	-42.5	176.5	-139.2	97.9	0	0	0	111.5	T13 W14 K15 L20 R21	T13-L17 PolarHBondContact O-N 3.4Å; W14-L17 PolarHBondContact O-N 2.82Å; K15-L17 VanDerWaalsContact C-N 3.33Å; L17-L20 PolarHBondContact O-N 3.23Å; L17-R21 WeakPolarHBondContact O-CB 3.35Å; L17-R21 PolarHBondContact O-N 3.5Å
18	A	60.9	Low	56.2	Low	59 Å²	59	101 Å²	101	49%	0.488	51%	0.513	S	S	.	.	H	α-helix	trans	-63.7	-41.5	177.2	0	0	0	0	0	112.1	W14 K15 Q16 R21 W22	W14-A18 WeakPolarHBondContact O-CB 3.15Å; W14-A18 PolarHBondContact O-N 3.11Å; K15-A18 PolarHBondContact O-N 2.78Å; Q16-A18 VanDerWaalsContact C-N 3.34Å; Q16-A18 PolarHBondContact O-N 3.42Å; A18-R21 PolarHBondContact O-N 2.91Å; A18-W22 WeakPolarHBondContact O-CB 3.45Å; A18-W22 PolarHBondContact O-N 3.34Å
19	I	66	Low	55.8	Low	98 Å²	98	101 Å²	101	50%	0.503	51%	0.508	S	S	.	.	H	α-helix	trans	-66.2	-42.6	176.3	-66.3	165.4	0	0	0	110.7	K15 Q16 W22 R23	K15-I19 VanDerWaalsContact O-CG1 3.3Å; K15-I19 WeakPolarHBondContact O-CG1 3.48Å; K15-I19 PolarHBondContact O-N 3.36Å; Q16-I19 PolarHBondContact O-N 3.47Å; I19-W22 PolarHBondContact O-N 3.04Å; I19-R23 WeakPolarHBondContact O-CB 3.38Å; I19-R23 WeakPolarHBondContact O-CG 3.42Å; I19-R23 PolarHBondContact O-N 3.46Å
20	L	65.7	Low	55.6	Low	90 Å²	90	101 Å²	101	47%	0.471	50%	0.499	S	S	.	.	H	α-helix	trans	-61.1	-46.6	175.6	-86.9	154.7	0	0	0	111.3	Q16 L17 R23 L24	Q16-L20 WeakPolarHBondContact O-CB 3.39Å; Q16-L20 PolarHBondContact O-N 2.95Å; L17-L20 PolarHBondContact O-N 3.23Å; L20-R23 PolarHBondContact O-N 3.41Å; L20-L24 WeakPolarHBondContact O-CB 3.49Å; L20-L24 PolarHBondContact O-N 3.33Å
21	R	57.4	Low	55.5	Low	139 Å²	139	103.7 Å²	103.7	53%	0.525	51%	0.507	S	S	.	.	H	α-helix	trans	-59.6	-49.6	176.5	-173.5	178.3	-178.3	-157.5	-1.9	111.3	L17 A18 R23 L24 V25 D35	L17-R21 WeakPolarHBondContact O-CB 3.35Å; L17-R21 PolarHBondContact O-N 3.5Å; A18-R21 PolarHBondContact O-N 2.91Å; R21-R23 VanDerWaalsContact C-N 3.28Å; R21-R23 PolarHBondContact O-N 2.98Å; R21-L24 PolarHBondContact O-N 3.28Å; R21-V25 WeakPolarHBondContact O-CG2 3.49Å; R21-V25 PolarHBondContact O-N 2.95Å; R21-D35 IonicContact CZ-OD2 3.78Å; R21-D35 VanDerWaalsContact CZ-OD2 3.25Å; R21-D35 IonicContact NE-OD2 2.68Å; R21-D35 PolarHBondContact NE-OD2 3.21Å; R21-D35 VanDerWaalsContact NE-OD2 3.14Å; R21-D35 IonicContact NH2-OD1 3.14Å; R21-D35 IonicContact NH2-OD2 3.25Å; R21-D35 PolarHBondContact NH2-OD2 2.88Å
22	W	60.9	Low	55.5	Low	175 Å²	175	103.6 Å²	103.6	66%	0.663	51%	0.513	S	S	*	.	H	α-helix	trans	-58.8	-40.3	177.2	-176.2	-105.5	0	0	0	112.1	A18 I19 L26	A18-W22 WeakPolarHBondContact O-CB 3.45Å; A18-W22 PolarHBondContact O-N 3.34Å; I19-W22 PolarHBondContact O-N 3.04Å; W22-L26 VanDerWaalsContact CD1-CD1 3.48Å; W22-L26 HydrophobicContact CG-CD1 4.3Å; W22-L26 HydrophobicContact CZ2-CD1 4.49Å; W22-L26 WeakPolarHBondContact O-CB 3.3Å; W22-L26 WeakPolarHBondContact O-CG 3.35Å; W22-L26 PolarHBondContact O-N 3.47Å
23	R	58.8	Low	54.9	Low	147 Å²	147	105.6 Å²	105.6	56%	0.555	52%	0.522	S	S	*	.	H	α-helix	trans	-68.1	-39.4	176.3	-77.7	-177.4	-178.5	-160.8	0.6	113.4	I19 L20 R21 L26 S27	I19-R23 WeakPolarHBondContact O-CB 3.38Å; I19-R23 WeakPolarHBondContact O-CG 3.42Å; I19-R23 PolarHBondContact O-N 3.46Å; L20-R23 PolarHBondContact O-N 3.41Å; R21-R23 VanDerWaalsContact C-N 3.28Å; R21-R23 PolarHBondContact O-N 2.98Å; R23-L26 PolarHBondContact O-N 3.38Å; R23-S27 VanDerWaalsContact O-CB 3.26Å; R23-S27 WeakPolarHBondContact O-CB 3.34Å; R23-S27 PolarHBondContact O-N 2.84Å; R23-S27 PolarHBondContact O-OG 3.02Å
24	L	56	Low	54.3	Low	55 Å²	55	107.6 Å²	107.6	29%	0.288	53%	0.53	S	S	.	.	H	α-helix	trans	-62.8	-43.6	175.3	-83.5	156.1	0	0	0	111.4	L20 R21 S27 G28 W29 V30 M103	L20-L24 WeakPolarHBondContact O-CB 3.49Å; L20-L24 PolarHBondContact O-N 3.33Å; R21-L24 PolarHBondContact O-N 3.28Å; L24-S27 PolarHBondContact O-N 3.47Å; L24-G28 PolarHBondContact O-N 3.34Å; L24-W29 HydrophobicContact CD2-CB 3.88Å; L24-W29 PolarHBondContact O-N 3.15Å; L24-V30 HydrophobicContact CB-CB 4.37Å; L24-V30 HydrophobicContact CB-CG2 3.91Å; L24-V30 HydrophobicContact CD2-CG2 4.37Å; L24-V30 PolarHBondContact O-N 3.37Å; L24-M103 HydrophobicContact CD2-CE 4.28Å
25	V	52.5	Low	53.9	Low	44 Å²	44	103 Å²	103	27%	0.267	52%	0.518	S	S	.	.	H	α-helix	trans	-64.6	-47.9	175.8	175	0	0	0	0	111.2	R21 S27 G28 V30	R21-V25 WeakPolarHBondContact O-CG2 3.49Å; R21-V25 PolarHBondContact O-N 2.95Å; V25-S27 PolarHBondContact O-N 3.35Å; V25-G28 PolarHBondContact O-N 3.1Å; V25-V30 WeakPolarHBondContact CA-O 3.43Å; V25-V30 HydrophobicContact CG2-CB 4.24Å; V25-V30 HydrophobicContact CG2-CG1 4.22Å
26	L	58.8	Low	53.1	Low	120 Å²	120	101.8 Å²	101.8	63%	0.628	52%	0.521	S	S	*	.	H	α-helix	trans	-61.1	-32.4	177.2	-86.8	169.3	0	0	0	113.5	W22 R23 G28	W22-L26 VanDerWaalsContact CD1-CD1 3.48Å; W22-L26 HydrophobicContact CG-CD1 4.3Å; W22-L26 HydrophobicContact CZ2-CD1 4.49Å; W22-L26 WeakPolarHBondContact O-CB 3.3Å; W22-L26 WeakPolarHBondContact O-CG 3.35Å; W22-L26 PolarHBondContact O-N 3.47Å; R23-L26 PolarHBondContact O-N 3.38Å; L26-G28 PolarHBondContact O-N 2.95Å
27	S	58.8	Low	51.9	Low	76 Å²	76	106.9 Å²	106.9	53%	0.531	55%	0.545	S	S	.	.	T	Hydrogen-bonded Turn	trans	-81.7	-1.2	179.4	-54.6	0	0	0	0	112.1	R23 L24 V25 W29	R23-S27 VanDerWaalsContact O-CB 3.26Å; R23-S27 WeakPolarHBondContact O-CB 3.34Å; R23-S27 PolarHBondContact O-N 2.84Å; R23-S27 PolarHBondContact O-OG 3.02Å; L24-S27 PolarHBondContact O-N 3.47Å; V25-S27 PolarHBondContact O-N 3.35Å; S27-W29 VanDerWaalsContact C-N 3.27Å; S27-W29 VanDerWaalsContact CB-CD1 3.41Å; S27-W29 VanDerWaalsContact O-CD1 3.24Å; S27-W29 PolarHBondContact O-N 3.16Å
28	G	44.1	Very low	50.8	Low	61 Å²	61	109.4 Å²	109.4	63%	0.629	56%	0.559	S	S	*	*	T	Hydrogen-bonded Turn	trans	73.8	12.3	-179.6	0	0	0	0	0	114.6	L24 V25 L26	L24-G28 PolarHBondContact O-N 3.34Å; V25-G28 PolarHBondContact O-N 3.1Å; L26-G28 PolarHBondContact O-N 2.95Å
29	W	46.4	Very low	49.5	Very low	197 Å²	197	109.7 Å²	109.7	75%	0.746	57%	0.568	S	S	*	*	S	Bend	trans	-84.1	-20.9	-179.2	-72.8	78.6	0	0	0	113	L24 S27	L24-W29 HydrophobicContact CD2-CB 3.88Å; L24-W29 PolarHBondContact O-N 3.15Å; S27-W29 VanDerWaalsContact C-N 3.27Å; S27-W29 VanDerWaalsContact CB-CD1 3.41Å; S27-W29 VanDerWaalsContact O-CD1 3.24Å; S27-W29 PolarHBondContact O-N 3.16Å
30	V	41.1	Very low	47.9	Very low	44 Å²	44	111.1 Å²	111.1	27%	0.267	58%	0.575	S	S	.	*	S	Bend	trans	-130.5	113	175.5	175.1	0	0	0	0	106.2	L24 V25	L24-V30 HydrophobicContact CB-CB 4.37Å; L24-V30 HydrophobicContact CB-CG2 3.91Å; L24-V30 HydrophobicContact CD2-CG2 4.37Å; L24-V30 PolarHBondContact O-N 3.37Å; V25-V30 WeakPolarHBondContact CA-O 3.43Å; V25-V30 HydrophobicContact CG2-CB 4.24Å; V25-V30 HydrophobicContact CG2-CG1 4.22Å
31	Q	45.6	Very low	46.5	Very low	116 Å²	116	115.9 Å²	115.9	54%	0.542	60%	0.595	S	S	.	*			trans	-70.7	138.7	168.2	-76.3	-167.6	-35.9	0	0	107.9	E33 D34	Q31-E33 PolarHBondContact O-N 3.45Å; Q31-D34 PolarHBondContact O-N 2.97Å; Q31-D34 VanDerWaalsContact O-N 3.11Å
32	P	48.1	Very low	45.5	Very low	91 Å²	91	120 Å²	120	59%	0.591	61%	0.611	S	S	*	*	T	Hydrogen-bonded Turn	trans	-59.7	-15.3	178.5	24	-32.5	0	0	0	113
33	E	42.7	Very low	44.1	Very low	154 Å²	154	119 Å²	119	72%	0.72	62%	0.617	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.5	-22.7	179	-60.2	-171.7	103.9	0	0	113.7	Q31 D35	Q31-E33 PolarHBondContact O-N 3.45Å; E33-D35 PolarHBondContact O-N 2.86Å; E33-D35 VanDerWaalsContact O-N 3.15Å
34	D	42.4	Very low	42.8	Very low	116 Å²	116	117.4 Å²	117.4	62%	0.62	63%	0.628	S	S	*	*	T	Hydrogen-bonded Turn	trans	-72.2	-5.1	178.8	-71	-52.3	0	0	0	113.3	Q31	Q31-D34 PolarHBondContact O-N 2.97Å; Q31-D34 VanDerWaalsContact O-N 3.11Å
35	D	40.2	Very low	41.6	Very low	79 Å²	79	117.8 Å²	117.8	42%	0.422	65%	0.646	S	S	.	*	T	Hydrogen-bonded Turn	trans	-96.2	0	-176.4	-123.9	-47.5	0	0	0	113.6	R21 E33	R21-D35 IonicContact CZ-OD2 3.78Å; R21-D35 VanDerWaalsContact CZ-OD2 3.25Å; R21-D35 IonicContact NE-OD2 2.68Å; R21-D35 PolarHBondContact NE-OD2 3.21Å; R21-D35 VanDerWaalsContact NE-OD2 3.14Å; R21-D35 IonicContact NH2-OD1 3.14Å; R21-D35 IonicContact NH2-OD2 3.25Å; R21-D35 PolarHBondContact NH2-OD2 2.88Å; E33-D35 PolarHBondContact O-N 2.86Å; E33-D35 VanDerWaalsContact O-N 3.15Å
36	V	42.9	Very low	41	Very low	101 Å²	101	121.8 Å²	121.8	61%	0.612	67%	0.673	S	S	*	*	S	Bend	trans	-94.7	-15.9	-176.7	-172.2	0	0	0	0	113.5
37	Q	38.6	Very low	40.1	Very low	171 Å²	171	126.8 Å²	126.8	80%	0.799	69%	0.685	S	S	*	*	S	Bend	trans	-97.2	-31.5	-176.8	-91.1	180	-75.2	0	0	116.2
38	D	39.9	Very low	39.5	Very low	164 Å²	164	129 Å²	129	88%	0.877	70%	0.695	S	S	*	*	S	Bend	trans	-90.1	-10	-172.8	-84	-17.9	0	0	0	115.3
39	G	32.4	Very low	39.6	Very low	65 Å²	65	131 Å²	131	67%	0.67	70%	0.697	S	S	*	*	S	Bend	trans	-100.5	-15.3	-174.5	0	0	0	0	0	116.6
40	I	33.2	Very low	39.3	Very low	129 Å²	129	126 Å²	126	66%	0.662	69%	0.69	S	S	*	*			trans	-128.6	21.6	-165.3	-36.7	-179.5	0	0	0	112.5	R42	I40-R42 PolarHBondContact O-N 2.94Å
41	E	35.7	Very low	39.9	Very low	189 Å²	189	129.5 Å²	129.5	88%	0.883	71%	0.714	S	S	*	*	S	Bend	trans	-78	0.7	166.6	-87.3	-157.8	157.7	0	0	113.9
42	R	35.7	Very low	39.5	Very low	226 Å²	226	131.1 Å²	131.1	85%	0.853	72%	0.721	S	S	*	*	S	Bend	trans	-136.2	92.2	174.6	-111.4	174.6	164.6	176.6	-3.5	108.9	I40	I40-R42 PolarHBondContact O-N 2.94Å
43	I	31.8	Very low	39	Very low	153 Å²	153	135.3 Å²	135.3	79%	0.785	73%	0.733	S	S	*	*	S	Bend	trans	159.3	108.3	132.3	-75.2	149.6	0	0	0	107.7
44	S	32	Very low	39	Very low	114 Å²	114	135.7 Å²	135.7	80%	0.797	74%	0.739	S	S	*	*			trans	81.3	91.9	155.7	-59.3	0	0	0	0	120
45	G	30.7	Very low	39.1	Very low	64 Å²	64	141 Å²	141	66%	0.66	75%	0.75	S	S	*	*			trans	76.3	151.4	130.2	0	0	0	0	0	118	Y47	G45-Y47 VanDerWaalsContact C-N 3.33Å; G45-Y47 PolarHBondContact O-N 2.78Å
46	P	39.6	Very low	39	Very low	128 Å²	128	145.8 Å²	145.8	83%	0.831	77%	0.77	S	S	*	*			trans	-77.4	83.6	-174.9	33.6	-32.9	0	0	0	109.9	T48	P46-T48 PolarHBondContact O-N 2.95Å
47	Y	40	Very low	39	Very low	224 Å²	224	146.9 Å²	146.9	88%	0.878	78%	0.777	S	S	*	*			trans	-93.9	78.9	159.3	-112.3	-88.5	0	0	0	107.6	G45 P49	G45-Y47 VanDerWaalsContact C-N 3.33Å; G45-Y47 PolarHBondContact O-N 2.78Å; Y47-P49 WeakPolarHBondContact O-CD 3.26Å
48	T	46.8	Very low	39	Very low	122 Å²	122	146.9 Å²	146.9	75%	0.748	78%	0.777	S	S	*	*			trans	-67.2	111	165.4	-22.6	0	0	0	0	106.7	P46	P46-T48 PolarHBondContact O-N 2.95Å
49	P	46.3	Very low	38.9	Very low	105 Å²	105	150.5 Å²	150.5	68%	0.682	78%	0.778	S	S	*	*			trans	-69.8	131.5	177.1	17.1	-10.7	0	0	0	108.8	Y47	Y47-P49 WeakPolarHBondContact O-CD 3.26Å
50	P	40	Very low	39	Very low	91 Å²	91	155.6 Å²	155.6	59%	0.591	78%	0.784	S	S	*	*			trans	-65.4	141.8	-175.3	22.9	-31	0	0	0	111.6	H52	P50-H52 PolarHBondContact O-N 2.71Å
51	P	53	Low	39.2	Very low	118 Å²	118	161 Å²	161	77%	0.766	80%	0.796	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.2	32.9	-165.7	30.6	-36.4	0	0	0	115.2
52	H	38.3	Very low	39	Very low	149 Å²	149	157.4 Å²	157.4	69%	0.69	79%	0.788	S	S	*	*	T	Hydrogen-bonded Turn	trans	-109.4	-9.3	-169.1	-43.6	-41.3	0	0	0	115.3	P50	P50-H52 PolarHBondContact O-N 2.71Å
53	E	37.4	Very low	38.9	Very low	179 Å²	179	151.5 Å²	151.5	84%	0.836	78%	0.781	S	S	*	*	S	Bend	trans	-95.7	-7.6	-174.7	-69	-166.9	159.8	0	0	115.4	R55	E53-R55 VanDerWaalsContact C-N 3.28Å; E53-R55 PolarHBondContact O-N 3.25Å
54	L	42.4	Very low	39.1	Very low	162 Å²	162	150 Å²	150	85%	0.848	78%	0.779	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78	-5.5	-179.4	-69	176.1	0	0	0	114.8
55	R	43.4	Very low	39	Very low	227 Å²	227	156 Å²	156	86%	0.857	78%	0.784	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84.8	-6.6	-178.1	-100.9	-172.6	175	-174.2	-0.2	115.7	E53	E53-R55 VanDerWaalsContact C-N 3.28Å; E53-R55 PolarHBondContact O-N 3.25Å
56	Q	38.1	Very low	39.2	Very low	180 Å²	180	157 Å²	157	84%	0.841	78%	0.781	S	S	*	*	S	Bend	trans	-98.3	-9	-178.4	-70	-164.9	2.5	0	0	115.3
57	V	43	Very low	38.7	Very low	125 Å²	125	155.6 Å²	155.6	76%	0.758	78%	0.78	S	S	*	*	T	Hydrogen-bonded Turn	trans	-94.2	-0.5	-179.6	-165.6	0	0	0	0	112.9	R59	V57-R59 VanDerWaalsContact C-N 3.3Å; V57-R59 PolarHBondContact O-N 3.26Å
58	E	39.9	Very low	38.3	Very low	171 Å²	171	151.2 Å²	151.2	80%	0.799	78%	0.777	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.1	-7.2	178.9	-142.6	174	-171.1	0	0	113.4
59	R	38.2	Very low	37.4	Very low	239 Å²	239	154.5 Å²	154.5	90%	0.902	78%	0.78	S	S	*	*	S	Bend	trans	-108	39.8	-173.4	-140.9	-176.6	-158.6	-175.3	5.7	114.3	V57	V57-R59 VanDerWaalsContact C-N 3.3Å; V57-R59 PolarHBondContact O-N 3.26Å
60	E	34.2	Very low	36.5	Very low	172 Å²	172	157.8 Å²	157.8	80%	0.804	79%	0.791	S	S	*	*			trans	-155	24.7	168.4	-128.5	173.8	-172.4	0	0	115.1	T62	E60-T62 PolarHBondContact O-N 3.03Å
61	R	37.1	Very low	35.9	Very low	242 Å²	242	159.7 Å²	159.7	91%	0.913	80%	0.801	S	S	*	*			trans	-81.8	59.8	164.9	-75.1	-172.3	178.5	-178.1	1.1	110.4	S63	R61-S63 PolarHBondContact O-N 3.25Å
62	T	31.1	Very low	34.6	Very low	114 Å²	114	157.7 Å²	157.7	70%	0.699	79%	0.794	S	S	*	*			trans	-72.4	116.3	168.8	-31.8	0	0	0	0	107.5	E60 V64	E60-T62 PolarHBondContact O-N 3.03Å; T62-V64 PolarHBondContact O-N 3.01Å
63	S	32.7	Very low	34.3	Very low	103 Å²	103	156 Å²	156	72%	0.72	80%	0.797	S	S	*	*			trans	-36.6	89.3	178.3	-175.9	0	0	0	0	114.1	R61 R65	R61-S63 PolarHBondContact O-N 3.25Å; S63-R65 VanDerWaalsContact C-N 3.26Å; S63-R65 PolarHBondContact O-N 3.41Å
64	V	36.7	Very low	34	Very low	121 Å²	121	152 Å²	152	73%	0.733	79%	0.788	S	S	*	*			trans	-80	87.1	163.6	179.4	0	0	0	0	106.4	T62 S66	T62-V64 PolarHBondContact O-N 3.01Å; V64-S66 WeakPolarHBondContact CG1-OG 3.43Å; V64-S66 PolarHBondContact O-N 3.31Å
65	R	29.7	Very low	33.3	Very low	240 Å²	240	153.1 Å²	153.1	91%	0.906	79%	0.789	S	S	*	*			trans	-69.8	55.9	169.8	-134.4	-172.9	-168.1	-172.7	2.9	109.4	S63 A67	S63-R65 VanDerWaalsContact C-N 3.26Å; S63-R65 PolarHBondContact O-N 3.41Å; R65-A67 PolarHBondContact O-N 2.89Å
66	S	35.7	Very low	32.9	Very low	85 Å²	85	149.7 Å²	149.7	59%	0.594	79%	0.787	S	S	*	*			trans	-76.1	109.6	171.3	-75.3	0	0	0	0	107.4	V64 T68	V64-S66 WeakPolarHBondContact CG1-OG 3.43Å; V64-S66 PolarHBondContact O-N 3.31Å; S66-T68 VanDerWaalsContact C-N 3.27Å; S66-T68 PolarHBondContact O-N 3.3Å
67	A	29.4	Very low	32.6	Very low	98 Å²	98	143.5 Å²	143.5	81%	0.81	77%	0.771	S	S	*	*			trans	-54	92	169.6	0	0	0	0	0	109.4	R65 K69	R65-A67 PolarHBondContact O-N 2.89Å; A67-K69 PolarHBondContact O-N 3.03Å
68	T	31.1	Very low	32.4	Very low	132 Å²	132	143.9 Å²	143.9	81%	0.81	78%	0.776	S	S	*	*			trans	-65.4	92.4	167.7	5.7	0	0	0	0	106	S66 L70	S66-T68 VanDerWaalsContact C-N 3.27Å; S66-T68 PolarHBondContact O-N 3.3Å; T68-L70 PolarHBondContact O-N 2.91Å
69	K	27	Very low	32.5	Very low	191 Å²	191	140.4 Å²	140.4	83%	0.83	76%	0.76	S	S	*	*			trans	-50.7	112.6	159.5	-86.8	-178.5	175.2	176.4	0	105.3	A67 V71	A67-K69 PolarHBondContact O-N 3.03Å; K69-V71 VanDerWaalsContact C-N 3.27Å; K69-V71 PolarHBondContact O-N 2.98Å
70	L	28.2	Very low	32.4	Very low	174 Å²	174	139.4 Å²	139.4	91%	0.911	76%	0.756	S	S	*	*			trans	-54.7	95.8	173.9	-74.1	158.1	0	0	0	106.9	T68 A72	T68-L70 PolarHBondContact O-N 2.91Å; L70-A72 PolarHBondContact O-N 2.88Å
71	V	27.3	Very low	32.7	Very low	131 Å²	131	136.6 Å²	136.6	79%	0.794	74%	0.742	S	S	*	*			trans	-68.1	108.4	169.2	-179.6	0	0	0	0	103.9	K69	K69-V71 VanDerWaalsContact C-N 3.27Å; K69-V71 PolarHBondContact O-N 2.98Å
72	A	26.3	Very low	32.7	Very low	76 Å²	76	130.9 Å²	130.9	63%	0.628	73%	0.729	S	S	*	*			trans	-49.9	132.6	177.9	0	0	0	0	0	108.4	L70 S74	L70-A72 PolarHBondContact O-N 2.88Å; A72-S74 PolarHBondContact O-N 3.42Å
73	P	31.9	Very low	32.9	Very low	113 Å²	113	126.5 Å²	126.5	73%	0.734	71%	0.707	S	S	*	*			trans	-55.4	108.8	-176.3	20.1	-30.3	0	0	0	108.3	H75	P73-H75 PolarHBondContact O-N 3.2Å
74	S	30.3	Very low	33.2	Very low	95 Å²	95	123.6 Å²	123.6	66%	0.664	68%	0.683	S	S	*	*			trans	-59.1	108.8	175.6	43.6	0	0	0	0	106.7	A72 L76	A72-S74 PolarHBondContact O-N 3.42Å; S74-L76 VanDerWaalsContact C-N 3.27Å; S74-L76 PolarHBondContact O-N 3.32Å
75	H	28.2	Very low	33.1	Very low	187 Å²	187	126.7 Å²	126.7	87%	0.866	68%	0.681	S	S	*	*			trans	-57.5	94.4	174.2	-76.2	-94.8	0	0	0	108	P73 G77	P73-H75 PolarHBondContact O-N 3.2Å; H75-G77 PolarHBondContact O-N 3.23Å
76	L	35.4	Very low	33.6	Very low	154 Å²	154	118.8 Å²	118.8	81%	0.806	66%	0.66	S	S	*	*			trans	-70.7	84.3	167.3	-66.6	173.5	0	0	0	105.8	S74	S74-L76 VanDerWaalsContact C-N 3.27Å; S74-L76 PolarHBondContact O-N 3.32Å
77	G	31.4	Very low	33.4	Very low	50 Å²	50	123.5 Å²	123.5	52%	0.515	67%	0.665	S	S	.	*			trans	-54.3	150.8	165.2	0	0	0	0	0	108.8	H75 Q79	H75-G77 PolarHBondContact O-N 3.23Å; G77-Q79 PolarHBondContact O-N 3.39Å
78	P	38.3	Very low	33.7	Very low	133 Å²	133	124.3 Å²	124.3	86%	0.864	66%	0.659	S	S	*	*			trans	-62.9	85.8	178.5	26.7	-33.6	0	0	0	108.6	R80	P78-R80 PolarHBondContact O-N 2.8Å
79	Q	41.7	Very low	33.6	Very low	99 Å²	99	121 Å²	121	46%	0.463	64%	0.641	S	S	.	*			trans	-59.9	116.6	165.7	-173.1	169.2	-2.8	0	0	103.7	G77 F81	G77-Q79 PolarHBondContact O-N 3.39Å; Q79-F81 WeakPolarHBondContact O-CD2 3.42Å; Q79-F81 PolarHBondContact O-N 3.02Å
80	R	36.7	Very low	33.7	Very low	217 Å²	217	121.7 Å²	121.7	82%	0.819	64%	0.639	S	S	*	*			trans	-54.2	89.1	-178.8	-64.2	-178.7	177.6	-172.5	-1.5	108.1	P78 D82	P78-R80 PolarHBondContact O-N 2.8Å; R80-D82 PolarHBondContact O-N 3.24Å
81	F	41	Very low	33.8	Very low	113 Å²	113	116.5 Å²	116.5	50%	0.496	62%	0.617	S	S	.	*			trans	-74.6	73.1	156.5	-66.3	-84.4	0	0	0	104.2	Q79 G83 L84 V113	Q79-F81 WeakPolarHBondContact O-CD2 3.42Å; Q79-F81 PolarHBondContact O-N 3.02Å; F81-G83 PolarHBondContact O-N 3.1Å; F81-L84 HydrophobicContact CB-CB 3.77Å; F81-L84 HydrophobicContact CB-CD1 3.84Å; F81-L84 HydrophobicContact CB-CG 4.4Å; F81-L84 HydrophobicContact CD1-CD1 3.59Å; F81-L84 HydrophobicContact CE1-CD1 4.32Å; F81-L84 HydrophobicContact CG-CD1 3.85Å; F81-L84 PolarHBondContact O-N 3.25Å; F81-L84 VanDerWaalsContact O-N 3.09Å; F81-V113 HydrophobicContact CE1-CG1 4.44Å
82	D	35.8	Very low	34	Very low	122 Å²	122	115.3 Å²	115.3	65%	0.652	61%	0.609	S	S	*	*	T	Hydrogen-bonded Turn	trans	-49.3	117.8	162	-80.5	-35.3	0	0	0	104.7	R80 T111	R80-D82 PolarHBondContact O-N 3.24Å; D82-T111 WeakPolarHBondContact O-CB 3.21Å; D82-T111 WeakPolarHBondContact O-CG2 3.48Å; D82-T111 PolarHBondContact O-OG1 2.87Å
83	G	37	Very low	34.2	Very low	22 Å²	22	118.2 Å²	118.2	23%	0.227	61%	0.61	C	S	.	*	T	Hydrogen-bonded Turn	trans	106.8	-19.9	-179.3	0	0	0	0	0	118.5	F81 R85 V108 T111	F81-G83 PolarHBondContact O-N 3.1Å; G83-R85 PolarHBondContact O-N 3.25Å; G83-V108 WeakPolarHBondContact O-CB 3.44Å; G83-V108 PolarHBondContact O-N 3.1Å; G83-V108 VanDerWaalsContact O-N 3.12Å; G83-T111 WeakPolarHBondContact CA-OG1 3Å
84	L	38.1	Very low	34.3	Very low	42 Å²	42	122.2 Å²	122.2	22%	0.22	62%	0.619	C	S	.	*	E	Extended strand (participates in β ladder)	trans	-96	92.4	172	-87.4	146.4	0	0	0	109.1	F81 V86 V105 L107	F81-L84 HydrophobicContact CB-CB 3.77Å; F81-L84 HydrophobicContact CB-CD1 3.84Å; F81-L84 HydrophobicContact CB-CG 4.4Å; F81-L84 HydrophobicContact CD1-CD1 3.59Å; F81-L84 HydrophobicContact CE1-CD1 4.32Å; F81-L84 HydrophobicContact CG-CD1 3.85Å; F81-L84 PolarHBondContact O-N 3.25Å; F81-L84 VanDerWaalsContact O-N 3.09Å; L84-V86 PolarHBondContact O-N 2.85Å; L84-V86 VanDerWaalsContact O-N 3.15Å; L84-V105 HydrophobicContact CD2-CG1 3.3Å; L84-L107 HydrophobicContact CD2-CD1 4.18Å; L84-L107 HydrophobicContact CD2-CG 3.9Å; L84-L107 HydrophobicContact CG-CG 4.36Å
85	R	35.7	Very low	34.5	Very low	186 Å²	186	122.3 Å²	122.3	70%	0.702	62%	0.615	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-79.9	93.3	166.4	-70.4	-171.9	-179.9	-165.3	0.8	108	G83 R87 T106	G83-R85 PolarHBondContact O-N 3.25Å; R85-R87 PolarHBondContact O-N 3.27Å; R85-T106 PolarHBondContact O-OG1 3.07Å
86	V	38.7	Very low	34.7	Very low	74 Å²	74	119.8 Å²	119.8	45%	0.448	62%	0.615	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-74.7	107.9	168.6	-179.2	0	0	0	0	107.7	L84 M103	L84-V86 PolarHBondContact O-N 2.85Å; L84-V86 VanDerWaalsContact O-N 3.15Å; V86-M103 HydrophobicContact CG1-CE 3.94Å; V86-M103 HydrophobicContact CG1-CG 3.65Å; V86-M103 HydrophobicContact CG1-SD 3.44Å; V86-M103 WeakPolarHBondContact CG1-SD 3.46Å
87	R	31.8	Very low	34.9	Very low	185 Å²	185	116.2 Å²	116.2	70%	0.698	62%	0.616	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-99.7	116.8	169.7	-89.9	-174.2	165	178.4	-4.8	108.5	R85 C89 V104	R85-R87 PolarHBondContact O-N 3.27Å; R87-C89 PolarHBondContact O-N 3.39Å; R87-V104 PolarHBondContact N-O 3.5Å; R87-V104 PolarHBondContact O-N 3.34Å; R87-V104 VanDerWaalsContact O-N 3.16Å
88	T	34.9	Very low	34.8	Very low	114 Å²	114	117.6 Å²	117.6	70%	0.699	61%	0.614	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-75.4	117	169.7	52.5	0	0	0	0	108.6
89	C	30.4	Very low	34.5	Very low	64 Å²	64	115.6 Å²	115.6	43%	0.432	60%	0.599	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-106.6	106.7	173.7	-65.3	0	0	0	0	108.2	R87 G102	R87-C89 PolarHBondContact O-N 3.39Å; C89-G102 CarbonylContact C-O 3.58Å; C89-G102 WeakPolarHBondContact CA-O 3.43Å; C89-G102 PolarHBondContact N-O 3.15Å; C89-G102 CarbonylContact O-C 3.43Å; C89-G102 PolarHBondContact O-N 3.47Å; C89-G102 VanDerWaalsContact O-N 3.1Å
90	R	28.9	Very low	34.1	Very low	205 Å²	205	116.3 Å²	116.3	77%	0.774	60%	0.602	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-86.4	109.5	165.3	-82.1	-176.5	172.7	-179.8	-2.5	107.8
91	S	30.9	Very low	34.2	Very low	65 Å²	65	110.2 Å²	110.2	46%	0.455	59%	0.593	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-96.9	104.8	164.5	55.3	0	0	0	0	107.7	H93 H100	S91-H93 PolarHBondContact O-N 2.88Å; S91-H100 PolarHBondContact N-O 3.44Å; S91-H100 VanDerWaalsContact O-O 3.11Å
92	V	29.9	Very low	33.7	Very low	105 Å²	105	106.8 Å²	106.8	64%	0.636	59%	0.589	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-82.9	100.7	170.2	-175.2	0	0	0	0	106
93	H	31	Very low	33.7	Very low	138 Å²	138	105 Å²	105	64%	0.639	58%	0.578	S	S	*	*			trans	-76.7	130.7	164.4	-101.6	-62.2	0	0	0	107.8	S91 V95	S91-H93 PolarHBondContact O-N 2.88Å; H93-V95 PolarHBondContact O-N 2.77Å
94	E	34.6	Very low	33.5	Very low	197 Å²	197	107.7 Å²	107.7	92%	0.921	59%	0.59	S	S	*	*	S	Bend	trans	-68.1	55	173.1	-82.8	-176	149.4	0	0	111.8
95	V	33.2	Very low	33.6	Very low	97 Å²	97	108.6 Å²	108.6	59%	0.588	60%	0.597	S	S	*	*	S	Bend	trans	-109	119	156.1	-175.3	0	0	0	0	105.3	H93 G97 V98	H93-V95 PolarHBondContact O-N 2.77Å; V95-G97 PolarHBondContact O-N 2.93Å; V95-V98 PolarHBondContact O-N 3.04Å
96	P	34.3	Very low	33.7	Very low	133 Å²	133	103.4 Å²	103.4	86%	0.864	59%	0.586	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.1	116	-170.7	-20.1	29.5	0	0	0	110.5
97	G	37.8	Very low	33.8	Very low	79 Å²	79	104.7 Å²	104.7	81%	0.814	59%	0.59	S	S	*	*	T	Hydrogen-bonded Turn	trans	107.8	-2.7	168.2	0	0	0	0	0	117.2	V95	V95-G97 PolarHBondContact O-N 2.93Å
98	V	30.2	Very low	34.2	Very low	79 Å²	79	100 Å²	100	48%	0.479	58%	0.581	S	S	.	*			trans	-119.6	96.3	178.4	-161.9	0	0	0	0	111.9	V95 H100	V95-V98 PolarHBondContact O-N 3.04Å; V98-H100 WeakPolarHBondContact CG1-CE1 3.49Å; V98-H100 PolarHBondContact O-N 3.2Å
99	V	31	Very low	34.4	Very low	91 Å²	91	99.2 Å²	99.2	55%	0.552	59%	0.586	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-85.1	101.2	171.7	-179.8	0	0	0	0	108.4	S101	V99-S101 PolarHBondContact O-N 3.12Å
100	H	34.5	Very low	34.8	Very low	114 Å²	114	104.9 Å²	104.9	53%	0.528	61%	0.607	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-79.9	110.5	170.1	-71	86.4	0	0	0	109.3	S91 V98	S91-H100 PolarHBondContact N-O 3.44Å; S91-H100 VanDerWaalsContact O-O 3.11Å; V98-H100 WeakPolarHBondContact CG1-CE1 3.49Å; V98-H100 PolarHBondContact O-N 3.2Å
101	S	38.1	Very low	35.2	Very low	90 Å²	90	97.4 Å²	97.4	63%	0.629	58%	0.584	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-95.9	99.6	169.9	57.8	0	0	0	0	109.9	V99	V99-S101 PolarHBondContact O-N 3.12Å
102	G	31.4	Very low	35.3	Very low	40 Å²	40	101.2 Å²	101.2	41%	0.412	60%	0.604	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-88.7	129.7	171.6	0	0	0	0	0	111.1	C89	C89-G102 CarbonylContact C-O 3.58Å; C89-G102 WeakPolarHBondContact CA-O 3.43Å; C89-G102 PolarHBondContact N-O 3.15Å; C89-G102 CarbonylContact O-C 3.43Å; C89-G102 PolarHBondContact O-N 3.47Å; C89-G102 VanDerWaalsContact O-N 3.1Å
103	M	34.8	Very low	35.9	Very low	85 Å²	85	99.5 Å²	99.5	42%	0.419	59%	0.594	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-102.2	113.9	171.3	-161.9	170.3	81.2	0	0	109.3	L24 V86 V105	L24-M103 HydrophobicContact CD2-CE 4.28Å; V86-M103 HydrophobicContact CG1-CE 3.94Å; V86-M103 HydrophobicContact CG1-CG 3.65Å; V86-M103 HydrophobicContact CG1-SD 3.44Å; V86-M103 WeakPolarHBondContact CG1-SD 3.46Å; M103-V105 HydrophobicContact CE-CG2 3.73Å; M103-V105 HydrophobicContact CG-CG2 4.46Å
104	V	33.6	Very low	36.2	Very low	78 Å²	78	95.2 Å²	95.2	47%	0.473	59%	0.587	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-91.4	112.1	174.7	-179.5	0	0	0	0	108	R87 T106	R87-V104 PolarHBondContact N-O 3.5Å; R87-V104 PolarHBondContact O-N 3.34Å; R87-V104 VanDerWaalsContact O-N 3.16Å; V104-T106 HydrophobicContact CG1-CG2 4.38Å
105	V	40.4	Very low	36.6	Very low	62 Å²	62	88.6 Å²	88.6	38%	0.376	57%	0.566	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-98.6	104.2	174.9	-177	0	0	0	0	108.4	L84 M103	L84-V105 HydrophobicContact CD2-CG1 3.3Å; M103-V105 HydrophobicContact CE-CG2 3.73Å; M103-V105 HydrophobicContact CG-CG2 4.46Å
106	T	37.9	Very low	36.9	Very low	76 Å²	76	88.1 Å²	88.1	47%	0.466	57%	0.565	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-95.1	112.9	171.6	30.3	0	0	0	0	109.7	R85 V104 V108	R85-T106 PolarHBondContact O-OG1 3.07Å; V104-T106 HydrophobicContact CG1-CG2 4.38Å; T106-V108 PolarHBondContact O-N 2.78Å
107	L	41.3	Very low	37.2	Very low	102 Å²	102	84 Å²	84	53%	0.534	53%	0.533	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-76	112.7	165.7	-89.1	107.2	0	0	0	108.7	L84 A109	L84-L107 HydrophobicContact CD2-CD1 4.18Å; L84-L107 HydrophobicContact CD2-CG 3.9Å; L84-L107 HydrophobicContact CG-CG 4.36Å; L107-A109 PolarHBondContact O-N 3.31Å
108	V	39	Very low	37.3	Very low	85 Å²	85	84.3 Å²	84.3	52%	0.515	52%	0.519	S	S	.	.			trans	-79.5	119.8	166.7	-175.1	0	0	0	0	107.4	G83 T106 E110 T111	G83-V108 WeakPolarHBondContact O-CB 3.44Å; G83-V108 PolarHBondContact O-N 3.1Å; G83-V108 VanDerWaalsContact O-N 3.12Å; T106-V108 PolarHBondContact O-N 2.78Å; V108-E110 PolarHBondContact O-N 3.06Å; V108-T111 PolarHBondContact O-OG1 2.91Å
109	A	39.4	Very low	37.7	Very low	98 Å²	98	88.6 Å²	88.6	81%	0.81	53%	0.527	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.5	15.5	-152.4	0	0	0	0	0	119	L107	L107-A109 PolarHBondContact O-N 3.31Å
110	E	39.8	Very low	38.3	Very low	183 Å²	183	87.5 Å²	87.5	86%	0.855	52%	0.518	S	S	*	.	T	Hydrogen-bonded Turn	trans	-141.1	35.4	-175.3	-67.5	-169.5	159.9	0	0	114.3	V108	V108-E110 PolarHBondContact O-N 3.06Å
111	T	35.6	Very low	38.8	Very low	49 Å²	49	91.1 Å²	91.1	30%	0.301	54%	0.54	S	S	.	.			trans	-111.9	111.7	-178.8	46.8	0	0	0	0	111.7	D82 G83 V108 V113	D82-T111 WeakPolarHBondContact O-CB 3.21Å; D82-T111 WeakPolarHBondContact O-CG2 3.48Å; D82-T111 PolarHBondContact O-OG1 2.87Å; G83-T111 WeakPolarHBondContact CA-OG1 3Å; V108-T111 PolarHBondContact O-OG1 2.91Å; T111-V113 VanDerWaalsContact C-N 3.34Å; T111-V113 PolarHBondContact O-N 2.66Å
112	V	34.5	Very low	39.4	Very low	144 Å²	144	92.8 Å²	92.8	87%	0.873	55%	0.551	S	S	*	*			trans	-59	97	176.8	-179.4	0	0	0	0	107.3	G114	V112-G114 PolarHBondContact O-N 2.65Å
113	V	41.7	Very low	39.9	Very low	69 Å²	69	93.4 Å²	93.4	42%	0.418	56%	0.556	S	S	.	*			trans	-63.4	102.2	171.7	-177.7	0	0	0	0	106.4	F81 T111	F81-V113 HydrophobicContact CE1-CG1 4.44Å; T111-V113 VanDerWaalsContact C-N 3.34Å; T111-V113 PolarHBondContact O-N 2.66Å
114	G	38	Very low	40	Very low	49 Å²	49	90.7 Å²	90.7	51%	0.505	55%	0.551	S	S	.	*	P	Polyproline II helix	trans	-54.1	142.9	175.4	0	0	0	0	0	110.3	V112	V112-G114 PolarHBondContact O-N 2.65Å
115	A	42.3	Very low	40.7	Very low	57 Å²	57	94.1 Å²	94.1	47%	0.471	56%	0.555	S	S	.	*	P	Polyproline II helix	trans	-53.7	136.5	-179.6	0	0	0	0	0	110.3	F117	A115-F117 PolarHBondContact O-N 2.87Å
116	P	40.3	Very low	40.9	Very low	88 Å²	88	96.1 Å²	96.1	57%	0.571	56%	0.563	S	S	*	*	P	Polyproline II helix	trans	-61.3	130.5	176	26.2	-32.8	0	0	0	109.1	V128	P116-V128 WeakPolarHBondContact O-CB 3.4Å
117	F	40.1	Very low	41.5	Very low	46 Å²	46	98.5 Å²	98.5	20%	0.202	57%	0.573	C	S	.	*	E	Extended strand (participates in β ladder)	trans	-114.8	149.4	172.2	59	-93.3	0	0	0	109.7	A115 R119 R125 L126	A115-F117 PolarHBondContact O-N 2.87Å; F117-R119 HydrophobicContact CD2-CG 4.09Å; F117-R119 HydrophobicContact CE2-CG 3.9Å; F117-R125 HydrophobicContact CD2-CG 4.23Å; F117-R125 VanDerWaalsContact CE1-NH2 3.29Å; F117-R125 HydrophobicContact CE2-CG 4.4Å; F117-R125 VanDerWaalsContact CZ-NH2 3.33Å; F117-L126 WeakPolarHBondContact CB-O 3.49Å
118	V	40	Very low	41.8	Very low	85 Å²	85	97 Å²	97	52%	0.515	57%	0.568	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-97.2	126.3	172.2	178.6	0	0	0	0	106.9	L126 V128	V118-L126 PolarHBondContact N-O 2.94Å; V118-L126 VanDerWaalsContact N-O 3.1Å; V118-L126 PolarHBondContact O-N 2.81Å; V118-V128 HydrophobicContact CG2-CG2 3.88Å
119	R	37.2	Very low	41.7	Very low	170 Å²	170	95.2 Å²	95.2	64%	0.642	57%	0.566	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-89.4	123.6	167	-88.1	179.1	162.4	-176.5	-5.8	108.2	F117 G124 R125	F117-R119 HydrophobicContact CD2-CG 4.09Å; F117-R119 HydrophobicContact CE2-CG 3.9Å; R119-G124 WeakPolarHBondContact CA-O 3.34Å; R119-R125 HydrophobicContact CG-CG 4.45Å
120	D	43.8	Very low	42	Very low	67 Å²	67	95.6 Å²	95.6	36%	0.358	56%	0.561	S	S	.	*	P	Polyproline II helix	trans	-73.2	166.2	166.6	68	38.3	0	0	0	110.5	C122 G123 G124	D120-C122 PolarHBondContact O-N 3.09Å; D120-C122 VanDerWaalsContact O-N 3.17Å; D120-C122 WeakPolarHBondContact OD1-CA 2.89Å; D120-C122 WeakPolarHBondContact OD1-CB 3.43Å; D120-C122 PolarHBondContact OD1-N 3.37Å; D120-G123 PolarHBondContact O-N 2.98Å; D120-G123 PolarHBondContact OD1-N 3.24Å; D120-G123 VanDerWaalsContact OD1-N 3.09Å; D120-G124 PolarHBondContact N-O 3.05Å; D120-G124 WeakPolarHBondContact OD1-CA 3.41Å; D120-G124 PolarHBondContact OD1-N 2.83Å
121	L	45	Very low	41.9	Very low	190 Å²	190	96.3 Å²	96.3	100%	0.995	56%	0.557	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64.3	-17.2	-178.3	-69.2	169.4	0	0	0	113.2	G123	L121-G123 VanDerWaalsContact C-N 3.3Å
122	C	51.8	Low	41.9	Very low	126 Å²	126	99.7 Å²	99.7	85%	0.851	57%	0.573	S	S	*	*	T	Hydrogen-bonded Turn	trans	-89.9	3.6	177.6	-61.1	0	0	0	0	112.3	D120 G124	D120-C122 PolarHBondContact O-N 3.09Å; D120-C122 VanDerWaalsContact O-N 3.17Å; D120-C122 WeakPolarHBondContact OD1-CA 2.89Å; D120-C122 WeakPolarHBondContact OD1-CB 3.43Å; D120-C122 PolarHBondContact OD1-N 3.37Å; C122-G124 VanDerWaalsContact C-N 3.28Å
123	G	40.8	Very low	42.3	Very low	52 Å²	52	95.8 Å²	95.8	54%	0.536	56%	0.556	S	S	.	*	S	Bend	trans	81.6	5.1	-179.1	0	0	0	0	0	114	D120 L121	D120-G123 PolarHBondContact O-N 2.98Å; D120-G123 PolarHBondContact OD1-N 3.24Å; D120-G123 VanDerWaalsContact OD1-N 3.09Å; L121-G123 VanDerWaalsContact C-N 3.3Å
124	G	37.1	Very low	42.1	Very low	29 Å²	29	101 Å²	101	30%	0.299	58%	0.576	S	S	.	*			trans	-64.3	131.2	171.9	0	0	0	0	0	110.6	R119 D120 C122	R119-G124 WeakPolarHBondContact CA-O 3.34Å; D120-G124 PolarHBondContact N-O 3.05Å; D120-G124 WeakPolarHBondContact OD1-CA 3.41Å; D120-G124 PolarHBondContact OD1-N 2.83Å; C122-G124 VanDerWaalsContact C-N 3.28Å
125	R	49.4	Very low	42.1	Very low	150 Å²	150	107.6 Å²	107.6	57%	0.566	59%	0.593	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-87.8	114.1	170.6	-80.4	178.4	126.9	175.6	-4.4	108.4	F117 R119	F117-R125 HydrophobicContact CD2-CG 4.23Å; F117-R125 VanDerWaalsContact CE1-NH2 3.29Å; F117-R125 HydrophobicContact CE2-CG 4.4Å; F117-R125 VanDerWaalsContact CZ-NH2 3.33Å; R119-R125 HydrophobicContact CG-CG 4.45Å
126	L	44.7	Very low	41.8	Very low	104 Å²	104	115.5 Å²	115.5	55%	0.545	61%	0.611	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-96.5	100.5	164.1	-66.3	171.9	0	0	0	107.1	F117 V118 V128	F117-L126 WeakPolarHBondContact CB-O 3.49Å; V118-L126 PolarHBondContact N-O 2.94Å; V118-L126 VanDerWaalsContact N-O 3.1Å; V118-L126 PolarHBondContact O-N 2.81Å; L126-V128 PolarHBondContact O-N 3.09Å
127	D	50.2	Low	41.5	Very low	126 Å²	126	117 Å²	117	67%	0.674	62%	0.624	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-64.3	108.6	170.1	-75.4	-36.7	0	0	0	107.9	G129	D127-G129 VanDerWaalsContact C-N 3.29Å; D127-G129 PolarHBondContact O-N 2.92Å
128	V	47	Very low	41.4	Very low	70 Å²	70	123.3 Å²	123.3	42%	0.424	68%	0.684	S	S	.	*			trans	-75.7	95	171.2	-172.5	0	0	0	0	105.1	P116 V118 L126	P116-V128 WeakPolarHBondContact O-CB 3.4Å; V118-V128 HydrophobicContact CG2-CG2 3.88Å; L126-V128 PolarHBondContact O-N 3.09Å
129	G	37.8	Very low	41.5	Very low	47 Å²	47	125.2 Å²	125.2	49%	0.485	69%	0.692	S	S	.	*			trans	-48.1	153.1	173.6	0	0	0	0	0	110.8	D127 Y131	D127-G129 VanDerWaalsContact C-N 3.29Å; D127-G129 PolarHBondContact O-N 2.92Å; G129-Y131 PolarHBondContact O-N 3.05Å
130	P	45.7	Very low	41.7	Very low	107 Å²	107	122.8 Å²	122.8	70%	0.695	70%	0.695	S	S	*	*			trans	-51.6	122.6	-176.3	21.9	-32.7	0	0	0	109.6	N132	P130-N132 VanDerWaalsContact C-N 3.33Å; P130-N132 PolarHBondContact O-N 3.17Å
131	Y	36.7	Very low	41.6	Very low	198 Å²	198	125.9 Å²	125.9	78%	0.776	71%	0.714	S	S	*	*			trans	-60.5	95.2	-179.2	-176	-94.1	0	0	0	109.3	G129 A133	G129-Y131 PolarHBondContact O-N 3.05Å; Y131-A133 HydrophobicContact CD1-CB 4.16Å; Y131-A133 HydrophobicContact CE1-CB 3.95Å; Y131-A133 PolarHBondContact O-N 2.98Å
132	N	36.2	Very low	41.4	Very low	120 Å²	120	122.2 Å²	122.2	64%	0.642	70%	0.697	S	S	*	*			trans	-77	92.3	174.2	-85.3	-39	0	0	0	108.1	P130 H134 Q135	P130-N132 VanDerWaalsContact C-N 3.33Å; P130-N132 PolarHBondContact O-N 3.17Å; N132-H134 PolarHBondContact O-N 3.06Å; N132-Q135 PolarHBondContact O-N 2.98Å
133	A	42.7	Very low	40.7	Very low	62 Å²	62	121.9 Å²	121.9	51%	0.512	69%	0.688	S	S	.	*	T	Hydrogen-bonded Turn	trans	-58.9	-3.3	176.1	0	0	0	0	0	114.3	Y131	Y131-A133 HydrophobicContact CD1-CB 4.16Å; Y131-A133 HydrophobicContact CE1-CB 3.95Å; Y131-A133 PolarHBondContact O-N 2.98Å
134	H	37.2	Very low	40.7	Very low	178 Å²	178	126.6 Å²	126.6	82%	0.824	70%	0.698	S	S	*	*	T	Hydrogen-bonded Turn	trans	-86	-1.2	-179.8	-75.7	-64.8	0	0	0	115.3	N132 R136	N132-H134 PolarHBondContact O-N 3.06Å; H134-R136 PolarHBondContact O-N 3.06Å
135	Q	38.8	Very low	40.9	Very low	187 Å²	187	133.6 Å²	133.6	87%	0.874	73%	0.726	S	S	*	*			trans	-84.5	21	174.3	-93.4	-173.7	-32.4	0	0	115.1	N132	N132-Q135 PolarHBondContact O-N 2.98Å
136	R	35	Very low	40.3	Very low	223 Å²	223	132.3 Å²	132.3	84%	0.842	74%	0.739	S	S	*	*	S	Bend	trans	-104.3	75.8	162.4	-77.7	-171.3	177.3	-174.1	-0.7	110.3	H134	H134-R136 PolarHBondContact O-N 3.06Å
137	S	34.6	Very low	39.9	Very low	121 Å²	121	134.7 Å²	134.7	85%	0.846	76%	0.755	S	S	*	*			trans	169.9	90.7	148.6	-83.4	0	0	0	0	110.2
138	A	37.2	Very low	39	Very low	177 Å²	177	135.5 Å²	135.5	100%	1.463	76%	0.762	S	S	*	*			trans	-167.5	0	141.7	0	0	0	0	0	106.3

Retrieved 138 of 138 residues in 39.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).