A0A077ZMM8_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZMM8, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 117 aa.

						>A0A077ZMM8_TRITR|A0A077ZMM8
MDQSATGVQLARKSLTRATTVNGETRVLCAWLLCLHHADPVTAAAGGGDGRTAVPLDPSPLFLTTRPEQRTVGPADSERARCYPKDGELCMSRTKPEETLVEVRSGVDVQITRPTCA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	47.8	Very low	53.8	Low	238 Å²	238	123.7 Å²	123.7	100%	1.172	72%	0.723	S	S	*	*				0	94.2	0	-71.4	149.7	104.1	0	0	105.9	Q3	M1-Q3 PolarHBondContact O-N 3.47Å
2	D	46.9	Very low	54.7	Low	165 Å²	165	128.6 Å²	128.6	88%	0.882	72%	0.72	S	S	*	*			trans	-77.1	111.9	-174.8	-128.3	-88.7	0	0	0	108.9	S4	D2-S4 PolarHBondContact O-N 3.26Å; D2-S4 VanDerWaalsContact O-N 3.13Å
3	Q	48.4	Very low	55.9	Low	187 Å²	187	128.2 Å²	128.2	87%	0.874	71%	0.706	S	S	*	*			trans	-80	87.9	176.1	-72.8	-179.7	67.9	0	0	108.7	M1 A5	M1-Q3 PolarHBondContact O-N 3.47Å; Q3-A5 PolarHBondContact O-N 3.17Å
4	S	50.4	Low	57	Low	96 Å²	96	122.8 Å²	122.8	67%	0.671	68%	0.682	S	S	*	*			trans	-72	90.1	169	169.5	0	0	0	0	109.7	D2 T6	D2-S4 PolarHBondContact O-N 3.26Å; D2-S4 VanDerWaalsContact O-N 3.13Å; S4-T6 PolarHBondContact O-N 3.39Å; S4-T6 VanDerWaalsContact O-N 3.11Å
5	A	56.1	Low	58.2	Low	99 Å²	99	121.9 Å²	121.9	82%	0.818	67%	0.674	S	S	*	*			trans	-74.1	91.5	169.4	0	0	0	0	0	110	Q3 G7	Q3-A5 PolarHBondContact O-N 3.17Å; A5-G7 PolarHBondContact O-N 3.08Å
6	T	54.8	Low	59.3	Low	130 Å²	130	119.6 Å²	119.6	80%	0.798	67%	0.665	S	S	*	*			trans	-75.6	73.1	166.4	33.4	0	0	0	0	109.7	S4	S4-T6 PolarHBondContact O-N 3.39Å; S4-T6 VanDerWaalsContact O-N 3.11Å
7	G	54.6	Low	60.4	Low	56 Å²	56	122.6 Å²	122.6	58%	0.577	66%	0.664	S	S	*	*			trans	-84.2	117	172.9	0	0	0	0	0	111.1	A5 Q9	A5-G7 PolarHBondContact O-N 3.08Å; G7-Q9 PolarHBondContact O-N 3.01Å
8	V	56.3	Low	61.6	Low	105 Å²	105	119.5 Å²	119.5	64%	0.636	66%	0.657	S	S	*	*			trans	-60.1	109.4	168.2	176.6	0	0	0	0	108.4	L10 L35	V8-L10 PolarHBondContact O-N 2.85Å; V8-L35 HydrophobicContact CG1-CD2 4.13Å
9	Q	56.1	Low	62.4	Low	151 Å²	151	115.2 Å²	115.2	71%	0.706	63%	0.634	S	S	*	*			trans	-80.1	111.6	176.7	-79.3	-72.7	-55.1	0	0	109.6	G7 A11	G7-Q9 PolarHBondContact O-N 3.01Å; Q9-A11 PolarHBondContact O-N 3Å
10	L	57.4	Low	63.3	Low	96 Å²	96	114.7 Å²	114.7	50%	0.503	64%	0.635	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-85.5	100.8	174.9	-166.7	66.1	0	0	0	109.4	V8 L33 L35	V8-L10 PolarHBondContact O-N 2.85Å; L10-L33 HydrophobicContact CD1-CD1 3.47Å; L10-L33 VanDerWaalsContact CD1-CD1 3.47Å; L10-L33 HydrophobicContact CD1-CD2 3.89Å; L10-L33 HydrophobicContact CD1-CG 3.51Å; L10-L33 HydrophobicContact CD2-CD1 3.79Å; L10-L33 HydrophobicContact CG-CD1 3.5Å; L10-L33 VanDerWaalsContact CG-CD1 3.5Å; L10-L33 HydrophobicContact CG-CG 4.14Å; L10-L35 HydrophobicContact CD1-CD2 4.06Å; L10-L35 HydrophobicContact CD1-CG 4.23Å
11	A	62.7	Low	64.1	Low	38 Å²	38	113.2 Å²	113.2	31%	0.314	63%	0.629	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-92.2	122.5	176.5	0	0	0	0	0	110.1	Q9 C34	Q9-A11 PolarHBondContact O-N 3Å; A11-C34 HydrophobicContact CB-CB 4.31Å; A11-C34 PolarHBondContact N-O 3.08Å; A11-C34 WeakPolarHBondContact O-CB 3.47Å; A11-C34 PolarHBondContact O-N 2.82Å
12	R	64.5	Low	65.4	Low	182 Å²	182	109.5 Å²	109.5	69%	0.687	61%	0.614	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-91.5	116.8	172.2	-63.8	175.9	75.3	-179	3.9	108.6	L33	R12-L33 HydrophobicContact CG-CD1 3.99Å
13	K	70.3	Confident	67.1	Low	124 Å²	124	105.4 Å²	105.4	54%	0.539	61%	0.611	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-109.4	132.3	173	-63.8	-178.3	-179.7	-176.4	0	108.4	L32	K13-L32 PolarHBondContact N-O 3.26Å; K13-L32 PolarHBondContact O-N 3.15Å
14	S	72.3	Confident	68.3	Low	52 Å²	52	102.7 Å²	102.7	36%	0.364	60%	0.598	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-104.2	132.1	171.9	-168.3	0	0	0	0	108.9	A30	S14-A30 WeakPolarHBondContact CA-O 3.49Å
15	L	74.4	Confident	69.9	Low	109 Å²	109	102.7 Å²	102.7	57%	0.571	60%	0.595	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-106.3	118	168.9	-179.1	63.8	0	0	0	108.5	C29 A30	L15-C29 WeakPolarHBondContact O-CA 3.28Å; L15-A30 PolarHBondContact N-O 2.9Å; L15-A30 PolarHBondContact O-N 3.14Å
16	T	76.6	Confident	71	Confident	85 Å²	85	105.6 Å²	105.6	52%	0.521	58%	0.584	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-100.7	120.2	173.5	-57.4	0	0	0	0	109.1	V27 L28 C29	T16-V27 HydrophobicContact CG2-CG1 3.21Å; T16-L28 CarbonylContact C-O 3.55Å; T16-L28 WeakPolarHBondContact CA-O 3.45Å; T16-C29 PolarHBondContact OG1-SG 2.86Å; T16-C29 VanDerWaalsContact OG1-SG 3.38Å
17	R	78.1	Confident	72.3	Confident	172 Å²	172	103.6 Å²	103.6	65%	0.649	57%	0.572	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-121.7	116.2	176.2	-174.5	176.5	178.6	-174.6	-1.1	109.6	T19 L28	R17-T19 HydrophobicContact CG-CG2 4.17Å; R17-L28 PolarHBondContact N-O 3.48Å; R17-L28 PolarHBondContact O-N 3.38Å
18	A	80.7	Confident	73.6	Confident	66 Å²	66	105.7 Å²	105.7	55%	0.545	57%	0.569	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-77	130.8	167.5	0	0	0	0	0	109.6	T25 R26 V27	A18-T25 HydrophobicContact CB-CG2 4.25Å; A18-R26 CarbonylContact C-O 3.57Å; A18-R26 WeakPolarHBondContact CA-O 3.45Å; A18-V27 HydrophobicContact CB-CG2 4.39Å
19	T	76.8	Confident	74.7	Confident	37 Å²	37	104.3 Å²	104.3	23%	0.227	56%	0.563	C	S	.	*	E	Extended strand (participates in β ladder)	trans	-125.8	127.4	172.3	58.7	0	0	0	0	108.3	R17 R26 L28	R17-T19 HydrophobicContact CG-CG2 4.17Å; T19-R26 PolarHBondContact N-O 2.99Å; T19-R26 PolarHBondContact O-N 3.31Å; T19-R26 VanDerWaalsContact O-O 3.12Å; T19-R26 PolarHBondContact OG1-O 3.08Å; T19-L28 HydrophobicContact CG2-CD1 4.24Å
20	T	81.4	Confident	75.6	Confident	105 Å²	105	99.7 Å²	99.7	64%	0.644	55%	0.551	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-93	118.2	173.6	52	0	0	0	0	108.6	E24 T25	T20-E24 CarbonylContact C-O 3.52Å; T20-E24 VanDerWaalsContact CA-O 3.28Å; T20-E24 WeakPolarHBondContact CA-O 3.39Å; T20-T25 HydrophobicContact CG2-CG2 4.23Å; T20-T25 WeakPolarHBondContact CG2-OG1 3.38Å
21	V	80.3	Confident	76.7	Confident	84 Å²	84	103.1 Å²	103.1	51%	0.509	56%	0.557	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-124.6	124.1	176.1	-174.9	0	0	0	0	107.5	G23 E24	V21-G23 VanDerWaalsContact C-N 3.29Å; V21-G23 PolarHBondContact O-N 3.13Å; V21-E24 PolarHBondContact N-O 3.47Å; V21-E24 WeakPolarHBondContact O-CB 3.45Å; V21-E24 PolarHBondContact O-N 2.77Å
22	N	74.2	Confident	77.1	Confident	160 Å²	160	106.3 Å²	106.3	86%	0.856	57%	0.568	S	S	*	*	T	Hydrogen-bonded Turn	trans	57.1	36	179.7	-157.2	25.2	0	0	0	114.9	E24	N22-E24 PolarHBondContact O-N 3.3Å
23	G	82.4	Confident	77.6	Confident	80 Å²	80	102.7 Å²	102.7	83%	0.825	56%	0.562	S	S	*	*	T	Hydrogen-bonded Turn	trans	78.1	-7.5	-175.2	0	0	0	0	0	114.6	V21	V21-G23 VanDerWaalsContact C-N 3.29Å; V21-G23 PolarHBondContact O-N 3.13Å
24	E	74.9	Confident	77.3	Confident	130 Å²	130	98.6 Å²	98.6	61%	0.607	55%	0.549	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-92.6	126	175.2	-60.4	-175.2	123.6	0	0	110.5	T20 V21 N22 R26	T20-E24 CarbonylContact C-O 3.52Å; T20-E24 VanDerWaalsContact CA-O 3.28Å; T20-E24 WeakPolarHBondContact CA-O 3.39Å; V21-E24 PolarHBondContact N-O 3.47Å; V21-E24 WeakPolarHBondContact O-CB 3.45Å; V21-E24 PolarHBondContact O-N 2.77Å; N22-E24 PolarHBondContact O-N 3.3Å; E24-R26 PolarHBondContact O-N 2.77Å
25	T	81.9	Confident	77	Confident	96 Å²	96	101 Å²	101	59%	0.589	56%	0.557	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-83.5	114.2	173.4	-54.6	0	0	0	0	109.4	A18 T20	A18-T25 HydrophobicContact CB-CG2 4.25Å; T20-T25 HydrophobicContact CG2-CG2 4.23Å; T20-T25 WeakPolarHBondContact CG2-OG1 3.38Å
26	R	79.9	Confident	76.5	Confident	160 Å²	160	102.2 Å²	102.2	60%	0.604	56%	0.559	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-107.5	131.3	175.3	-55.6	-175.1	79.2	-170.5	5.1	109.1	A18 T19 E24	A18-R26 CarbonylContact C-O 3.57Å; A18-R26 WeakPolarHBondContact CA-O 3.45Å; T19-R26 PolarHBondContact N-O 2.99Å; T19-R26 PolarHBondContact O-N 3.31Å; T19-R26 VanDerWaalsContact O-O 3.12Å; T19-R26 PolarHBondContact OG1-O 3.08Å; E24-R26 PolarHBondContact O-N 2.77Å
27	V	83.2	Confident	75.5	Confident	88 Å²	88	105.7 Å²	105.7	53%	0.533	57%	0.569	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-101.3	119.3	177.9	-179.9	0	0	0	0	108.9	T16 A18	T16-V27 HydrophobicContact CG2-CG1 3.21Å; A18-V27 HydrophobicContact CB-CG2 4.39Å
28	L	81.1	Confident	74.3	Confident	100 Å²	100	101.8 Å²	101.8	52%	0.524	57%	0.574	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-99.3	118.7	175.6	-60.9	176.4	0	0	0	109.1	T16 R17 T19	T16-L28 CarbonylContact C-O 3.55Å; T16-L28 WeakPolarHBondContact CA-O 3.45Å; R17-L28 PolarHBondContact N-O 3.48Å; R17-L28 PolarHBondContact O-N 3.38Å; T19-L28 HydrophobicContact CG2-CD1 4.24Å
29	C	78.5	Confident	72.9	Confident	75 Å²	75	105.8 Å²	105.8	51%	0.507	59%	0.586	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-103.5	119	171	-69	0	0	0	0	109.1	L15 T16	L15-C29 WeakPolarHBondContact O-CA 3.28Å; T16-C29 PolarHBondContact OG1-SG 2.86Å; T16-C29 VanDerWaalsContact OG1-SG 3.38Å
30	A	76.4	Confident	71.9	Confident	54 Å²	54	109.5 Å²	109.5	45%	0.446	61%	0.611	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-113	126.8	173.6	0	0	0	0	0	109.6	S14 L15	S14-A30 WeakPolarHBondContact CA-O 3.49Å; L15-A30 PolarHBondContact N-O 2.9Å; L15-A30 PolarHBondContact O-N 3.14Å
31	W	79.2	Confident	70.6	Confident	168 Å²	168	110.7 Å²	110.7	64%	0.636	62%	0.617	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-92.4	123.6	175.4	-66.9	94.4	0	0	0	109.9
32	L	72.1	Confident	69.2	Low	106 Å²	106	113.4 Å²	113.4	56%	0.555	64%	0.635	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-104.8	127.3	172.7	-74.8	162.6	0	0	0	109.3	K13	K13-L32 PolarHBondContact N-O 3.26Å; K13-L32 PolarHBondContact O-N 3.15Å
33	L	75	Confident	68.2	Low	105 Å²	105	109.8 Å²	109.8	55%	0.55	63%	0.627	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-90.6	106.9	172.6	-163.8	63.3	0	0	0	108.5	L10 R12	L10-L33 HydrophobicContact CD1-CD1 3.47Å; L10-L33 VanDerWaalsContact CD1-CD1 3.47Å; L10-L33 HydrophobicContact CD1-CD2 3.89Å; L10-L33 HydrophobicContact CD1-CG 3.51Å; L10-L33 HydrophobicContact CD2-CD1 3.79Å; L10-L33 HydrophobicContact CG-CD1 3.5Å; L10-L33 VanDerWaalsContact CG-CD1 3.5Å; L10-L33 HydrophobicContact CG-CG 4.14Å; R12-L33 HydrophobicContact CG-CD1 3.99Å
34	C	64.6	Low	66.7	Low	38 Å²	38	110.1 Å²	110.1	26%	0.257	62%	0.622	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-88.8	109.4	174.8	-68.3	0	0	0	0	109.1	A11 H36	A11-C34 HydrophobicContact CB-CB 4.31Å; A11-C34 PolarHBondContact N-O 3.08Å; A11-C34 WeakPolarHBondContact O-CB 3.47Å; A11-C34 PolarHBondContact O-N 2.82Å; C34-H36 PolarHBondContact O-N 2.86Å
35	L	65.6	Low	65.6	Low	104 Å²	104	109.1 Å²	109.1	55%	0.545	64%	0.636	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-81.6	104.3	162.2	-76.7	150.4	0	0	0	107.5	V8 L10 H37	V8-L35 HydrophobicContact CG1-CD2 4.13Å; L10-L35 HydrophobicContact CD1-CD2 4.06Å; L10-L35 HydrophobicContact CD1-CG 4.23Å; L35-H37 PolarHBondContact O-N 2.95Å; L35-H37 VanDerWaalsContact O-N 3.12Å
36	H	62.7	Low	64.1	Low	133 Å²	133	108.4 Å²	108.4	62%	0.616	65%	0.647	S	S	*	*			trans	-71.8	100.5	166.2	-112.1	-96.7	0	0	0	107.5	C34 A38	C34-H36 PolarHBondContact O-N 2.86Å; H36-A38 PolarHBondContact O-N 2.88Å
37	H	56.1	Low	62.6	Low	159 Å²	159	105 Å²	105	74%	0.736	66%	0.663	S	S	*	*	P	Polyproline II helix	trans	-69.3	116.8	163.3	-71.8	89.1	0	0	0	106.6	L35 D39	L35-H37 PolarHBondContact O-N 2.95Å; L35-H37 VanDerWaalsContact O-N 3.12Å; H37-D39 PolarHBondContact O-N 2.8Å
38	A	52.9	Low	61.3	Low	89 Å²	89	104.5 Å²	104.5	74%	0.736	68%	0.675	S	S	*	*	P	Polyproline II helix	trans	-61.6	127	165.8	0	0	0	0	0	107.4	H36	H36-A38 PolarHBondContact O-N 2.88Å
39	D	52.5	Low	59.6	Low	150 Å²	150	108.3 Å²	108.3	80%	0.802	70%	0.696	S	S	*	*	P	Polyproline II helix	trans	-46.5	127.1	177.9	-69.9	-70.1	0	0	0	110.3	H37 V41	H37-D39 PolarHBondContact O-N 2.8Å; D39-V41 PolarHBondContact O-N 2.82Å
40	P	54.1	Low	58.4	Low	116 Å²	116	108 Å²	108	75%	0.753	71%	0.705	S	S	*	*			trans	-65.9	107.9	163.9	28.2	-29.5	0	0	0	105.9	T42	P40-T42 PolarHBondContact O-N 2.71Å
41	V	54	Low	57.6	Low	129 Å²	129	116.8 Å²	116.8	78%	0.782	73%	0.727	S	S	*	*			trans	-38.3	119.2	166.8	58.5	0	0	0	0	108.6	D39 A43	D39-V41 PolarHBondContact O-N 2.82Å; V41-A43 PolarHBondContact O-N 2.84Å
42	T	51.8	Low	56.1	Low	142 Å²	142	115.2 Å²	115.2	87%	0.871	74%	0.736	S	S	*	*			trans	-62.6	82.7	178.6	-59.2	0	0	0	0	109	P40	P40-T42 PolarHBondContact O-N 2.71Å
43	A	52.8	Low	55.3	Low	84 Å²	84	114.8 Å²	114.8	69%	0.694	75%	0.748	S	S	*	*			trans	-95.7	93.1	163.2	0	0	0	0	0	105.7	V41	V41-A43 PolarHBondContact O-N 2.84Å
44	A	51.3	Low	54.7	Low	87 Å²	87	115.4 Å²	115.4	72%	0.719	76%	0.756	S	S	*	*				70	108.4	92.9	0	0	0	0	0	112.8
45	A	51.9	Low	54.4	Low	109 Å²	109	119 Å²	119	90%	0.901	78%	0.779	S	S	*	*			trans	70.3	128	140.6	0	0	0	0	0	120.4
46	G	50.9	Low	53.9	Low	80 Å²	80	122.3 Å²	122.3	83%	0.825	80%	0.796	S	S	*	*			trans	104.1	107	165.7	0	0	0	0	0	111.5
47	G	48.3	Very low	53.7	Low	90 Å²	90	121.7 Å²	121.7	93%	0.928	80%	0.797	S	S	*	*			cis	86.4	96.2	46.2	0	0	0	0	0	108.3
48	G	55.1	Low	53.6	Low	77 Å²	77	119.8 Å²	119.8	79%	0.794	80%	0.799	S	S	*	*			trans	166	93.2	176.6	0	0	0	0	0	113.6
49	D	45.3	Very low	53.5	Low	179 Å²	179	119.6 Å²	119.6	96%	0.957	79%	0.792	S	S	*	*			trans	-56.2	128.3	166.1	-64.8	-66.1	0	0	0	111.1
50	G	53.2	Low	53.6	Low	69 Å²	69	117.8 Å²	117.8	71%	0.711	79%	0.789	S	S	*	*			trans	166.2	97.4	173.6	0	0	0	0	0	115.2
51	R	60.1	Low	53.2	Low	238 Å²	238	119.7 Å²	119.7	90%	0.898	79%	0.792	S	S	*	*			trans	64.3	93.2	155.2	-64.9	-172.8	168.2	121.1	-1	116.8	A53	R51-A53 PolarHBondContact O-N 2.78Å; R51-A53 VanDerWaalsContact O-N 3.12Å
52	T	49	Very low	52.9	Low	136 Å²	136	122.6 Å²	122.6	83%	0.834	79%	0.794	S	S	*	*			trans	-2.3	94.8	142.8	50.9	0	0	0	0	115.9
53	A	54.6	Low	52.2	Low	97 Å²	97	124.4 Å²	124.4	80%	0.802	80%	0.798	S	S	*	*			trans	-94.1	96.7	158.4	0	0	0	0	0	107.4	R51	R51-A53 PolarHBondContact O-N 2.78Å; R51-A53 VanDerWaalsContact O-N 3.12Å
54	V	61	Low	51.8	Low	117 Å²	117	125.8 Å²	125.8	71%	0.709	80%	0.798	S	S	*	*			trans	-69.9	124.7	176.9	-162.6	0	0	0	0	107.8	L56	V54-L56 PolarHBondContact O-N 2.98Å
55	P	59.6	Low	51.7	Low	114 Å²	114	127.8 Å²	127.8	74%	0.74	80%	0.801	S	S	*	*			trans	-65.6	123.3	169.9	-14.3	28.7	0	0	0	108.5	D57	P55-D57 PolarHBondContact O-N 2.87Å
56	L	55.1	Low	51.8	Low	173 Å²	173	134.1 Å²	134.1	91%	0.906	80%	0.801	S	S	*	*			trans	-67	105	173.6	-65	171.3	0	0	0	108.6	V54	V54-L56 PolarHBondContact O-N 2.98Å
57	D	59.2	Low	51.5	Low	121 Å²	121	136.3 Å²	136.3	65%	0.647	80%	0.801	S	S	*	*			trans	-60.7	128.5	172.1	174.4	72.4	0	0	0	111	P55 S59	P55-D57 PolarHBondContact O-N 2.87Å; D57-S59 PolarHBondContact O-N 3.41Å; D57-S59 VanDerWaalsContact O-N 3.1Å; D57-S59 PolarHBondContact OD2-N 2.93Å; D57-S59 PolarHBondContact OD2-OG 3.21Å
58	P	54	Low	51.6	Low	118 Å²	118	140.8 Å²	140.8	77%	0.766	80%	0.798	S	S	*	*			trans	-80.5	88.7	169.4	32.3	-29.9	0	0	0	109.1	P60	P58-P60 WeakPolarHBondContact O-CD 3.48Å
59	S	50.6	Low	51.4	Low	85 Å²	85	146.3 Å²	146.3	59%	0.594	80%	0.803	S	S	*	*			trans	-57	134	176.2	-59.5	0	0	0	0	113.4	D57	D57-S59 PolarHBondContact O-N 3.41Å; D57-S59 VanDerWaalsContact O-N 3.1Å; D57-S59 PolarHBondContact OD2-N 2.93Å; D57-S59 PolarHBondContact OD2-OG 3.21Å
60	P	53.2	Low	51.6	Low	112 Å²	112	148.9 Å²	148.9	73%	0.727	80%	0.8	S	S	*	*			trans	-100.1	108.4	147.7	25.8	-10.9	0	0	0	108.9	P58 F62	P58-P60 WeakPolarHBondContact O-CD 3.48Å; P60-F62 PolarHBondContact O-N 3.45Å
61	L	46.8	Very low	51.6	Low	156 Å²	156	151.5 Å²	151.5	82%	0.817	80%	0.802	S	S	*	*			trans	-61	93.6	174.5	-64.5	170.4	0	0	0	111.8
62	F	47.6	Very low	51.3	Low	190 Å²	190	146.3 Å²	146.3	83%	0.833	80%	0.796	S	S	*	*			trans	-146	69.1	162	-74.3	-79.3	0	0	0	111.2	P60	P60-F62 PolarHBondContact O-N 3.45Å
63	L	36.5	Very low	51.3	Low	181 Å²	181	142.5 Å²	142.5	95%	0.948	78%	0.784	S	S	*	*			trans	-90.6	94.2	162.7	-73.8	170.6	0	0	0	108.5
64	T	45	Very low	51.2	Low	113 Å²	113	144.3 Å²	144.3	69%	0.693	79%	0.788	S	S	*	*			trans	-134.6	129.7	154.8	92.7	0	0	0	0	109.4
65	T	48.1	Very low	50.7	Low	128 Å²	128	142.5 Å²	142.5	79%	0.785	79%	0.785	S	S	*	*	S	Bend	trans	82.9	98.2	156.2	66.1	0	0	0	0	120.3
66	R	54.2	Low	50.1	Low	242 Å²	242	144.2 Å²	144.2	91%	0.913	79%	0.788	S	S	*	*			trans	76.4	109	139.9	-72.7	-170	168	-173.3	-2.8	119.9
67	P	45	Very low	49.8	Very low	127 Å²	127	141.3 Å²	141.3	83%	0.825	78%	0.782	S	S	*	*			trans	-99.6	107.5	173.3	35.3	-23.4	0	0	0	110.9
68	E	50.2	Low	49.5	Very low	183 Å²	183	144.7 Å²	144.7	86%	0.855	79%	0.794	S	S	*	*			trans	-170	100.2	152.3	-125.5	-165.7	115.6	0	0	108.9
69	Q	51	Low	49.5	Very low	194 Å²	194	149.7 Å²	149.7	91%	0.907	80%	0.798	S	S	*	*			trans	-166.9	98.2	145.7	-82.4	-130	-68.6	0	0	107.6	T71	Q69-T71 PolarHBondContact O-N 3.12Å
70	R	50.7	Low	49.7	Very low	233 Å²	233	149.9 Å²	149.9	88%	0.879	80%	0.804	S	S	*	*			trans	-54.5	129.9	155.4	-73	174.6	161.7	98.1	-1.7	107.3
71	T	52.4	Low	49.9	Very low	124 Å²	124	155.7 Å²	155.7	76%	0.761	81%	0.812	S	S	*	*			trans	-179.7	118.9	148.6	-77.9	0	0	0	0	109.6	Q69	Q69-T71 PolarHBondContact O-N 3.12Å
72	V	54.6	Low	50.7	Low	128 Å²	128	153.6 Å²	153.6	78%	0.776	81%	0.809	S	S	*	*			trans	67.4	107.7	153.1	179.3	0	0	0	0	117.4
73	G	47.1	Very low	51.4	Low	57 Å²	57	153.8 Å²	153.8	59%	0.588	81%	0.806	S	S	*	*			trans	-66.4	156.9	162.6	0	0	0	0	0	111.1	A75	G73-A75 PolarHBondContact O-N 3.06Å
74	P	53.7	Low	52.9	Low	135 Å²	135	150.4 Å²	150.4	88%	0.877	79%	0.794	S	S	*	*			trans	-74.9	77.5	-179.3	31.8	-33.8	0	0	0	110.7
75	A	50.1	Low	53.7	Low	78 Å²	78	154.4 Å²	154.4	65%	0.645	80%	0.802	S	S	*	*			trans	-75.2	150.7	138.1	0	0	0	0	0	107.2	G73	G73-A75 PolarHBondContact O-N 3.06Å
76	D	47	Very low	54.3	Low	150 Å²	150	155.4 Å²	155.4	80%	0.802	80%	0.802	S	S	*	*			trans	78.7	69.5	-177.5	-67.7	-77.2	0	0	0	116.9
77	S	49.2	Very low	54.5	Low	113 Å²	113	147.6 Å²	147.6	79%	0.79	80%	0.797	S	S	*	*			trans	-139.6	33.4	144.8	-74	0	0	0	0	112.5	R79	S77-R79 PolarHBondContact O-N 3.36Å
78	E	52.8	Low	55.3	Low	192 Å²	192	150.4 Å²	150.4	90%	0.897	80%	0.8	S	S	*	*			trans	-67.7	64.5	150.9	-169.7	-176.8	117.1	0	0	108.6
79	R	54.1	Low	56	Low	223 Å²	223	149.6 Å²	149.6	84%	0.842	80%	0.8	S	S	*	*			trans	-105.1	90.9	162.6	-76.3	-176.9	176.9	-95.8	-0.8	105.6	S77 R81	S77-R79 PolarHBondContact O-N 3.36Å; R79-R81 PolarHBondContact O-N 2.81Å
80	A	53.6	Low	56.3	Low	89 Å²	89	145.3 Å²	145.3	74%	0.736	79%	0.79	S	S	*	*			trans	-37.7	90.1	158.9	0	0	0	0	0	109.3	C82	A80-C82 PolarHBondContact O-N 3.48Å
81	R	58.7	Low	56.4	Low	234 Å²	234	143 Å²	143	88%	0.883	79%	0.792	S	S	*	*			trans	-75.2	86.7	176.5	-166.2	175.5	-168.8	-91.3	0.7	104.5	R79 Y83	R79-R81 PolarHBondContact O-N 2.81Å; R81-Y83 PolarHBondContact O-N 3.37Å
82	C	62.5	Low	56.7	Low	112 Å²	112	141.1 Å²	141.1	76%	0.757	78%	0.783	S	S	*	*			trans	-45.6	104.5	176.3	-66.6	0	0	0	0	108	A80 P84	A80-C82 PolarHBondContact O-N 3.48Å; C82-P84 WeakPolarHBondContact O-CD 3.49Å
83	Y	63.1	Low	56.8	Low	194 Å²	194	146.8 Å²	146.8	76%	0.761	79%	0.791	S	S	*	*			trans	-64.3	118.2	166.7	-149.3	-90.9	0	0	0	104.8	R81 K85	R81-Y83 PolarHBondContact O-N 3.37Å; Y83-K85 PolarHBondContact O-N 3Å
84	P	67.1	Low	57.3	Low	109 Å²	109	150.8 Å²	150.8	71%	0.708	80%	0.804	S	S	*	*			trans	-58.6	115.3	174.4	23.7	-29.6	0	0	0	106.2	C82 D86	C82-P84 WeakPolarHBondContact O-CD 3.49Å; P84-D86 PolarHBondContact O-N 3.31Å; P84-D86 VanDerWaalsContact O-N 3.13Å
85	K	63.4	Low	58.1	Low	198 Å²	198	152.9 Å²	152.9	86%	0.861	80%	0.8	S	S	*	*			trans	-53.8	120.6	173.6	-79	-79.4	-176.7	-169.4	0	106.5	Y83 G87	Y83-K85 PolarHBondContact O-N 3Å; K85-G87 PolarHBondContact O-N 3.01Å
86	D	59.3	Low	58.8	Low	148 Å²	148	153.9 Å²	153.9	79%	0.791	80%	0.8	S	S	*	*	T	Hydrogen-bonded Turn	trans	-40.3	126.8	176	-58.1	-71.8	0	0	0	111.3	P84	P84-D86 PolarHBondContact O-N 3.31Å; P84-D86 VanDerWaalsContact O-N 3.13Å
87	G	59.2	Low	59.2	Low	78 Å²	78	155.4 Å²	155.4	80%	0.804	80%	0.802	S	S	*	*	T	Hydrogen-bonded Turn	trans	119	8.8	148	0	0	0	0	0	121.2	K85	K85-G87 PolarHBondContact O-N 3.01Å
88	E	61.8	Low	59.8	Low	187 Å²	187	157.6 Å²	157.6	87%	0.874	80%	0.8	S	S	*	*			trans	-101.4	88.3	174.6	-153.8	172.2	-164	0	0	112.9	C90	E88-C90 PolarHBondContact O-N 3.11Å; E88-C90 VanDerWaalsContact O-N 3.08Å
89	L	63.8	Low	60.3	Low	165 Å²	165	154.5 Å²	154.5	86%	0.864	79%	0.794	S	S	*	*			trans	-69.2	91.2	163	-74.3	163.6	0	0	0	108.8	M91	L89-M91 PolarHBondContact O-N 2.96Å
90	C	57.7	Low	60.6	Low	104 Å²	104	151.1 Å²	151.1	70%	0.703	79%	0.792	S	S	*	*			trans	-69.8	98.4	171.3	-169.3	0	0	0	0	109.8	E88 S92	E88-C90 PolarHBondContact O-N 3.11Å; E88-C90 VanDerWaalsContact O-N 3.08Å; C90-S92 VanDerWaalsContact C-N 3.34Å; C90-S92 PolarHBondContact O-N 2.94Å; C90-S92 PolarHBondContact SG-OG 3.39Å; C90-S92 VanDerWaalsContact SG-OG 3.39Å
91	M	53.9	Low	60.8	Low	186 Å²	186	152.7 Å²	152.7	92%	0.916	79%	0.792	S	S	*	*			trans	-69.5	82.2	171.7	-60.9	-173.3	87	0	0	110.3	L89	L89-M91 PolarHBondContact O-N 2.96Å
92	S	57.6	Low	61	Low	83 Å²	83	150.3 Å²	150.3	58%	0.58	79%	0.791	S	S	*	*			trans	-167.1	65.8	170.3	57.1	0	0	0	0	114.1	C90	C90-S92 VanDerWaalsContact C-N 3.34Å; C90-S92 PolarHBondContact O-N 2.94Å; C90-S92 PolarHBondContact SG-OG 3.39Å; C90-S92 VanDerWaalsContact SG-OG 3.39Å
93	R	57	Low	60.6	Low	247 Å²	247	151.1 Å²	151.1	93%	0.932	79%	0.792	S	S	*	*			trans	-138.4	87	146.7	-74.4	-172.3	77.3	-179.6	1.4	109.5
94	T	58.2	Low	60.8	Low	142 Å²	142	153.3 Å²	153.3	87%	0.871	80%	0.799	S	S	*	*	P	Polyproline II helix	trans	-50.5	133	161.3	-10.5	0	0	0	0	109.3
95	K	69.8	Low	60.3	Low	179 Å²	179	153.2 Å²	153.2	78%	0.778	80%	0.801	S	S	*	*	P	Polyproline II helix	trans	-52.6	132.8	179.2	-172.1	-176.1	-177.8	-170.8	0	111.3	E97	K95-E97 PolarHBondContact O-N 3.1Å
96	P	65.3	Low	60	Low	99 Å²	99	147.4 Å²	147.4	64%	0.643	80%	0.797	S	S	*	*	P	Polyproline II helix	trans	-78.3	118.2	161.4	31	-28.1	0	0	0	108.3	E98	P96-E98 HydrophobicContact CB-CG 4.13Å
97	E	55	Low	59.9	Low	182 Å²	182	146.4 Å²	146.4	85%	0.85	80%	0.796	S	S	*	*			trans	-93.4	89.5	167.2	-174.5	174.8	122.5	0	0	107.2	K95	K95-E97 PolarHBondContact O-N 3.1Å
98	E	61	Low	60.1	Low	159 Å²	159	149.3 Å²	149.3	74%	0.743	79%	0.793	S	S	*	*			trans	-173.3	133.9	177.6	54	-177.9	128.3	0	0	106.2	P96	P96-E98 HydrophobicContact CB-CG 4.13Å
99	T	64.6	Low	60.1	Low	127 Å²	127	146.3 Å²	146.3	78%	0.779	79%	0.787	S	S	*	*			cis	-159.8	152.7	6.5	-74.1	0	0	0	0	107.4
100	L	60.3	Low	60.3	Low	152 Å²	152	145.8 Å²	145.8	80%	0.796	78%	0.78	S	S	*	*			trans	-50.6	141.7	179.2	-62.9	158.2	0	0	0	115.1
101	V	57.6	Low	60.6	Low	122 Å²	122	148.2 Å²	148.2	74%	0.739	79%	0.785	S	S	*	*			trans	54.4	117.1	135	-177.2	0	0	0	0	118.2
102	E	63.7	Low	61.5	Low	183 Å²	183	144.9 Å²	144.9	86%	0.855	78%	0.775	S	S	*	*				-149.2	121.8	121.9	-101.9	-174.3	170.8	0	0	110	R104	E102-R104 PolarHBondContact O-N 3.31Å; E102-R104 VanDerWaalsContact O-N 3.17Å
103	V	54.2	Low	62.3	Low	129 Å²	129	151.2 Å²	151.2	78%	0.782	79%	0.786	S	S	*	*			trans	-68.6	103	174.1	172.3	0	0	0	0	108.2	S105	V103-S105 PolarHBondContact O-N 3.13Å
104	R	65.6	Low	62.9	Low	241 Å²	241	145.3 Å²	145.3	91%	0.909	78%	0.78	S	S	*	*			trans	-87.6	84.9	166.8	-61.3	-172.2	83.9	-179.6	5.9	108.8	E102	E102-R104 PolarHBondContact O-N 3.31Å; E102-R104 VanDerWaalsContact O-N 3.17Å
105	S	57.3	Low	63.5	Low	107 Å²	107	145.1 Å²	145.1	75%	0.748	78%	0.779	S	S	*	*			trans	-72.7	130.9	164.1	66.3	0	0	0	0	109.8	V103	V103-S105 PolarHBondContact O-N 3.13Å
106	G	57.1	Low	63	Low	75 Å²	75	142.3 Å²	142.3	77%	0.773	78%	0.781	S	S	*	*			trans	98.9	93.6	158.7	0	0	0	0	0	115.4
107	V	57.4	Low	62.7	Low	127 Å²	127	145.4 Å²	145.4	77%	0.77	81%	0.814	S	S	*	*				-169.2	132.5	97.3	85.5	0	0	0	0	108.4	V109	V107-V109 HydrophobicContact CG1-CG1 4.41Å; V107-V109 PolarHBondContact O-N 3.39Å; V107-V109 VanDerWaalsContact O-N 3.08Å
108	D	63.4	Low	63.1	Low	139 Å²	139	143.6 Å²	143.6	74%	0.743	81%	0.812	S	S	*	*			trans	-64	104.4	173.9	-130.5	-32.2	0	0	0	108.1	Q110	D108-Q110 PolarHBondContact O-N 3.06Å
109	V	62.2	Low	63.2	Low	125 Å²	125	142.7 Å²	142.7	76%	0.758	82%	0.816	S	S	*	*			trans	-75.5	71.7	172.6	-81.6	0	0	0	0	108.7	V107 I111	V107-V109 HydrophobicContact CG1-CG1 4.41Å; V107-V109 PolarHBondContact O-N 3.39Å; V107-V109 VanDerWaalsContact O-N 3.08Å; V109-I111 PolarHBondContact O-N 2.75Å; V109-I111 VanDerWaalsContact O-N 3.15Å
110	Q	68.1	Low	63.1	Low	153 Å²	153	143.6 Å²	143.6	72%	0.715	82%	0.818	S	S	*	*			trans	-61.1	114.1	167.4	-73.6	-173.5	58.1	0	0	108.5	D108 T112	D108-Q110 PolarHBondContact O-N 3.06Å; Q110-T112 PolarHBondContact O-N 3.07Å
111	I	63.3	Low	63.3	Low	155 Å²	155	143.1 Å²	143.1	80%	0.795	82%	0.819	S	S	*	*			trans	-72.6	83.6	171.4	-57.5	174	0	0	0	107.2	V109 R113	V109-I111 PolarHBondContact O-N 2.75Å; V109-I111 VanDerWaalsContact O-N 3.15Å; I111-R113 PolarHBondContact O-N 3.29Å; I111-R113 VanDerWaalsContact O-N 3.14Å
112	T	72.3	Confident	63.7	Low	117 Å²	117	144.4 Å²	144.4	72%	0.718	82%	0.824	S	S	*	*			trans	-69.1	106.3	169.4	-58.7	0	0	0	0	108.1	Q110 P114	Q110-T112 PolarHBondContact O-N 3.07Å; T112-P114 WeakPolarHBondContact O-CD 3.46Å
113	R	74.2	Confident	63.7	Low	215 Å²	215	141.9 Å²	141.9	81%	0.811	82%	0.822	S	S	*	*			trans	-68.6	122.2	166.8	-66.1	-173.3	173.6	-163.2	-1.9	107.7	I111 T115	I111-R113 PolarHBondContact O-N 3.29Å; I111-R113 VanDerWaalsContact O-N 3.14Å; R113-T115 PolarHBondContact O-N 3.12Å; R113-T115 VanDerWaalsContact O-N 3.08Å
114	P	70.6	Confident	64.3	Low	124 Å²	124	142.8 Å²	142.8	81%	0.805	83%	0.825	S	S	*	*			trans	-70.6	108.1	173	27.8	-30.4	0	0	0	108.3	T112	T112-P114 WeakPolarHBondContact O-CD 3.46Å
115	T	70.8	Confident	64.2	Low	137 Å²	137	135.2 Å²	135.2	84%	0.84	82%	0.819	S	S	*	*			trans	-84	105.8	160.4	-46.5	0	0	0	0	106	R113	R113-T115 PolarHBondContact O-N 3.12Å; R113-T115 VanDerWaalsContact O-N 3.08Å
116	C	59.9	Low	64.8	Low	121 Å²	121	137.6 Å²	137.6	82%	0.818	82%	0.824	S	S	*	*			trans	-69.6	132.8	170.8	-172.8	0	0	0	0	108.7
117	A	58.7	Low	65.5	Low	163 Å²	163	143.3 Å²	143.3	100%	1.347	83%	0.829	S	S	*	*			trans	-62.2	0	171.1	0	0	0	0	0	112.5

Retrieved 117 of 117 residues in 61.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).