A0A077ZMN7_TRITR Loading...

Mobilization protein

AlphaFold DB , UniProt , Accession A0A077ZMN7, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 84 aa.

						>A0A077ZMN7_TRITR|A0A077ZMN7
MSRTLEQKIADAEARLQRLKAKSRSLDTAQKVIVGAALLAKVRKPEEVQLRAWLLQFLKAEVTRQADVTRILPLINELEALPEQ
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	64.6	Low	89.9	Confident	243 Å²	243	118.5 Å²	118.5	100%	1.197	61%	0.608	S	S	*	*				0	125.1	0	-59.1	-163.2	-154.8	0	0	108.4
2	S	82.8	Confident	90.5	Very high	116 Å²	116	113.8 Å²	113.8	81%	0.811	60%	0.601	S	S	*	*	P	Polyproline II helix	trans	-69.3	136.5	171.3	43.1	0	0	0	0	109	T4	S2-T4 PolarHBondContact O-N 2.68Å
3	R	82.5	Confident	91	Very high	155 Å²	155	113.9 Å²	113.9	59%	0.585	60%	0.596	S	S	*	*	P	Polyproline II helix	trans	-59.8	137.9	173.7	-67.7	178.6	-176.1	-173.8	-8	109.7	Q7 K8 D11	R3-Q7 VanDerWaalsContact CA-OE1 3.27Å; R3-Q7 HydrophobicContact CB-CB 4.23Å; R3-K8 HydrophobicContact CB-CG 4.05Å; R3-D11 IonicContact CZ-OD2 3.39Å; R3-D11 IonicContact NH1-OD2 2.65Å; R3-D11 PolarHBondContact NH1-OD2 3.1Å
4	T	93.4	Very high	91.5	Very high	66 Å²	66	108.4 Å²	108.4	41%	0.405	58%	0.575	S	S	.	*	P	Polyproline II helix	trans	-64.5	157.9	172.1	70.3	0	0	0	0	109.8	S2 E6 Q7 K8	S2-T4 PolarHBondContact O-N 2.68Å; T4-E6 PolarHBondContact O-N 3.49Å; T4-Q7 VanDerWaalsContact N-OE1 3.09Å; T4-Q7 PolarHBondContact O-N 3.46Å; T4-Q7 WeakPolarHBondContact OG1-CG 3.41Å; T4-Q7 PolarHBondContact OG1-N 3.06Å; T4-Q7 VanDerWaalsContact OG1-N 3.1Å; T4-K8 WeakPolarHBondContact O-CG 3.46Å; T4-K8 PolarHBondContact O-N 2.91Å; T4-K8 VanDerWaalsContact O-N 3.08Å
5	L	93.3	Very high	91.9	Very high	131 Å²	131	111.2 Å²	111.2	69%	0.686	58%	0.575	S	S	*	*	H	α-helix	trans	-56.5	-40.3	173.7	-179.3	61.1	0	0	0	111	Q7 K8 I9	L5-Q7 PolarHBondContact O-N 3.33Å; L5-K8 WeakPolarHBondContact O-CB 3.29Å; L5-K8 PolarHBondContact O-N 3.33Å; L5-K8 VanDerWaalsContact O-N 3.17Å; L5-I9 HydrophobicContact CD1-CD1 4.44Å; L5-I9 HydrophobicContact CG-CD1 4.05Å; L5-I9 WeakPolarHBondContact O-CG1 3.37Å; L5-I9 PolarHBondContact O-N 2.95Å
6	E	93.7	Very high	92.3	Very high	152 Å²	152	109.9 Å²	109.9	71%	0.71	57%	0.568	S	S	*	*	H	α-helix	trans	-59.1	-45.6	175.8	-62.4	175.8	159.7	0	0	112.3	T4 K8 I9 A10	T4-E6 PolarHBondContact O-N 3.49Å; E6-K8 VanDerWaalsContact C-N 3.31Å; E6-K8 PolarHBondContact O-N 3.32Å; E6-I9 PolarHBondContact O-N 3.01Å; E6-A10 PolarHBondContact O-N 3.45Å
7	Q	94.9	Very high	92.6	Very high	101 Å²	101	111.5 Å²	111.5	47%	0.472	57%	0.573	S	S	.	*	H	α-helix	trans	-61.7	-39.1	175.7	-74.6	172	-15.1	0	0	111.9	R3 T4 L5 A10 D11	R3-Q7 VanDerWaalsContact CA-OE1 3.27Å; R3-Q7 HydrophobicContact CB-CB 4.23Å; T4-Q7 VanDerWaalsContact N-OE1 3.09Å; T4-Q7 PolarHBondContact O-N 3.46Å; T4-Q7 WeakPolarHBondContact OG1-CG 3.41Å; T4-Q7 PolarHBondContact OG1-N 3.06Å; T4-Q7 VanDerWaalsContact OG1-N 3.1Å; L5-Q7 PolarHBondContact O-N 3.33Å; Q7-A10 PolarHBondContact O-N 3.49Å; Q7-D11 WeakPolarHBondContact O-CB 3.44Å; Q7-D11 PolarHBondContact O-N 3.36Å
8	K	95.4	Very high	92.9	Very high	123 Å²	123	115.1 Å²	115.1	54%	0.535	58%	0.577	S	S	.	*	H	α-helix	trans	-66.3	-39	176.2	-66.1	-179.5	-174	-179.8	0	111.9	R3 T4 L5 E6 A12	R3-K8 HydrophobicContact CB-CG 4.05Å; T4-K8 WeakPolarHBondContact O-CG 3.46Å; T4-K8 PolarHBondContact O-N 2.91Å; T4-K8 VanDerWaalsContact O-N 3.08Å; L5-K8 WeakPolarHBondContact O-CB 3.29Å; L5-K8 PolarHBondContact O-N 3.33Å; L5-K8 VanDerWaalsContact O-N 3.17Å; E6-K8 VanDerWaalsContact C-N 3.31Å; E6-K8 PolarHBondContact O-N 3.32Å; K8-A12 WeakPolarHBondContact O-CB 3.04Å; K8-A12 PolarHBondContact O-N 2.92Å; K8-A12 VanDerWaalsContact O-N 3.07Å
9	I	96.1	Very high	93.2	Very high	84 Å²	84	113.4 Å²	113.4	43%	0.431	57%	0.57	S	S	.	*	H	α-helix	trans	-64.2	-49.4	175.2	-68.7	167.2	0	0	0	109.9	L5 E6 D11 A12 E13	L5-I9 HydrophobicContact CD1-CD1 4.44Å; L5-I9 HydrophobicContact CG-CD1 4.05Å; L5-I9 WeakPolarHBondContact O-CG1 3.37Å; L5-I9 PolarHBondContact O-N 2.95Å; E6-I9 PolarHBondContact O-N 3.01Å; I9-D11 VanDerWaalsContact C-N 3.33Å; I9-D11 PolarHBondContact O-N 3.47Å; I9-A12 PolarHBondContact O-N 3.43Å; I9-A12 VanDerWaalsContact O-N 3.1Å; I9-E13 HydrophobicContact CG2-CG 4.32Å; I9-E13 WeakPolarHBondContact O-CG 3.29Å; I9-E13 PolarHBondContact O-N 3.28Å
10	A	95.5	Very high	93.4	Very high	53 Å²	53	113.5 Å²	113.5	44%	0.438	57%	0.567	S	S	.	*	H	α-helix	trans	-58.7	-42.5	178.9	0	0	0	0	0	112.3	E6 Q7 E13 A14	E6-A10 PolarHBondContact O-N 3.45Å; Q7-A10 PolarHBondContact O-N 3.49Å; A10-E13 PolarHBondContact O-N 3.32Å; A10-A14 WeakPolarHBondContact O-CB 3.39Å; A10-A14 PolarHBondContact O-N 3.38Å
11	D	96.3	Very high	93.6	Very high	79 Å²	79	111 Å²	111	42%	0.422	56%	0.563	S	S	.	*	H	α-helix	trans	-62.5	-42.4	175.5	-81.8	-14.3	0	0	0	112.1	R3 Q7 I9 R15	R3-D11 IonicContact CZ-OD2 3.39Å; R3-D11 IonicContact NH1-OD2 2.65Å; R3-D11 PolarHBondContact NH1-OD2 3.1Å; Q7-D11 WeakPolarHBondContact O-CB 3.44Å; Q7-D11 PolarHBondContact O-N 3.36Å; I9-D11 VanDerWaalsContact C-N 3.33Å; I9-D11 PolarHBondContact O-N 3.47Å; D11-R15 WeakPolarHBondContact O-CB 3.49Å; D11-R15 PolarHBondContact O-N 3.49Å
12	A	97.2	Very high	95.2	Very high	63 Å²	63	106 Å²	106	52%	0.521	54%	0.535	S	S	.	.	H	α-helix	trans	-66.6	-42.3	178.6	0	0	0	0	0	111.6	K8 I9 R15 L16	K8-A12 WeakPolarHBondContact O-CB 3.04Å; K8-A12 PolarHBondContact O-N 2.92Å; K8-A12 VanDerWaalsContact O-N 3.07Å; I9-A12 PolarHBondContact O-N 3.43Å; I9-A12 VanDerWaalsContact O-N 3.1Å; A12-R15 PolarHBondContact O-N 3.28Å; A12-L16 WeakPolarHBondContact O-CB 3.45Å; A12-L16 PolarHBondContact O-N 3.45Å
13	E	97.8	Very high	95.9	Very high	115 Å²	115	104.1 Å²	104.1	54%	0.537	52%	0.522	S	S	.	.	H	α-helix	trans	-63.2	-45.8	175.3	-72.3	-179.1	167	0	0	111.6	I9 A10 R15 L16 Q17	I9-E13 HydrophobicContact CG2-CG 4.32Å; I9-E13 WeakPolarHBondContact O-CG 3.29Å; I9-E13 PolarHBondContact O-N 3.28Å; A10-E13 PolarHBondContact O-N 3.32Å; E13-R15 VanDerWaalsContact C-N 3.31Å; E13-R15 PolarHBondContact O-N 2.9Å; E13-L16 PolarHBondContact O-N 3.19Å; E13-Q17 WeakPolarHBondContact O-CG 3.27Å; E13-Q17 PolarHBondContact O-N 3.36Å
14	A	97.5	Very high	96.6	Very high	36 Å²	36	105.6 Å²	105.6	30%	0.298	53%	0.527	S	S	.	.	H	α-helix	trans	-61	-40.6	175.4	0	0	0	0	0	111.6	A10 Q17 R18	A10-A14 WeakPolarHBondContact O-CB 3.39Å; A10-A14 PolarHBondContact O-N 3.38Å; A14-Q17 PolarHBondContact O-N 3.15Å; A14-R18 WeakPolarHBondContact O-CG 3.5Å; A14-R18 PolarHBondContact O-N 3.44Å; A14-R18 VanDerWaalsContact O-N 3.1Å
15	R	97.7	Very high	96.7	Very high	151 Å²	151	106.2 Å²	106.2	57%	0.57	54%	0.535	S	S	*	.	H	α-helix	trans	-64.7	-43.4	175.2	-178.2	57.6	175.8	178.9	-1.4	111.5	D11 A12 E13 R18 L19	D11-R15 WeakPolarHBondContact O-CB 3.49Å; D11-R15 PolarHBondContact O-N 3.49Å; A12-R15 PolarHBondContact O-N 3.28Å; E13-R15 VanDerWaalsContact C-N 3.31Å; E13-R15 PolarHBondContact O-N 2.9Å; R15-R18 PolarHBondContact O-N 3.16Å; R15-L19 HydrophobicContact CG-CD1 4.24Å; R15-L19 WeakPolarHBondContact O-CG 3.34Å; R15-L19 PolarHBondContact O-N 3.09Å
16	L	98.1	Very high	96.9	Very high	90 Å²	90	104.4 Å²	104.4	47%	0.471	53%	0.525	S	S	.	.	H	α-helix	trans	-61.6	-43.9	177.5	179.4	60.5	0	0	0	111.4	A12 E13 R18 L19 K20	A12-L16 WeakPolarHBondContact O-CB 3.45Å; A12-L16 PolarHBondContact O-N 3.45Å; E13-L16 PolarHBondContact O-N 3.19Å; L16-R18 PolarHBondContact O-N 3.41Å; L16-L19 PolarHBondContact O-N 2.86Å; L16-K20 HydrophobicContact CD1-CD 4.48Å; L16-K20 HydrophobicContact CD1-CG 4.37Å; L16-K20 HydrophobicContact CG-CD 4.3Å; L16-K20 WeakPolarHBondContact O-CG 3.49Å; L16-K20 PolarHBondContact O-N 3.46Å
17	Q	98	Very high	97.1	Very high	138 Å²	138	100.3 Å²	100.3	65%	0.645	51%	0.508	S	S	*	.	H	α-helix	trans	-60.4	-43.7	176.4	-73.1	179.7	-3.9	0	0	111.8	E13 A14 L19 K20 A21	E13-Q17 WeakPolarHBondContact O-CG 3.27Å; E13-Q17 PolarHBondContact O-N 3.36Å; A14-Q17 PolarHBondContact O-N 3.15Å; Q17-L19 PolarHBondContact O-N 3Å; Q17-K20 PolarHBondContact O-N 2.93Å; Q17-A21 WeakPolarHBondContact O-CB 3.48Å; Q17-A21 PolarHBondContact O-N 2.95Å
18	R	97.8	Very high	97.3	Very high	175 Å²	175	99.4 Å²	99.4	66%	0.66	51%	0.51	S	S	*	.	H	α-helix	trans	-61.9	-42.3	175.5	-70.3	174.4	-171.5	176.8	5.2	112.4	A14 R15 L16 A21 K22	A14-R18 WeakPolarHBondContact O-CG 3.5Å; A14-R18 PolarHBondContact O-N 3.44Å; A14-R18 VanDerWaalsContact O-N 3.1Å; R15-R18 PolarHBondContact O-N 3.16Å; L16-R18 PolarHBondContact O-N 3.41Å; R18-A21 PolarHBondContact O-N 3.32Å; R18-K22 WeakPolarHBondContact O-CB 3.27Å; R18-K22 PolarHBondContact O-N 3.27Å
19	L	98.3	Very high	97.4	Very high	84 Å²	84	95.6 Å²	95.6	44%	0.44	50%	0.501	S	S	.	.	H	α-helix	trans	-66	-41.7	177.4	-70.7	173.1	0	0	0	111.8	R15 L16 Q17 K22 S23	R15-L19 HydrophobicContact CG-CD1 4.24Å; R15-L19 WeakPolarHBondContact O-CG 3.34Å; R15-L19 PolarHBondContact O-N 3.09Å; L16-L19 PolarHBondContact O-N 2.86Å; Q17-L19 PolarHBondContact O-N 3Å; L19-K22 PolarHBondContact O-N 2.94Å; L19-S23 WeakPolarHBondContact O-CB 3.39Å; L19-S23 PolarHBondContact O-N 3.24Å
20	K	97.9	Very high	97.5	Very high	115 Å²	115	97.6 Å²	97.6	50%	0.5	51%	0.509	S	S	.	.	H	α-helix	trans	-61.2	-44.3	173.9	-74.5	179	177.1	179.2	0	111.7	L16 Q17 S23 R24	L16-K20 HydrophobicContact CD1-CD 4.48Å; L16-K20 HydrophobicContact CD1-CG 4.37Å; L16-K20 HydrophobicContact CG-CD 4.3Å; L16-K20 WeakPolarHBondContact O-CG 3.49Å; L16-K20 PolarHBondContact O-N 3.46Å; Q17-K20 PolarHBondContact O-N 2.93Å; K20-S23 PolarHBondContact O-N 3.23Å; K20-R24 WeakPolarHBondContact O-CG 3.28Å; K20-R24 PolarHBondContact O-N 3.29Å
21	A	97.5	Very high	97.6	Very high	60 Å²	60	101.2 Å²	101.2	50%	0.496	52%	0.515	S	S	.	.	H	α-helix	trans	-62.5	-43.8	176.2	0	0	0	0	0	111.9	Q17 R18 R24 S25	Q17-A21 WeakPolarHBondContact O-CB 3.48Å; Q17-A21 PolarHBondContact O-N 2.95Å; R18-A21 PolarHBondContact O-N 3.32Å; A21-R24 PolarHBondContact O-N 3.41Å; A21-S25 WeakPolarHBondContact O-CB 3.46Å; A21-S25 PolarHBondContact O-N 2.94Å
22	K	97.1	Very high	97.7	Very high	139 Å²	139	102 Å²	102	60%	0.604	52%	0.522	S	S	*	.	H	α-helix	trans	-61.8	-43.7	175.2	-174.2	174	-178.8	178.4	0	111.9	R18 L19 S25 L26	R18-K22 WeakPolarHBondContact O-CB 3.27Å; R18-K22 PolarHBondContact O-N 3.27Å; L19-K22 PolarHBondContact O-N 2.94Å; K22-S25 PolarHBondContact O-N 2.95Å; K22-L26 HydrophobicContact CG-CD1 4.25Å; K22-L26 WeakPolarHBondContact O-CG 3.45Å; K22-L26 PolarHBondContact O-N 3.2Å
23	S	97	Very high	97.8	Very high	77 Å²	77	104.5 Å²	104.5	54%	0.538	53%	0.526	S	S	.	.	H	α-helix	trans	-60.8	-45.7	177	171.7	0	0	0	0	111.9	L19 K20 S25 L26 D27	L19-S23 WeakPolarHBondContact O-CB 3.39Å; L19-S23 PolarHBondContact O-N 3.24Å; K20-S23 PolarHBondContact O-N 3.23Å; S23-S25 PolarHBondContact O-N 3.41Å; S23-L26 PolarHBondContact O-N 3Å; S23-D27 PolarHBondContact O-N 3.08Å
24	R	97.2	Very high	97.8	Very high	185 Å²	185	104 Å²	104	70%	0.698	53%	0.53	S	S	*	.	H	α-helix	trans	-63	-39.3	175.8	-70.4	176.4	-177.7	-176.6	-1.2	112.9	K20 A21 T28	K20-R24 WeakPolarHBondContact O-CG 3.28Å; K20-R24 PolarHBondContact O-N 3.29Å; A21-R24 PolarHBondContact O-N 3.41Å; R24-T28 WeakPolarHBondContact O-CB 3.45Å; R24-T28 PolarHBondContact O-N 3.04Å; R24-T28 PolarHBondContact O-OG1 2.87Å
25	S	97.4	Very high	97.8	Very high	79 Å²	79	103.8 Å²	103.8	55%	0.552	53%	0.531	S	S	*	.	H	α-helix	trans	-63.7	-44	176.5	176.6	0	0	0	0	111.7	A21 K22 S23 T28 A29	A21-S25 WeakPolarHBondContact O-CB 3.46Å; A21-S25 PolarHBondContact O-N 2.94Å; K22-S25 PolarHBondContact O-N 2.95Å; S23-S25 PolarHBondContact O-N 3.41Å; S25-T28 PolarHBondContact O-N 3.41Å; S25-A29 WeakPolarHBondContact O-CB 3.43Å; S25-A29 PolarHBondContact O-N 3.45Å
26	L	97.5	Very high	97.8	Very high	94 Å²	94	99.1 Å²	99.1	49%	0.492	53%	0.525	S	S	.	.	H	α-helix	trans	-63.9	-45.1	176.2	-71.6	171.7	0	0	0	112.3	K22 S23 T28 A29 Q30	K22-L26 HydrophobicContact CG-CD1 4.25Å; K22-L26 WeakPolarHBondContact O-CG 3.45Å; K22-L26 PolarHBondContact O-N 3.2Å; S23-L26 PolarHBondContact O-N 3Å; L26-T28 VanDerWaalsContact C-N 3.33Å; L26-T28 PolarHBondContact O-N 3.38Å; L26-A29 PolarHBondContact O-N 3.29Å; L26-Q30 VanDerWaalsContact O-CG 3.31Å; L26-Q30 WeakPolarHBondContact O-CG 3.3Å; L26-Q30 PolarHBondContact O-N 3.26Å
27	D	97.9	Very high	97.9	Very high	65 Å²	65	97.8 Å²	97.8	35%	0.348	53%	0.527	S	S	.	.	H	α-helix	trans	-59.6	-43.4	175.6	171.2	74.4	0	0	0	111.7	S23 Q30 K31	S23-D27 PolarHBondContact O-N 3.08Å; D27-Q30 PolarHBondContact O-N 3Å; D27-K31 VanDerWaalsContact CG-NZ 3.29Å; D27-K31 WeakPolarHBondContact O-CG 3.42Å; D27-K31 PolarHBondContact O-N 3.32Å; D27-K31 VanDerWaalsContact O-N 3.1Å; D27-K31 WeakPolarHBondContact OD1-CE 3.48Å; D27-K31 IonicContact OD1-NZ 2.73Å; D27-K31 PolarHBondContact OD1-NZ 3Å; D27-K31 VanDerWaalsContact OD1-NZ 3.12Å; D27-K31 WeakPolarHBondContact OD2-CE 3.48Å; D27-K31 IonicContact OD2-NZ 3.91Å; D27-K31 PolarHBondContact OD2-NZ 3.42Å
28	T	98.1	Very high	97.9	Very high	82 Å²	82	94 Å²	94	50%	0.503	51%	0.511	S	S	.	.	H	α-helix	trans	-62.1	-47.4	175.4	-56.8	0	0	0	0	111.2	R24 S25 L26 Q30 K31 V32	R24-T28 WeakPolarHBondContact O-CB 3.45Å; R24-T28 PolarHBondContact O-N 3.04Å; R24-T28 PolarHBondContact O-OG1 2.87Å; S25-T28 PolarHBondContact O-N 3.41Å; L26-T28 VanDerWaalsContact C-N 3.33Å; L26-T28 PolarHBondContact O-N 3.38Å; T28-Q30 VanDerWaalsContact C-N 3.33Å; T28-Q30 PolarHBondContact O-N 2.92Å; T28-K31 PolarHBondContact O-N 2.92Å; T28-V32 HydrophobicContact CG2-CG2 4.43Å; T28-V32 WeakPolarHBondContact O-CG2 3.47Å; T28-V32 PolarHBondContact O-N 3.39Å
29	A	97.8	Very high	97.9	Very high	44 Å²	44	87.7 Å²	87.7	36%	0.364	49%	0.49	S	S	.	.	H	α-helix	trans	-60.5	-42.4	179.3	0	0	0	0	0	111.9	S25 L26 V32 I33	S25-A29 WeakPolarHBondContact O-CB 3.43Å; S25-A29 PolarHBondContact O-N 3.45Å; L26-A29 PolarHBondContact O-N 3.29Å; A29-V32 PolarHBondContact O-N 2.98Å; A29-I33 VanDerWaalsContact O-CG1 3.25Å; A29-I33 WeakPolarHBondContact O-CG1 3.45Å; A29-I33 PolarHBondContact O-N 3.03Å
30	Q	98.3	Very high	97.9	Very high	125 Å²	125	86.4 Å²	86.4	58%	0.584	49%	0.491	S	S	*	.	H	α-helix	trans	-60.3	-46.7	176.5	-74.7	173.9	-11.4	0	0	111.8	L26 D27 T28 V32 I33 V34	L26-Q30 VanDerWaalsContact O-CG 3.31Å; L26-Q30 WeakPolarHBondContact O-CG 3.3Å; L26-Q30 PolarHBondContact O-N 3.26Å; D27-Q30 PolarHBondContact O-N 3Å; T28-Q30 VanDerWaalsContact C-N 3.33Å; T28-Q30 PolarHBondContact O-N 2.92Å; Q30-V32 VanDerWaalsContact C-N 3.35Å; Q30-V32 PolarHBondContact O-N 2.86Å; Q30-I33 PolarHBondContact O-N 3.04Å; Q30-V34 WeakPolarHBondContact O-CG2 3.38Å; Q30-V34 PolarHBondContact O-N 3.2Å; Q30-V34 VanDerWaalsContact O-N 3.08Å
31	K	98.2	Very high	97.9	Very high	130 Å²	130	84.9 Å²	84.9	57%	0.565	49%	0.485	S	S	*	.	H	α-helix	trans	-61.8	-41.9	177.1	-71.1	167.4	-179.8	166.1	0	112.1	D27 T28 V34 G35	D27-K31 VanDerWaalsContact CG-NZ 3.29Å; D27-K31 WeakPolarHBondContact O-CG 3.42Å; D27-K31 PolarHBondContact O-N 3.32Å; D27-K31 VanDerWaalsContact O-N 3.1Å; D27-K31 WeakPolarHBondContact OD1-CE 3.48Å; D27-K31 IonicContact OD1-NZ 2.73Å; D27-K31 PolarHBondContact OD1-NZ 3Å; D27-K31 VanDerWaalsContact OD1-NZ 3.12Å; D27-K31 WeakPolarHBondContact OD2-CE 3.48Å; D27-K31 IonicContact OD2-NZ 3.91Å; D27-K31 PolarHBondContact OD2-NZ 3.42Å; T28-K31 PolarHBondContact O-N 2.92Å; K31-V34 PolarHBondContact O-N 3.2Å; K31-G35 PolarHBondContact O-N 3.02Å
32	V	98.1	Very high	97.9	Very high	94 Å²	94	82 Å²	82	57%	0.57	46%	0.461	S	S	*	.	H	α-helix	trans	-63.2	-44.2	176.7	170.1	0	0	0	0	111.3	T28 A29 Q30 G35 A36	T28-V32 HydrophobicContact CG2-CG2 4.43Å; T28-V32 WeakPolarHBondContact O-CG2 3.47Å; T28-V32 PolarHBondContact O-N 3.39Å; A29-V32 PolarHBondContact O-N 2.98Å; Q30-V32 VanDerWaalsContact C-N 3.35Å; Q30-V32 PolarHBondContact O-N 2.86Å; V32-G35 PolarHBondContact O-N 3.07Å; V32-A36 VanDerWaalsContact O-CB 3.27Å; V32-A36 WeakPolarHBondContact O-CB 3.47Å; V32-A36 PolarHBondContact O-N 3.04Å
33	I	98.4	Very high	97.9	Very high	117 Å²	117	80 Å²	80	60%	0.6	45%	0.449	S	S	*	.	H	α-helix	trans	-60.9	-47.6	178.8	-70.3	164.4	0	0	0	110.8	A29 Q30 A36 A37	A29-I33 VanDerWaalsContact O-CG1 3.25Å; A29-I33 WeakPolarHBondContact O-CG1 3.45Å; A29-I33 PolarHBondContact O-N 3.03Å; Q30-I33 PolarHBondContact O-N 3.04Å; I33-A36 PolarHBondContact O-N 2.55Å; I33-A37 WeakPolarHBondContact O-CB 3.3Å; I33-A37 PolarHBondContact O-N 3.2Å
34	V	98.5	Very high	97.9	Very high	104 Å²	104	80.8 Å²	80.8	63%	0.63	44%	0.443	S	S	*	.	H	α-helix	trans	-63.3	-45.7	179	174.9	0	0	0	0	110.9	Q30 K31 A36 A37 L38	Q30-V34 WeakPolarHBondContact O-CG2 3.38Å; Q30-V34 PolarHBondContact O-N 3.2Å; Q30-V34 VanDerWaalsContact O-N 3.08Å; K31-V34 PolarHBondContact O-N 3.2Å; V34-A36 PolarHBondContact O-N 3.19Å; V34-A37 PolarHBondContact O-N 3.42Å; V34-L38 PolarHBondContact O-N 3.12Å
35	G	97.5	Very high	97.8	Very high	31 Å²	31	74.4 Å²	74.4	32%	0.32	43%	0.426	S	S	.	.	H	α-helix	trans	-61.1	-43.2	177.2	0	0	0	0	0	112.8	K31 V32 A37 L38 L39	K31-G35 PolarHBondContact O-N 3.02Å; V32-G35 PolarHBondContact O-N 3.07Å; G35-A37 PolarHBondContact O-N 2.94Å; G35-L38 PolarHBondContact O-N 2.73Å; G35-L39 WeakPolarHBondContact O-CB 3.37Å; G35-L39 VanDerWaalsContact O-CG 3.31Å; G35-L39 WeakPolarHBondContact O-CG 3.22Å; G35-L39 PolarHBondContact O-N 2.69Å
36	A	98.3	Very high	97.7	Very high	53 Å²	53	75.8 Å²	75.8	44%	0.438	42%	0.423	S	S	.	.	H	α-helix	trans	-64.1	-40.4	177.2	0	0	0	0	0	112.2	V32 I33 V34 L39 A40	V32-A36 VanDerWaalsContact O-CB 3.27Å; V32-A36 WeakPolarHBondContact O-CB 3.47Å; V32-A36 PolarHBondContact O-N 3.04Å; I33-A36 PolarHBondContact O-N 2.55Å; V34-A36 PolarHBondContact O-N 3.19Å; A36-L39 PolarHBondContact O-N 3.41Å; A36-A40 WeakPolarHBondContact O-CB 3.47Å; A36-A40 PolarHBondContact O-N 3.42Å
37	A	98.5	Very high	97.7	Very high	62 Å²	62	73.3 Å²	73.3	51%	0.512	41%	0.409	S	S	.	.	H	α-helix	trans	-63.8	-43.4	176.1	0	0	0	0	0	111.9	I33 V34 G35 A40 K41	I33-A37 WeakPolarHBondContact O-CB 3.3Å; I33-A37 PolarHBondContact O-N 3.2Å; V34-A37 PolarHBondContact O-N 3.42Å; G35-A37 PolarHBondContact O-N 2.94Å; A37-A40 PolarHBondContact O-N 3.39Å; A37-K41 PolarHBondContact O-N 2.93Å
38	L	98.2	Very high	97.6	Very high	59 Å²	59	71.9 Å²	71.9	31%	0.309	40%	0.403	S	S	.	.	H	α-helix	trans	-62.7	-46.7	175.2	179.6	60.3	0	0	0	111.3	V34 G35 A40 K41 V42 L50 L54	V34-L38 PolarHBondContact O-N 3.12Å; G35-L38 PolarHBondContact O-N 2.73Å; L38-A40 VanDerWaalsContact C-N 3.33Å; L38-A40 PolarHBondContact O-N 3.42Å; L38-K41 WeakPolarHBondContact O-CB 3.48Å; L38-K41 PolarHBondContact O-N 2.89Å; L38-K41 VanDerWaalsContact O-N 3.07Å; L38-V42 HydrophobicContact CD1-CG1 4.09Å; L38-V42 WeakPolarHBondContact O-CG2 3.43Å; L38-V42 PolarHBondContact O-N 2.93Å; L38-L50 HydrophobicContact CD1-CD2 4.15Å; L38-L54 HydrophobicContact CD2-CD1 4.03Å; L38-L54 HydrophobicContact CD2-CD2 4.4Å; L38-L54 HydrophobicContact CG-CD2 4.41Å
39	L	98.1	Very high	97.5	Very high	43 Å²	43	76.3 Å²	76.3	23%	0.225	42%	0.418	C	S	.	.	H	α-helix	trans	-59.1	-43	177.1	-73.5	173.9	0	0	0	111.9	G35 A36 K41 V42 R43 L54 L78	G35-L39 WeakPolarHBondContact O-CB 3.37Å; G35-L39 VanDerWaalsContact O-CG 3.31Å; G35-L39 WeakPolarHBondContact O-CG 3.22Å; G35-L39 PolarHBondContact O-N 2.69Å; A36-L39 PolarHBondContact O-N 3.41Å; L39-K41 VanDerWaalsContact C-N 3.27Å; L39-K41 PolarHBondContact O-N 2.91Å; L39-V42 WeakPolarHBondContact O-CG2 3.34Å; L39-R43 WeakPolarHBondContact O-CB 3.38Å; L39-R43 WeakPolarHBondContact O-CD 3.29Å; L39-R43 WeakPolarHBondContact O-CG 3.05Å; L39-R43 PolarHBondContact O-N 3.02Å; L39-L54 HydrophobicContact CD2-CD2 4.42Å; L39-L78 HydrophobicContact CD2-CD1 4.33Å
40	A	98.1	Very high	97.5	Very high	57 Å²	57	76.8 Å²	76.8	47%	0.471	41%	0.414	S	S	.	.	H	α-helix	trans	-62.4	-34.7	175.6	0	0	0	0	0	112.4	A36 A37 L38	A36-A40 WeakPolarHBondContact O-CB 3.47Å; A36-A40 PolarHBondContact O-N 3.42Å; A37-A40 PolarHBondContact O-N 3.39Å; L38-A40 VanDerWaalsContact C-N 3.33Å; L38-A40 PolarHBondContact O-N 3.42Å
41	K	97.7	Very high	97.5	Very high	82 Å²	82	71.3 Å²	71.3	36%	0.357	39%	0.388	S	S	.	.	H	α-helix	trans	-71.1	-52.5	177.2	-176.8	61.4	171.4	162	0	111.6	A37 L38 L39 R43 K44 E47 L50	A37-K41 PolarHBondContact O-N 2.93Å; L38-K41 WeakPolarHBondContact O-CB 3.48Å; L38-K41 PolarHBondContact O-N 2.89Å; L38-K41 VanDerWaalsContact O-N 3.07Å; L39-K41 VanDerWaalsContact C-N 3.27Å; L39-K41 PolarHBondContact O-N 2.91Å; K41-R43 PolarHBondContact O-N 3.5Å; K41-K44 HydrophobicContact CD-CD 4.44Å; K41-K44 VanDerWaalsContact O-CB 3.31Å; K41-K44 WeakPolarHBondContact O-CB 3.45Å; K41-K44 WeakPolarHBondContact O-CG 3.31Å; K41-K44 PolarHBondContact O-N 3.48Å; K41-E47 HydrophobicContact CD-CG 3.96Å; K41-E47 WeakPolarHBondContact CE-OE1 3.47Å; K41-E47 WeakPolarHBondContact CE-OE2 3.31Å; K41-E47 HydrophobicContact CG-CG 4.23Å; K41-E47 VanDerWaalsContact NZ-CD 3.26Å; K41-E47 IonicContact NZ-OE1 2.93Å; K41-E47 PolarHBondContact NZ-OE1 2.93Å; K41-E47 IonicContact NZ-OE2 3.9Å; K41-E47 WeakPolarHBondContact O-CG 3.45Å; K41-L50 HydrophobicContact CG-CD2 3.77Å
42	V	97.9	Very high	97.5	Very high	0 Å²	0	67.7 Å²	67.7	0%	0	38%	0.383	C	S	.	.	H	α-helix	trans	-66.2	-20.7	-176.7	-62.3	0	0	0	0	114	L38 L39 K44 L50 R51 L54 L78	L38-V42 HydrophobicContact CD1-CG1 4.09Å; L38-V42 WeakPolarHBondContact O-CG2 3.43Å; L38-V42 PolarHBondContact O-N 2.93Å; L39-V42 WeakPolarHBondContact O-CG2 3.34Å; V42-K44 PolarHBondContact O-N 3.36Å; V42-L50 HydrophobicContact CG1-CB 4.34Å; V42-L50 HydrophobicContact CG1-CD2 3.83Å; V42-L50 HydrophobicContact CG1-CG 3.71Å; V42-R51 HydrophobicContact CB-CB 4.06Å; V42-R51 HydrophobicContact CB-CG 4.46Å; V42-R51 WeakPolarHBondContact O-CD 3.27Å; V42-R51 PolarHBondContact O-NH1 3.1Å; V42-L54 HydrophobicContact CB-CD2 4.45Å; V42-L54 HydrophobicContact CG1-CB 4.49Å; V42-L54 HydrophobicContact CG1-CD2 3.99Å; V42-L54 HydrophobicContact CG2-CD2 3.89Å; V42-L78 HydrophobicContact CG2-CD1 4.33Å; V42-L78 HydrophobicContact CG2-CD2 3.83Å
43	R	97.4	Very high	97.5	Very high	96 Å²	96	69.6 Å²	69.6	36%	0.362	38%	0.38	S	S	.	.	T	Hydrogen-bonded Turn	trans	-70.7	-16.1	173.6	-78.4	172.6	172.2	138.8	0.1	113.7	L39 K41 E77 L78 L81	L39-R43 WeakPolarHBondContact O-CB 3.38Å; L39-R43 WeakPolarHBondContact O-CD 3.29Å; L39-R43 WeakPolarHBondContact O-CG 3.05Å; L39-R43 PolarHBondContact O-N 3.02Å; K41-R43 PolarHBondContact O-N 3.5Å; R43-E77 IonicContact CZ-OE1 2.69Å; R43-E77 IonicContact CZ-OE2 2.69Å; R43-E77 IonicContact NE-OE1 3.12Å; R43-E77 PolarHBondContact NE-OE1 3.07Å; R43-E77 VanDerWaalsContact NH2-CD 3.33Å; R43-E77 IonicContact NH2-OE1 2.55Å; R43-E77 PolarHBondContact NH2-OE1 3.31Å; R43-E77 IonicContact NH2-OE2 3.21Å; R43-E77 PolarHBondContact NH2-OE2 2.93Å; R43-L78 HydrophobicContact CG-CD2 4.02Å; R43-L81 HydrophobicContact CB-CD1 4.32Å; R43-L81 HydrophobicContact CG-CD1 4.16Å
44	K	96.5	Very high	97.5	Very high	95 Å²	95	64.5 Å²	64.5	41%	0.413	35%	0.353	S	S	.	.	S	Bend	trans	-70.2	136.7	178.2	-61.9	-169.3	177.5	-169.1	0	109.8	K41 V42 E46 E47 R51	K41-K44 HydrophobicContact CD-CD 4.44Å; K41-K44 VanDerWaalsContact O-CB 3.31Å; K41-K44 WeakPolarHBondContact O-CB 3.45Å; K41-K44 WeakPolarHBondContact O-CG 3.31Å; K41-K44 PolarHBondContact O-N 3.48Å; V42-K44 PolarHBondContact O-N 3.36Å; K44-E46 WeakPolarHBondContact CB-OE2 3.49Å; K44-E46 VanDerWaalsContact CD-OE1 3.29Å; K44-E46 WeakPolarHBondContact CD-OE1 3.33Å; K44-E46 PolarHBondContact O-N 2.95Å; K44-E47 HydrophobicContact CB-CB 4.45Å; K44-E47 HydrophobicContact CB-CG 3.98Å; K44-E47 PolarHBondContact O-N 3.06Å; K44-R51 PolarHBondContact O-NH1 2.99Å
45	P	95.1	Very high	97.4	Very high	50 Å²	50	60.4 Å²	60.4	33%	0.325	33%	0.328	S	S	.	.	T	Hydrogen-bonded Turn	trans	-59.1	-34.7	-174.5	-23.6	33.2	0	0	0	113.5	E47 V48 Q84	P45-E47 PolarHBondContact O-N 3.39Å; P45-V48 VanDerWaalsContact O-CG2 3.29Å; P45-V48 WeakPolarHBondContact O-CG2 3.47Å; P45-Q84 HydrophobicContact CB-CB 4.21Å; P45-Q84 HydrophobicContact CB-CG 3.56Å
46	E	95.7	Very high	97.4	Very high	108 Å²	108	65.8 Å²	65.8	51%	0.505	35%	0.345	S	S	.	.	T	Hydrogen-bonded Turn	trans	-70	-14.8	178.5	69.6	-84.5	-165.7	0	0	114.3	K44 V48	K44-E46 WeakPolarHBondContact CB-OE2 3.49Å; K44-E46 VanDerWaalsContact CD-OE1 3.29Å; K44-E46 WeakPolarHBondContact CD-OE1 3.33Å; K44-E46 PolarHBondContact O-N 2.95Å; E46-V48 VanDerWaalsContact C-N 3.27Å; E46-V48 PolarHBondContact O-N 3.31Å
47	E	96.8	Very high	97.4	Very high	42 Å²	42	67.6 Å²	67.6	20%	0.196	34%	0.343	C	S	.	.			trans	-91.8	38.4	-174.5	-65.1	-64.6	150.6	0	0	113.3	K41 K44 P45 Q49 L50 R51	K41-E47 HydrophobicContact CD-CG 3.96Å; K41-E47 WeakPolarHBondContact CE-OE1 3.47Å; K41-E47 WeakPolarHBondContact CE-OE2 3.31Å; K41-E47 HydrophobicContact CG-CG 4.23Å; K41-E47 VanDerWaalsContact NZ-CD 3.26Å; K41-E47 IonicContact NZ-OE1 2.93Å; K41-E47 PolarHBondContact NZ-OE1 2.93Å; K41-E47 IonicContact NZ-OE2 3.9Å; K41-E47 WeakPolarHBondContact O-CG 3.45Å; K44-E47 HydrophobicContact CB-CB 4.45Å; K44-E47 HydrophobicContact CB-CG 3.98Å; K44-E47 PolarHBondContact O-N 3.06Å; P45-E47 PolarHBondContact O-N 3.39Å; E47-Q49 PolarHBondContact O-N 3.46Å; E47-L50 PolarHBondContact O-N 2.96Å; E47-R51 VanDerWaalsContact O-CB 3.28Å; E47-R51 WeakPolarHBondContact O-CB 3.34Å; E47-R51 PolarHBondContact O-N 3.48Å
48	V	96.7	Very high	97.4	Very high	35 Å²	35	66.5 Å²	66.5	21%	0.212	33%	0.328	C	S	.	.	H	α-helix	trans	-57.5	-48.2	-176.9	-175.3	0	0	0	0	111.8	P45 E46 R51 A52 E83	P45-V48 VanDerWaalsContact O-CG2 3.29Å; P45-V48 WeakPolarHBondContact O-CG2 3.47Å; E46-V48 VanDerWaalsContact C-N 3.27Å; E46-V48 PolarHBondContact O-N 3.31Å; V48-R51 PolarHBondContact O-N 2.85Å; V48-A52 WeakPolarHBondContact O-CB 3.39Å; V48-A52 PolarHBondContact O-N 3.32Å; V48-E83 HydrophobicContact CG1-CG 3.96Å; V48-E83 HydrophobicContact CG2-CB 4.18Å; V48-E83 HydrophobicContact CG2-CG 4.31Å
49	Q	96.7	Very high	97.3	Very high	176 Å²	176	69.7 Å²	69.7	82%	0.822	34%	0.34	S	S	*	.	H	α-helix	trans	-65.8	-42.8	-177.6	-65.6	-178.2	13.2	0	0	112.3	E47 R51 A52 W53	E47-Q49 PolarHBondContact O-N 3.46Å; Q49-R51 VanDerWaalsContact C-N 3.34Å; Q49-A52 PolarHBondContact O-N 3.4Å; Q49-W53 WeakPolarHBondContact O-CB 3.38Å; Q49-W53 PolarHBondContact O-N 3.12Å
50	L	97.5	Very high	97.2	Very high	53 Å²	53	70.5 Å²	70.5	28%	0.277	35%	0.353	S	S	.	.	H	α-helix	trans	-67	-38.7	178.5	-174.9	65.5	0	0	0	111.2	L38 K41 V42 E47 W53 L54	L38-L50 HydrophobicContact CD1-CD2 4.15Å; K41-L50 HydrophobicContact CG-CD2 3.77Å; V42-L50 HydrophobicContact CG1-CB 4.34Å; V42-L50 HydrophobicContact CG1-CD2 3.83Å; V42-L50 HydrophobicContact CG1-CG 3.71Å; E47-L50 PolarHBondContact O-N 2.96Å; L50-W53 HydrophobicContact CD1-CE3 4.04Å; L50-W53 PolarHBondContact O-N 2.84Å; L50-L54 WeakPolarHBondContact O-CB 3.46Å; L50-L54 PolarHBondContact O-N 2.97Å
51	R	97.8	Very high	97.2	Very high	10 Å²	10	73.9 Å²	73.9	4%	0.038	36%	0.359	C	S	.	.	H	α-helix	trans	-63.2	-45.9	174.7	-177.7	167.3	61.9	-106.9	5.2	111.8	V42 K44 E47 V48 Q49 L54 L55 L78 P82	V42-R51 HydrophobicContact CB-CB 4.06Å; V42-R51 HydrophobicContact CB-CG 4.46Å; V42-R51 WeakPolarHBondContact O-CD 3.27Å; V42-R51 PolarHBondContact O-NH1 3.1Å; K44-R51 PolarHBondContact O-NH1 2.99Å; E47-R51 VanDerWaalsContact O-CB 3.28Å; E47-R51 WeakPolarHBondContact O-CB 3.34Å; E47-R51 PolarHBondContact O-N 3.48Å; V48-R51 PolarHBondContact O-N 2.85Å; Q49-R51 VanDerWaalsContact C-N 3.34Å; R51-L54 PolarHBondContact O-N 3.27Å; R51-L55 HydrophobicContact CG-CD1 4.27Å; R51-L55 WeakPolarHBondContact O-CG 3.43Å; R51-L55 PolarHBondContact O-N 3.27Å; R51-L78 WeakPolarHBondContact CD-O 3.46Å; R51-L78 HydrophobicContact CG-CB 4.32Å; R51-P82 PolarHBondContact NH2-O 3.47Å
52	A	97.4	Very high	97.2	Very high	55 Å²	55	71.7 Å²	71.7	46%	0.455	35%	0.352	S	S	.	.	H	α-helix	trans	-60.8	-45.3	176.2	0	0	0	0	0	111.7	V48 Q49 L54 L55 Q56	V48-A52 WeakPolarHBondContact O-CB 3.39Å; V48-A52 PolarHBondContact O-N 3.32Å; Q49-A52 PolarHBondContact O-N 3.4Å; A52-L54 PolarHBondContact O-N 3.08Å; A52-L55 PolarHBondContact O-N 2.69Å; A52-Q56 PolarHBondContact O-N 3.37Å
53	W	98.2	Very high	97.1	Very high	134 Å²	134	77.2 Å²	77.2	51%	0.508	39%	0.386	S	S	.	.	H	α-helix	trans	-58.1	-46.8	174.4	171.9	82.9	0	0	0	111.9	Q49 L50 L55 Q56 F57	Q49-W53 WeakPolarHBondContact O-CB 3.38Å; Q49-W53 PolarHBondContact O-N 3.12Å; L50-W53 HydrophobicContact CD1-CE3 4.04Å; L50-W53 PolarHBondContact O-N 2.84Å; W53-L55 PolarHBondContact O-N 3.42Å; W53-Q56 PolarHBondContact O-N 3.46Å; W53-F57 HydrophobicContact CZ2-CD2 4.32Å; W53-F57 HydrophobicContact CZ2-CG 4.44Å; W53-F57 VanDerWaalsContact O-CB 3.3Å; W53-F57 WeakPolarHBondContact O-CB 3.42Å; W53-F57 PolarHBondContact O-N 2.97Å
54	L	98.1	Very high	97.2	Very high	9 Å²	9	80.7 Å²	80.7	5%	0.047	40%	0.399	C	S	.	.	H	α-helix	trans	-62.3	-43.7	179.5	177.9	61.7	0	0	0	111.5	L38 L39 V42 L50 R51 A52 Q56 F57 L58 L78	L38-L54 HydrophobicContact CD2-CD1 4.03Å; L38-L54 HydrophobicContact CD2-CD2 4.4Å; L38-L54 HydrophobicContact CG-CD2 4.41Å; L39-L54 HydrophobicContact CD2-CD2 4.42Å; V42-L54 HydrophobicContact CB-CD2 4.45Å; V42-L54 HydrophobicContact CG1-CB 4.49Å; V42-L54 HydrophobicContact CG1-CD2 3.99Å; V42-L54 HydrophobicContact CG2-CD2 3.89Å; L50-L54 WeakPolarHBondContact O-CB 3.46Å; L50-L54 PolarHBondContact O-N 2.97Å; R51-L54 PolarHBondContact O-N 3.27Å; A52-L54 PolarHBondContact O-N 3.08Å; L54-Q56 PolarHBondContact O-N 3.42Å; L54-F57 HydrophobicContact CD1-CD1 4.5Å; L54-F57 PolarHBondContact O-N 2.9Å; L54-L58 HydrophobicContact CD1-CD1 4.08Å; L54-L58 HydrophobicContact CD1-CD2 4.46Å; L54-L58 HydrophobicContact CD1-CG 3.99Å; L54-L58 HydrophobicContact CG-CD1 3.98Å; L54-L58 HydrophobicContact CG-CG 4.31Å; L54-L58 WeakPolarHBondContact O-CB 3.42Å; L54-L58 VanDerWaalsContact O-CG 3.27Å; L54-L58 WeakPolarHBondContact O-CG 3.22Å; L54-L58 PolarHBondContact O-N 3.47Å; L54-L78 HydrophobicContact CD2-CD1 4.18Å
55	L	97.8	Very high	97.2	Very high	19 Å²	19	82.4 Å²	82.4	10%	0.099	41%	0.409	C	S	.	.	H	α-helix	trans	-61.1	-44.5	177.8	-75.3	170	0	0	0	111.7	R51 A52 W53 K59 I75 L78 E79	R51-L55 HydrophobicContact CG-CD1 4.27Å; R51-L55 WeakPolarHBondContact O-CG 3.43Å; R51-L55 PolarHBondContact O-N 3.27Å; A52-L55 PolarHBondContact O-N 2.69Å; W53-L55 PolarHBondContact O-N 3.42Å; L55-K59 VanDerWaalsContact O-CG 3.29Å; L55-K59 WeakPolarHBondContact O-CG 3.45Å; L55-K59 PolarHBondContact O-N 3.32Å; L55-K59 VanDerWaalsContact O-N 3.09Å; L55-I75 HydrophobicContact CD2-CB 4.42Å; L55-I75 HydrophobicContact CD2-CG1 4.47Å; L55-I75 HydrophobicContact CD2-CG2 4Å; L55-L78 HydrophobicContact CD1-CB 4.49Å; L55-L78 HydrophobicContact CD2-CB 4.06Å; L55-L78 HydrophobicContact CD2-CD1 4.43Å; L55-L78 HydrophobicContact CG-CB 4.47Å; L55-E79 HydrophobicContact CD1-CG 3.72Å; L55-E79 HydrophobicContact CD2-CG 4Å
56	Q	98	Very high	97.3	Very high	143 Å²	143	82.2 Å²	82.2	67%	0.668	41%	0.412	S	S	*	.	H	α-helix	trans	-63.8	-44.6	176	-175.4	179.7	-1.5	0	0	111.5	A52 W53 L54 K59 A60	A52-Q56 PolarHBondContact O-N 3.37Å; W53-Q56 PolarHBondContact O-N 3.46Å; L54-Q56 PolarHBondContact O-N 3.42Å; Q56-K59 PolarHBondContact O-N 2.92Å; Q56-A60 PolarHBondContact O-N 2.99Å
57	F	98.1	Very high	97.4	Very high	92 Å²	92	79.5 Å²	79.5	40%	0.404	40%	0.4	S	S	.	.	H	α-helix	trans	-59	-48.2	177.3	175.4	-95.4	0	0	0	111.6	W53 L54 K59 A60 E61	W53-F57 HydrophobicContact CZ2-CD2 4.32Å; W53-F57 HydrophobicContact CZ2-CG 4.44Å; W53-F57 VanDerWaalsContact O-CB 3.3Å; W53-F57 WeakPolarHBondContact O-CB 3.42Å; W53-F57 PolarHBondContact O-N 2.97Å; L54-F57 HydrophobicContact CD1-CD1 4.5Å; L54-F57 PolarHBondContact O-N 2.9Å; F57-K59 VanDerWaalsContact C-N 3.33Å; F57-K59 PolarHBondContact O-N 3.38Å; F57-A60 PolarHBondContact O-N 2.97Å; F57-A60 VanDerWaalsContact O-N 3.16Å; F57-E61 HydrophobicContact CD2-CG 3.92Å; F57-E61 HydrophobicContact CE1-CB 4.5Å; F57-E61 HydrophobicContact CE1-CG 4.27Å; F57-E61 HydrophobicContact CE2-CG 3.56Å; F57-E61 HydrophobicContact CG-CG 4.42Å; F57-E61 HydrophobicContact CZ-CB 4.35Å; F57-E61 HydrophobicContact CZ-CG 3.75Å; F57-E61 WeakPolarHBondContact O-CB 3.45Å; F57-E61 WeakPolarHBondContact O-CG 3.25Å; F57-E61 PolarHBondContact O-N 2.99Å
58	L	97.6	Very high	97.5	Very high	38 Å²	38	79.7 Å²	79.7	20%	0.199	40%	0.404	C	S	.	.	H	α-helix	trans	-62.1	-40.3	178.8	-70.7	173.4	0	0	0	112	L54 A60 V62 I71	L54-L58 HydrophobicContact CD1-CD1 4.08Å; L54-L58 HydrophobicContact CD1-CD2 4.46Å; L54-L58 HydrophobicContact CD1-CG 3.99Å; L54-L58 HydrophobicContact CG-CD1 3.98Å; L54-L58 HydrophobicContact CG-CG 4.31Å; L54-L58 WeakPolarHBondContact O-CB 3.42Å; L54-L58 VanDerWaalsContact O-CG 3.27Å; L54-L58 WeakPolarHBondContact O-CG 3.22Å; L54-L58 PolarHBondContact O-N 3.47Å; L58-A60 VanDerWaalsContact C-N 3.29Å; L58-A60 PolarHBondContact O-N 3.33Å; L58-V62 HydrophobicContact CD2-CG2 4.1Å; L58-V62 VanDerWaalsContact O-CB 3.27Å; L58-V62 WeakPolarHBondContact O-CB 3.31Å; L58-V62 WeakPolarHBondContact O-CG2 3.38Å; L58-V62 PolarHBondContact O-N 3.35Å; L58-I71 HydrophobicContact CB-CD1 4.36Å; L58-I71 HydrophobicContact CD2-CD1 4.29Å
59	K	95.7	Very high	97.6	Very high	126 Å²	126	82 Å²	82	55%	0.548	42%	0.419	S	S	.	.	H	α-helix	trans	-65.2	-31.7	176.6	-73.5	171.8	-177.8	176.9	0	112.8	L55 Q56 F57 E79	L55-K59 VanDerWaalsContact O-CG 3.29Å; L55-K59 WeakPolarHBondContact O-CG 3.45Å; L55-K59 PolarHBondContact O-N 3.32Å; L55-K59 VanDerWaalsContact O-N 3.09Å; Q56-K59 PolarHBondContact O-N 2.92Å; F57-K59 VanDerWaalsContact C-N 3.33Å; F57-K59 PolarHBondContact O-N 3.38Å; K59-E79 WeakPolarHBondContact CE-OE1 3.5Å; K59-E79 IonicContact NZ-OE1 2.89Å; K59-E79 PolarHBondContact NZ-OE1 3.21Å
60	A	97.5	Very high	97.6	Very high	61 Å²	61	81.7 Å²	81.7	50%	0.504	41%	0.41	S	S	.	.	H	α-helix	trans	-80.9	-43.2	179	0	0	0	0	0	112.8	Q56 F57 L58 T63	Q56-A60 PolarHBondContact O-N 2.99Å; F57-A60 PolarHBondContact O-N 2.97Å; F57-A60 VanDerWaalsContact O-N 3.16Å; L58-A60 VanDerWaalsContact C-N 3.29Å; L58-A60 PolarHBondContact O-N 3.33Å; A60-T63 WeakPolarHBondContact O-CG2 3.4Å
61	E	97.6	Very high	97.6	Very high	127 Å²	127	81 Å²	81	59%	0.593	41%	0.406	S	S	*	.	H	α-helix	trans	-93.1	-30	-169.6	-63.6	-59.9	140.4	0	0	113.6	F57 T63	F57-E61 HydrophobicContact CD2-CG 3.92Å; F57-E61 HydrophobicContact CE1-CB 4.5Å; F57-E61 HydrophobicContact CE1-CG 4.27Å; F57-E61 HydrophobicContact CE2-CG 3.56Å; F57-E61 HydrophobicContact CG-CG 4.42Å; F57-E61 HydrophobicContact CZ-CB 4.35Å; F57-E61 HydrophobicContact CZ-CG 3.75Å; F57-E61 WeakPolarHBondContact O-CB 3.45Å; F57-E61 WeakPolarHBondContact O-CG 3.25Å; F57-E61 PolarHBondContact O-N 2.99Å; E61-T63 PolarHBondContact O-N 2.87Å; E61-T63 VanDerWaalsContact O-N 3.15Å
62	V	97.6	Very high	97.6	Very high	36 Å²	36	84.2 Å²	84.2	22%	0.218	42%	0.424	C	S	.	.			trans	-89	84.5	179.5	-172.2	0	0	0	0	109	L58 D67 V68 I71	L58-V62 HydrophobicContact CD2-CG2 4.1Å; L58-V62 VanDerWaalsContact O-CB 3.27Å; L58-V62 WeakPolarHBondContact O-CB 3.31Å; L58-V62 WeakPolarHBondContact O-CG2 3.38Å; L58-V62 PolarHBondContact O-N 3.35Å; V62-D67 HydrophobicContact CG1-CB 3.6Å; V62-V68 HydrophobicContact CG1-CG2 4.18Å; V62-V68 WeakPolarHBondContact O-CG2 3.41Å; V62-I71 HydrophobicContact CB-CD1 4Å; V62-I71 HydrophobicContact CG1-CD1 3.89Å; V62-I71 HydrophobicContact CG2-CD1 3.87Å
63	T	96.1	Very high	97.6	Very high	117 Å²	117	85.7 Å²	85.7	72%	0.718	43%	0.429	S	S	*	.			trans	-96.5	-23.1	-173.5	55.9	0	0	0	0	113.9	A60 E61 Q65	A60-T63 WeakPolarHBondContact O-CG2 3.4Å; E61-T63 PolarHBondContact O-N 2.87Å; E61-T63 VanDerWaalsContact O-N 3.15Å; T63-Q65 PolarHBondContact O-N 2.92Å
64	R	98	Very high	97.6	Very high	169 Å²	169	82.7 Å²	82.7	64%	0.638	42%	0.422	S	S	*	.	S	Bend	trans	-71	122.8	179.3	-173	-177.4	-176.5	-169.3	2.1	109.8	A66 D67 V68	R64-A66 HydrophobicContact CG-CB 4.48Å; R64-A66 PolarHBondContact O-N 2.94Å; R64-A66 VanDerWaalsContact O-N 3.08Å; R64-D67 HydrophobicContact CB-CB 4.4Å; R64-D67 WeakPolarHBondContact CB-OD2 3.4Å; R64-D67 WeakPolarHBondContact CD-OD2 3.37Å; R64-D67 WeakPolarHBondContact O-CA 3.47Å; R64-D67 PolarHBondContact O-N 3.27Å; R64-V68 PolarHBondContact O-N 3Å
65	Q	97.5	Very high	97.5	Very high	131 Å²	131	83 Å²	83	61%	0.612	42%	0.423	S	S	*	.	H	α-helix	trans	-50.9	-41	-177.3	-172.8	59.3	55.4	0	0	113.9	T63 D67 V68 T69	T63-Q65 PolarHBondContact O-N 2.92Å; Q65-D67 VanDerWaalsContact C-N 3.28Å; Q65-D67 PolarHBondContact O-N 3.41Å; Q65-V68 PolarHBondContact O-N 3.35Å; Q65-T69 PolarHBondContact NE2-OG1 3.33Å; Q65-T69 WeakPolarHBondContact O-CB 3.46Å; Q65-T69 PolarHBondContact O-N 3.48Å; Q65-T69 PolarHBondContact O-OG1 2.9Å
66	A	97.9	Very high	97.6	Very high	46 Å²	46	86 Å²	86	38%	0.38	44%	0.44	S	S	.	.	H	α-helix	trans	-63	-35.2	178.5	0	0	0	0	0	112.9	R64 R70	R64-A66 HydrophobicContact CG-CB 4.48Å; R64-A66 PolarHBondContact O-N 2.94Å; R64-A66 VanDerWaalsContact O-N 3.08Å; A66-R70 WeakPolarHBondContact O-CB 3.39Å; A66-R70 PolarHBondContact O-N 2.9Å
67	D	98	Very high	97.5	Very high	51 Å²	51	82.8 Å²	82.8	27%	0.273	43%	0.425	S	S	.	.	H	α-helix	trans	-79.7	-39.9	179.5	-60.5	-37	0	0	0	110.4	V62 R64 Q65 T69 R70 I71	V62-D67 HydrophobicContact CG1-CB 3.6Å; R64-D67 HydrophobicContact CB-CB 4.4Å; R64-D67 WeakPolarHBondContact CB-OD2 3.4Å; R64-D67 WeakPolarHBondContact CD-OD2 3.37Å; R64-D67 WeakPolarHBondContact O-CA 3.47Å; R64-D67 PolarHBondContact O-N 3.27Å; Q65-D67 VanDerWaalsContact C-N 3.28Å; Q65-D67 PolarHBondContact O-N 3.41Å; D67-T69 PolarHBondContact O-N 3.47Å; D67-R70 WeakPolarHBondContact O-CB 3.33Å; D67-R70 PolarHBondContact O-N 3.1Å; D67-R70 VanDerWaalsContact O-N 3.12Å; D67-R70 IonicContact OD1-CZ 2.68Å; D67-R70 IonicContact OD1-NH1 3.87Å; D67-R70 PolarHBondContact OD1-NH1 3.35Å; D67-I71 WeakPolarHBondContact O-CG1 3.43Å; D67-I71 PolarHBondContact O-N 2.88Å
68	V	97.8	Very high	97.5	Very high	45 Å²	45	78.5 Å²	78.5	27%	0.273	41%	0.406	S	S	.	.	H	α-helix	trans	-53	-53.4	170.3	174.9	0	0	0	0	110.6	V62 R64 Q65 R70 I71 L72	V62-V68 HydrophobicContact CG1-CG2 4.18Å; V62-V68 WeakPolarHBondContact O-CG2 3.41Å; R64-V68 PolarHBondContact O-N 3Å; Q65-V68 PolarHBondContact O-N 3.35Å; V68-R70 VanDerWaalsContact C-N 3.25Å; V68-R70 PolarHBondContact O-N 3.46Å; V68-I71 PolarHBondContact O-N 3.31Å; V68-L72 PolarHBondContact O-N 3.1Å
69	T	98.1	Very high	97.5	Very high	84 Å²	84	81.2 Å²	81.2	52%	0.515	42%	0.418	S	S	.	.	H	α-helix	trans	-59.8	-37.3	179.2	-60.5	0	0	0	0	111.8	Q65 D67	Q65-T69 PolarHBondContact NE2-OG1 3.33Å; Q65-T69 WeakPolarHBondContact O-CB 3.46Å; Q65-T69 PolarHBondContact O-N 3.48Å; Q65-T69 PolarHBondContact O-OG1 2.9Å; D67-T69 PolarHBondContact O-N 3.47Å
70	R	98	Very high	97.5	Very high	170 Å²	170	79.2 Å²	79.2	64%	0.642	43%	0.425	S	S	*	.	H	α-helix	trans	-67.7	-38.7	-179.7	-173.9	178	-62.7	111.6	4.3	112.7	A66 D67 V68	A66-R70 WeakPolarHBondContact O-CB 3.39Å; A66-R70 PolarHBondContact O-N 2.9Å; D67-R70 WeakPolarHBondContact O-CB 3.33Å; D67-R70 PolarHBondContact O-N 3.1Å; D67-R70 VanDerWaalsContact O-N 3.12Å; D67-R70 IonicContact OD1-CZ 2.68Å; D67-R70 IonicContact OD1-NH1 3.87Å; D67-R70 PolarHBondContact OD1-NH1 3.35Å; V68-R70 VanDerWaalsContact C-N 3.25Å; V68-R70 PolarHBondContact O-N 3.46Å
71	I	97.2	Very high	97.4	Very high	38 Å²	38	78.5 Å²	78.5	20%	0.195	41%	0.412	C	S	.	.	H	α-helix	trans	-92.8	-9.2	-176.3	69.8	169.7	0	0	0	113.6	L58 V62 D67 V68 P73 L74 I75	L58-I71 HydrophobicContact CB-CD1 4.36Å; L58-I71 HydrophobicContact CD2-CD1 4.29Å; V62-I71 HydrophobicContact CB-CD1 4Å; V62-I71 HydrophobicContact CG1-CD1 3.89Å; V62-I71 HydrophobicContact CG2-CD1 3.87Å; D67-I71 WeakPolarHBondContact O-CG1 3.43Å; D67-I71 PolarHBondContact O-N 2.88Å; V68-I71 PolarHBondContact O-N 3.31Å; I71-P73 VanDerWaalsContact C-CD 3.42Å; I71-P73 VanDerWaalsContact C-N 3.32Å; I71-L74 WeakPolarHBondContact O-CA 3.35Å; I71-L74 WeakPolarHBondContact O-CB 3.39Å; I71-L74 PolarHBondContact O-N 3.2Å; I71-I75 HydrophobicContact CD1-CD1 3.86Å; I71-I75 HydrophobicContact CD1-CG1 4.43Å; I71-I75 HydrophobicContact CG1-CD1 3.89Å; I71-I75 HydrophobicContact CG1-CG1 4.41Å; I71-I75 PolarHBondContact O-N 3.44Å
72	L	97.6	Very high	97.1	Very high	78 Å²	78	76.7 Å²	76.7	41%	0.408	41%	0.412	S	S	.	.	H	α-helix	trans	-50.9	-41.8	-178.9	-176.2	63.8	0	0	0	113.9	V68 L74 I75 N76	V68-L72 PolarHBondContact O-N 3.1Å; L72-L74 VanDerWaalsContact C-N 3.28Å; L72-L74 PolarHBondContact O-N 3.41Å; L72-I75 PolarHBondContact O-N 2.92Å; L72-N76 VanDerWaalsContact O-CG 3.23Å; L72-N76 PolarHBondContact O-N 3.32Å; L72-N76 PolarHBondContact O-OD1 2.89Å
73	P	98.1	Very high	96.4	Very high	86 Å²	86	82.3 Å²	82.3	56%	0.558	44%	0.435	S	S	*	.	H	α-helix	trans	-59.9	-36.5	175.5	-24.6	35.6	0	0	0	113.5	I71 E77	I71-P73 VanDerWaalsContact C-CD 3.42Å; I71-P73 VanDerWaalsContact C-N 3.32Å; P73-E77 WeakPolarHBondContact O-CB 3.42Å; P73-E77 PolarHBondContact O-N 3Å
74	L	97.1	Very high	95.3	Very high	71 Å²	71	86.3 Å²	86.3	37%	0.372	45%	0.446	S	S	.	.	H	α-helix	trans	-72.1	-38.5	176.6	-67.8	172.1	0	0	0	111.6	I71 L72 E77 L78	I71-L74 WeakPolarHBondContact O-CA 3.35Å; I71-L74 WeakPolarHBondContact O-CB 3.39Å; I71-L74 PolarHBondContact O-N 3.2Å; L72-L74 VanDerWaalsContact C-N 3.28Å; L72-L74 PolarHBondContact O-N 3.41Å; L74-E77 PolarHBondContact O-N 3.41Å; L74-L78 VanDerWaalsContact O-CG 3.3Å; L74-L78 WeakPolarHBondContact O-CG 3.36Å; L74-L78 PolarHBondContact O-N 3.17Å
75	I	97.4	Very high	95.2	Very high	14 Å²	14	82.2 Å²	82.2	7%	0.072	44%	0.436	C	S	.	.	H	α-helix	trans	-59.4	-50.4	173.9	-70.1	174.7	0	0	0	109.6	L55 I71 L72 E77 L78 E79	L55-I75 HydrophobicContact CD2-CB 4.42Å; L55-I75 HydrophobicContact CD2-CG1 4.47Å; L55-I75 HydrophobicContact CD2-CG2 4Å; I71-I75 HydrophobicContact CD1-CD1 3.86Å; I71-I75 HydrophobicContact CD1-CG1 4.43Å; I71-I75 HydrophobicContact CG1-CD1 3.89Å; I71-I75 HydrophobicContact CG1-CG1 4.41Å; I71-I75 PolarHBondContact O-N 3.44Å; L72-I75 PolarHBondContact O-N 2.92Å; I75-E77 VanDerWaalsContact C-N 3.33Å; I75-E77 PolarHBondContact O-N 3.22Å; I75-L78 PolarHBondContact O-N 2.86Å; I75-E79 HydrophobicContact CG2-CG 4.34Å; I75-E79 WeakPolarHBondContact O-CB 3.49Å; I75-E79 WeakPolarHBondContact O-CG 3.36Å; I75-E79 PolarHBondContact O-N 3.1Å
76	N	98	Very high	95.1	Very high	83 Å²	83	79.6 Å²	79.6	44%	0.444	43%	0.427	S	S	.	.	H	α-helix	trans	-61.2	-41	179.8	-66	-11.4	0	0	0	112.1	L72 E79 A80	L72-N76 VanDerWaalsContact O-CG 3.23Å; L72-N76 PolarHBondContact O-N 3.32Å; L72-N76 PolarHBondContact O-OD1 2.89Å; N76-E79 PolarHBondContact O-N 2.92Å; N76-A80 WeakPolarHBondContact O-CB 3.35Å; N76-A80 PolarHBondContact O-N 3.48Å; N76-A80 VanDerWaalsContact O-N 3.1Å
77	E	97.7	Very high	94.9	Very high	75 Å²	75	81.4 Å²	81.4	35%	0.35	43%	0.43	S	S	.	.	H	α-helix	trans	-57.5	-50.7	174.8	-175.4	-159.7	148.1	0	0	111	R43 P73 L74 I75 A80 L81	R43-E77 IonicContact CZ-OE1 2.69Å; R43-E77 IonicContact CZ-OE2 2.69Å; R43-E77 IonicContact NE-OE1 3.12Å; R43-E77 PolarHBondContact NE-OE1 3.07Å; R43-E77 VanDerWaalsContact NH2-CD 3.33Å; R43-E77 IonicContact NH2-OE1 2.55Å; R43-E77 PolarHBondContact NH2-OE1 3.31Å; R43-E77 IonicContact NH2-OE2 3.21Å; R43-E77 PolarHBondContact NH2-OE2 2.93Å; P73-E77 WeakPolarHBondContact O-CB 3.42Å; P73-E77 PolarHBondContact O-N 3Å; L74-E77 PolarHBondContact O-N 3.41Å; I75-E77 VanDerWaalsContact C-N 3.33Å; I75-E77 PolarHBondContact O-N 3.22Å; E77-A80 PolarHBondContact O-N 3.49Å; E77-L81 PolarHBondContact O-N 3.34Å
78	L	97.4	Very high	94.8	Very high	3 Å²	3	83.2 Å²	83.2	2%	0.016	44%	0.439	C	S	.	.	H	α-helix	trans	-67.7	-37	-177.8	-68.1	178.4	0	0	0	112.4	L39 V42 R43 R51 L54 L55 L74 I75 A80 L81	L39-L78 HydrophobicContact CD2-CD1 4.33Å; V42-L78 HydrophobicContact CG2-CD1 4.33Å; V42-L78 HydrophobicContact CG2-CD2 3.83Å; R43-L78 HydrophobicContact CG-CD2 4.02Å; R51-L78 WeakPolarHBondContact CD-O 3.46Å; R51-L78 HydrophobicContact CG-CB 4.32Å; L54-L78 HydrophobicContact CD2-CD1 4.18Å; L55-L78 HydrophobicContact CD1-CB 4.49Å; L55-L78 HydrophobicContact CD2-CB 4.06Å; L55-L78 HydrophobicContact CD2-CD1 4.43Å; L55-L78 HydrophobicContact CG-CB 4.47Å; L74-L78 VanDerWaalsContact O-CG 3.3Å; L74-L78 WeakPolarHBondContact O-CG 3.36Å; L74-L78 PolarHBondContact O-N 3.17Å; I75-L78 PolarHBondContact O-N 2.86Å; L78-A80 VanDerWaalsContact C-N 3.27Å; L78-A80 PolarHBondContact O-N 2.65Å; L78-L81 HydrophobicContact CD2-CD1 3.91Å; L78-L81 PolarHBondContact O-N 3.08Å
79	E	96.5	Very high	94.6	Very high	94 Å²	94	85.6 Å²	85.6	44%	0.439	45%	0.449	S	S	.	.	H	α-helix	trans	-67.4	-27	176	-74.2	178.9	163	0	0	112.6	L55 K59 I75 N76	L55-E79 HydrophobicContact CD1-CG 3.72Å; L55-E79 HydrophobicContact CD2-CG 4Å; K59-E79 WeakPolarHBondContact CE-OE1 3.5Å; K59-E79 IonicContact NZ-OE1 2.89Å; K59-E79 PolarHBondContact NZ-OE1 3.21Å; I75-E79 HydrophobicContact CG2-CG 4.34Å; I75-E79 WeakPolarHBondContact O-CB 3.49Å; I75-E79 WeakPolarHBondContact O-CG 3.36Å; I75-E79 PolarHBondContact O-N 3.1Å; N76-E79 PolarHBondContact O-N 2.92Å
80	A	96.9	Very high	94.3	Very high	85 Å²	85	85.7 Å²	85.7	70%	0.702	45%	0.445	S	S	*	.	T	Hydrogen-bonded Turn	trans	-84.9	-5.4	178.8	0	0	0	0	0	114.1	N76 E77 L78	N76-A80 WeakPolarHBondContact O-CB 3.35Å; N76-A80 PolarHBondContact O-N 3.48Å; N76-A80 VanDerWaalsContact O-N 3.1Å; E77-A80 PolarHBondContact O-N 3.49Å; L78-A80 VanDerWaalsContact C-N 3.27Å; L78-A80 PolarHBondContact O-N 2.65Å
81	L	95.6	Very high	94.1	Very high	46 Å²	46	79.7 Å²	79.7	24%	0.241	43%	0.431	C	S	.	.	S	Bend	trans	-71.4	137.1	-179.5	-70.8	175.5	0	0	0	111.3	R43 E77 L78	R43-L81 HydrophobicContact CB-CD1 4.32Å; R43-L81 HydrophobicContact CG-CD1 4.16Å; E77-L81 PolarHBondContact O-N 3.34Å; L78-L81 HydrophobicContact CD2-CD1 3.91Å; L78-L81 PolarHBondContact O-N 3.08Å
82	P	90.2	Very high	93.8	Very high	89 Å²	89	82.9 Å²	82.9	58%	0.578	45%	0.449	S	S	*	.	P	Polyproline II helix	trans	-65.5	147.3	178.9	28.4	-34.6	0	0	0	111.5	R51	R51-P82 PolarHBondContact NH2-O 3.47Å
83	E	83.5	Confident	93.5	Very high	153 Å²	153	83.3 Å²	83.3	72%	0.715	45%	0.452	S	S	*	.	P	Polyproline II helix	trans	-86.2	134.4	165.9	-57.3	-175.1	155.8	0	0	108.2	V48	V48-E83 HydrophobicContact CG1-CG 3.96Å; V48-E83 HydrophobicContact CG2-CB 4.18Å; V48-E83 HydrophobicContact CG2-CG 4.31Å
84	Q	73.9	Confident	93.1	Very high	201 Å²	201	83.1 Å²	83.1	94%	0.939	44%	0.443	S	S	*	.			trans	-93.4	0	170.3	-89.9	-167.3	-32.3	0	0	111.2	P45	P45-Q84 HydrophobicContact CB-CB 4.21Å; P45-Q84 HydrophobicContact CB-CG 3.56Å

Retrieved 84 of 84 residues in 120.5 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).