A0A077ZMT7_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZMT7, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 99 aa.

						>A0A077ZMT7_TRITR|A0A077ZMT7
MTLLALLADWGVLKPDLFPEFSSCIMVELYEHASIHYVEIWYRRGHGKKPVQLKIKDCREPCKLQEFVAIAEKYASVNITADCEKFKELGLQFVDQKLT
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	59	Low	87.1	Confident	158 Å²	158	50.7 Å²	50.7	78%	0.778	31%	0.307	S	S	*	.				0	132.2	0	-163.3	178.3	-72.6	0	0	108.5	A5 L6 V77	M1-A5 HydrophobicContact CG-CB 4.34Å; M1-L6 HydrophobicContact CG-CD2 4.41Å; M1-L6 HydrophobicContact CG-CG 4.24Å; M1-L6 HydrophobicContact SD-CD1 4.47Å; M1-L6 HydrophobicContact SD-CD2 3.48Å; M1-L6 WeakPolarHBondContact SD-CD2 3.44Å; M1-L6 HydrophobicContact SD-CG 3.91Å; M1-V77 HydrophobicContact CE-CG2 4.46Å
2	T	83.9	Confident	87.6	Confident	91 Å²	91	47.7 Å²	47.7	56%	0.558	29%	0.289	S	S	*	.			trans	-106.3	163.5	-179.8	63.2	0	0	0	0	110.5	L4 A5 L6	T2-L4 PolarHBondContact O-N 3.13Å; T2-A5 WeakPolarHBondContact O-CB 3.34Å; T2-A5 PolarHBondContact O-N 3.2Å; T2-A5 VanDerWaalsContact O-N 3.13Å; T2-A5 PolarHBondContact OG1-N 3.27Å; T2-L6 PolarHBondContact O-N 3.23Å
3	L	90.8	Very high	87.9	Confident	47 Å²	47	50.5 Å²	50.5	25%	0.246	30%	0.301	C	S	.	.	H	α-helix	trans	-57.5	-38.3	176.9	-59.3	179.3	0	0	0	111.9	A5 L6 L7 P19 S23 I25 Y42	L3-A5 VanDerWaalsContact C-N 3.33Å; L3-A5 PolarHBondContact O-N 3.29Å; L3-L6 PolarHBondContact O-N 3.08Å; L3-L7 VanDerWaalsContact O-CG 3.3Å; L3-L7 WeakPolarHBondContact O-CG 3.39Å; L3-L7 PolarHBondContact O-N 2.68Å; L3-P19 HydrophobicContact CD1-CB 4.45Å; L3-S23 VanDerWaalsContact CD1-OG 3.3Å; L3-S23 WeakPolarHBondContact CD1-OG 3.48Å; L3-I25 HydrophobicContact CB-CD1 4.22Å; L3-I25 HydrophobicContact CD2-CB 4.3Å; L3-I25 HydrophobicContact CD2-CD1 3.66Å; L3-I25 HydrophobicContact CD2-CG1 3.88Å; L3-Y42 HydrophobicContact CD1-CE2 4.43Å
4	L	90.5	Very high	88.2	Confident	54 Å²	54	55.9 Å²	55.9	28%	0.283	32%	0.318	S	S	.	.	H	α-helix	trans	-62.7	-37.9	177.9	-72.3	173.6	0	0	0	112.7	T2 L7 A8 L13 F18 P19	T2-L4 PolarHBondContact O-N 3.13Å; L4-L7 PolarHBondContact O-N 3.02Å; L4-A8 WeakPolarHBondContact O-CB 3.46Å; L4-A8 PolarHBondContact O-N 3.4Å; L4-L13 HydrophobicContact CD2-CD1 3.59Å; L4-F18 HydrophobicContact CD1-CE2 4.05Å; L4-F18 HydrophobicContact CD1-CZ 4.39Å; L4-F18 HydrophobicContact CD2-CD2 4.29Å; L4-F18 HydrophobicContact CD2-CE2 4.43Å; L4-P19 HydrophobicContact CD1-CG 4.4Å; L4-P19 HydrophobicContact CD2-CG 4.15Å; L4-P19 HydrophobicContact CG-CG 4.01Å
5	A	88.7	Confident	88.4	Confident	25 Å²	25	60.5 Å²	60.5	21%	0.207	35%	0.351	C	S	.	.	H	α-helix	trans	-63.1	-46.4	176.1	0	0	0	0	0	110.6	M1 T2 L3 L7 A8 D9	M1-A5 HydrophobicContact CG-CB 4.34Å; T2-A5 WeakPolarHBondContact O-CB 3.34Å; T2-A5 PolarHBondContact O-N 3.2Å; T2-A5 VanDerWaalsContact O-N 3.13Å; T2-A5 PolarHBondContact OG1-N 3.27Å; L3-A5 VanDerWaalsContact C-N 3.33Å; L3-A5 PolarHBondContact O-N 3.29Å; A5-L7 PolarHBondContact O-N 2.85Å; A5-A8 WeakPolarHBondContact O-CB 3.49Å; A5-A8 PolarHBondContact O-N 3.34Å; A5-A8 VanDerWaalsContact O-N 3.13Å; A5-D9 WeakPolarHBondContact O-CB 3.05Å; A5-D9 VanDerWaalsContact O-CG 3.23Å; A5-D9 PolarHBondContact O-N 2.9Å
6	L	90.9	Very high	88.6	Confident	43 Å²	43	63.4 Å²	63.4	23%	0.225	37%	0.365	C	S	.	.	H	α-helix	trans	-61.9	-42	176.3	-71.8	172.3	0	0	0	112.6	M1 T2 L3 A8 D9 W10 I25	M1-L6 HydrophobicContact CG-CD2 4.41Å; M1-L6 HydrophobicContact CG-CG 4.24Å; M1-L6 HydrophobicContact SD-CD1 4.47Å; M1-L6 HydrophobicContact SD-CD2 3.48Å; M1-L6 WeakPolarHBondContact SD-CD2 3.44Å; M1-L6 HydrophobicContact SD-CG 3.91Å; T2-L6 PolarHBondContact O-N 3.23Å; L3-L6 PolarHBondContact O-N 3.08Å; L6-A8 VanDerWaalsContact C-N 3.26Å; L6-A8 PolarHBondContact O-N 3.14Å; L6-D9 PolarHBondContact O-N 3.32Å; L6-W10 HydrophobicContact CB-CE3 4.4Å; L6-W10 HydrophobicContact CB-CH2 4.11Å; L6-W10 HydrophobicContact CB-CZ2 4.39Å; L6-W10 HydrophobicContact CB-CZ3 4.11Å; L6-W10 HydrophobicContact CD1-CH2 4.34Å; L6-W10 HydrophobicContact CD2-CH2 4.34Å; L6-W10 HydrophobicContact CD2-CZ2 3.99Å; L6-W10 PolarHBondContact O-N 3.14Å; L6-I25 HydrophobicContact CB-CD1 3.8Å; L6-I25 HydrophobicContact CD1-CD1 3.84Å; L6-I25 HydrophobicContact CG-CD1 4.5Å
7	L	92.5	Very high	88.9	Confident	0 Å²	0	60.9 Å²	60.9	0%	0	35%	0.35	C	S	.	.	H	α-helix	trans	-62.7	-34.9	175.7	-66.3	174.9	0	0	0	112	L3 L4 A5 G11 V12 L13 L17 Y42 L53	L3-L7 VanDerWaalsContact O-CG 3.3Å; L3-L7 WeakPolarHBondContact O-CG 3.39Å; L3-L7 PolarHBondContact O-N 2.68Å; L4-L7 PolarHBondContact O-N 3.02Å; A5-L7 PolarHBondContact O-N 2.85Å; L7-G11 PolarHBondContact O-N 2.03Å; L7-V12 HydrophobicContact CB-CG2 4.14Å; L7-V12 HydrophobicContact CD2-CG2 3.69Å; L7-V12 VanDerWaalsContact O-CG2 3.31Å; L7-V12 WeakPolarHBondContact O-CG2 3.3Å; L7-V12 PolarHBondContact O-N 2.98Å; L7-L13 HydrophobicContact CB-CB 4.11Å; L7-L13 HydrophobicContact CB-CD1 4.14Å; L7-L13 HydrophobicContact CD1-CD1 4.31Å; L7-L13 PolarHBondContact O-N 2.99Å; L7-L17 HydrophobicContact CD1-CB 4.39Å; L7-Y42 HydrophobicContact CD1-CE2 4.44Å; L7-L53 HydrophobicContact CD2-CD1 3.5Å; L7-L53 HydrophobicContact CD2-CD2 4.48Å
8	A	89.8	Confident	89.1	Confident	50 Å²	50	64.6 Å²	64.6	41%	0.413	36%	0.362	S	S	.	.	H	α-helix	trans	-71.5	-47	175	0	0	0	0	0	111.6	L4 A5 L6 W10 G11 L13	L4-A8 WeakPolarHBondContact O-CB 3.46Å; L4-A8 PolarHBondContact O-N 3.4Å; A5-A8 WeakPolarHBondContact O-CB 3.49Å; A5-A8 PolarHBondContact O-N 3.34Å; A5-A8 VanDerWaalsContact O-N 3.13Å; L6-A8 VanDerWaalsContact C-N 3.26Å; L6-A8 PolarHBondContact O-N 3.14Å; A8-W10 PolarHBondContact O-N 3.47Å; A8-G11 WeakPolarHBondContact O-CA 3.31Å; A8-G11 PolarHBondContact O-N 3.38Å; A8-L13 HydrophobicContact CB-CB 4.49Å; A8-L13 HydrophobicContact CB-CD2 4.18Å
9	D	89.2	Confident	89.4	Confident	27 Å²	27	62.9 Å²	62.9	14%	0.144	35%	0.354	C	S	.	.	H	α-helix	trans	-59.6	-34.5	179.6	-68.8	1.7	0	0	0	111.2	A5 L6 G11 S76	A5-D9 WeakPolarHBondContact O-CB 3.05Å; A5-D9 VanDerWaalsContact O-CG 3.23Å; A5-D9 PolarHBondContact O-N 2.9Å; L6-D9 PolarHBondContact O-N 3.32Å; D9-G11 VanDerWaalsContact C-N 3.33Å; D9-S76 PolarHBondContact OD2-N 3.46Å; D9-S76 VanDerWaalsContact OD2-N 3.1Å; D9-S76 PolarHBondContact OD2-OG 3.43Å
10	W	91.6	Very high	89.7	Confident	19 Å²	19	63.7 Å²	63.7	7%	0.072	35%	0.354	C	S	.	.	T	Hydrogen-bonded Turn	trans	-85.3	-0.1	174.7	-60.7	-27.9	0	0	0	114.8	L6 A8 V12 I25 V27 I40 L53 I55 K56 F67	L6-W10 HydrophobicContact CB-CE3 4.4Å; L6-W10 HydrophobicContact CB-CH2 4.11Å; L6-W10 HydrophobicContact CB-CZ2 4.39Å; L6-W10 HydrophobicContact CB-CZ3 4.11Å; L6-W10 HydrophobicContact CD1-CH2 4.34Å; L6-W10 HydrophobicContact CD2-CH2 4.34Å; L6-W10 HydrophobicContact CD2-CZ2 3.99Å; L6-W10 PolarHBondContact O-N 3.14Å; A8-W10 PolarHBondContact O-N 3.47Å; W10-V12 VanDerWaalsContact C-N 3.28Å; W10-V12 HydrophobicContact CB-CG2 4.17Å; W10-V12 PolarHBondContact O-N 3.49Å; W10-I25 HydrophobicContact CH2-CD1 4.32Å; W10-I25 HydrophobicContact CH2-CG2 3.72Å; W10-I25 HydrophobicContact CZ3-CD1 3.89Å; W10-I25 HydrophobicContact CZ3-CG1 4.43Å; W10-I25 HydrophobicContact CZ3-CG2 3.73Å; W10-V27 HydrophobicContact CH2-CG2 4.25Å; W10-I40 HydrophobicContact CD2-CD1 3.75Å; W10-I40 HydrophobicContact CE3-CD1 3.8Å; W10-I40 HydrophobicContact CE3-CG2 4.03Å; W10-I40 HydrophobicContact CH2-CD1 3.67Å; W10-I40 HydrophobicContact CH2-CG2 3.93Å; W10-I40 HydrophobicContact CZ2-CD1 3.61Å; W10-I40 HydrophobicContact CZ3-CD1 3.76Å; W10-I40 HydrophobicContact CZ3-CG2 3.45Å; W10-I40 VanDerWaalsContact CZ3-CG2 3.45Å; W10-L53 HydrophobicContact CE3-CD1 4.27Å; W10-L53 HydrophobicContact CZ3-CD1 4.37Å; W10-I55 HydrophobicContact CB-CG2 4.24Å; W10-K56 PolarHBondContact O-N 3.19Å; W10-K56 VanDerWaalsContact O-N 3.08Å; W10-F67 HydrophobicContact CZ2-CZ 4.38Å; W10-F67 AromaticContact NE1-CE2 3.62Å; W10-F67 AromaticContact NE1-CZ 3.93Å
11	G	91.5	Very high	89.9	Confident	44 Å²	44	69.6 Å²	69.6	45%	0.454	38%	0.377	S	S	.	.	T	Hydrogen-bonded Turn	trans	67.8	24.4	178.4	0	0	0	0	0	114.3	L7 A8 D9	L7-G11 PolarHBondContact O-N 2.03Å; A8-G11 WeakPolarHBondContact O-CA 3.31Å; A8-G11 PolarHBondContact O-N 3.38Å; D9-G11 VanDerWaalsContact C-N 3.33Å
12	V	93	Very high	91.7	Very high	14 Å²	14	64.5 Å²	64.5	9%	0.085	36%	0.356	C	S	.	.			trans	-110.6	-6.2	-176.4	-61.8	0	0	0	0	113.7	L7 W10 K14 L17 L53 K54	L7-V12 HydrophobicContact CB-CG2 4.14Å; L7-V12 HydrophobicContact CD2-CG2 3.69Å; L7-V12 VanDerWaalsContact O-CG2 3.31Å; L7-V12 WeakPolarHBondContact O-CG2 3.3Å; L7-V12 PolarHBondContact O-N 2.98Å; W10-V12 VanDerWaalsContact C-N 3.28Å; W10-V12 HydrophobicContact CB-CG2 4.17Å; W10-V12 PolarHBondContact O-N 3.49Å; V12-K14 PolarHBondContact O-N 3.16Å; V12-L17 VanDerWaalsContact O-CD1 3.26Å; V12-L17 WeakPolarHBondContact O-CD1 3.49Å; V12-L53 HydrophobicContact CG2-CD1 4.13Å; V12-L53 HydrophobicContact CG2-CD2 4.36Å; V12-K54 WeakPolarHBondContact CG1-O 3.45Å
13	L	91.3	Very high	92.3	Very high	85 Å²	85	61.5 Å²	61.5	45%	0.445	34%	0.339	S	S	.	.			trans	-57.8	120.6	-177.9	-178.8	61.8	0	0	0	111.9	L4 L7 A8	L4-L13 HydrophobicContact CD2-CD1 3.59Å; L7-L13 HydrophobicContact CB-CB 4.11Å; L7-L13 HydrophobicContact CB-CD1 4.14Å; L7-L13 HydrophobicContact CD1-CD1 4.31Å; L7-L13 PolarHBondContact O-N 2.99Å; A8-L13 HydrophobicContact CB-CB 4.49Å; A8-L13 HydrophobicContact CB-CD2 4.18Å
14	K	92.5	Very high	92.6	Very high	126 Å²	126	60.8 Å²	60.8	55%	0.548	34%	0.338	S	S	.	.			trans	-140.7	155.2	176.3	-64.4	174.8	-173.6	175.1	0	110	V12 D16 L17	V12-K14 PolarHBondContact O-N 3.16Å; K14-D16 WeakPolarHBondContact CB-OD1 2.99Å; K14-D16 PolarHBondContact O-N 3.22Å; K14-L17 HydrophobicContact CB-CD1 4.48Å; K14-L17 PolarHBondContact O-N 2.88Å
15	P	91.5	Very high	92.9	Very high	125 Å²	125	59.7 Å²	59.7	81%	0.812	33%	0.332	S	S	*	.	G	3₁₀ helix	trans	-56	-34.1	-178	-27.4	35.7	0	0	0	114.5	L17 F18	P15-L17 PolarHBondContact O-N 3.42Å; P15-F18 WeakPolarHBondContact O-CB 3.41Å; P15-F18 PolarHBondContact O-N 3.35Å
16	D	91.3	Very high	93.3	Very high	107 Å²	107	61.7 Å²	61.7	57%	0.572	34%	0.338	S	S	*	.	G	3₁₀ helix	trans	-72.2	-11.9	178.1	62.1	-49.2	0	0	0	113.8	K14 R44	K14-D16 WeakPolarHBondContact CB-OD1 2.99Å; K14-D16 PolarHBondContact O-N 3.22Å; D16-R44 WeakPolarHBondContact O-CD 2.97Å; D16-R44 PolarHBondContact O-NE 3.24Å
17	L	92.6	Very high	93.5	Very high	20 Å²	20	63.7 Å²	63.7	11%	0.105	35%	0.351	C	S	.	.	G	3₁₀ helix	trans	-100.1	12.4	175.6	-61	178.1	0	0	0	113	L7 V12 K14 P15 Y42 V51 L53	L7-L17 HydrophobicContact CD1-CB 4.39Å; V12-L17 VanDerWaalsContact O-CD1 3.26Å; V12-L17 WeakPolarHBondContact O-CD1 3.49Å; K14-L17 HydrophobicContact CB-CD1 4.48Å; K14-L17 PolarHBondContact O-N 2.88Å; P15-L17 PolarHBondContact O-N 3.42Å; L17-Y42 HydrophobicContact CB-CE1 4.19Å; L17-Y42 HydrophobicContact CD2-CD1 3.96Å; L17-Y42 HydrophobicContact CD2-CE1 4.16Å; L17-Y42 PolarHBondContact O-OH 3.02Å; L17-Y42 VanDerWaalsContact O-OH 3.09Å; L17-V51 HydrophobicContact CD2-CG2 4.27Å; L17-L53 HydrophobicContact CD1-CD2 4.17Å
18	F	93.4	Very high	93.7	Very high	128 Å²	128	68 Å²	68	56%	0.561	37%	0.372	S	S	*	.			trans	-62.4	129.4	178.5	-159.3	-90.2	0	0	0	111	L4 P15 E20 R44	L4-F18 HydrophobicContact CD1-CE2 4.05Å; L4-F18 HydrophobicContact CD1-CZ 4.39Å; L4-F18 HydrophobicContact CD2-CD2 4.29Å; L4-F18 HydrophobicContact CD2-CE2 4.43Å; P15-F18 WeakPolarHBondContact O-CB 3.41Å; P15-F18 PolarHBondContact O-N 3.35Å; F18-E20 PolarHBondContact O-N 2.87Å; F18-R44 WeakPolarHBondContact O-CD 3.43Å; F18-R44 WeakPolarHBondContact O-CG 3.35Å
19	P	95.1	Very high	94	Very high	33 Å²	33	70.9 Å²	70.9	21%	0.214	38%	0.38	C	S	.	.			trans	-68.5	128	-173.3	25.1	-32.6	0	0	0	112.3	L3 L4 S23 Y42	L3-P19 HydrophobicContact CD1-CB 4.45Å; L4-P19 HydrophobicContact CD1-CG 4.4Å; L4-P19 HydrophobicContact CD2-CG 4.15Å; L4-P19 HydrophobicContact CG-CG 4.01Å; P19-S23 WeakPolarHBondContact CB-OG 3.45Å; P19-Y42 VanDerWaalsContact CA-OH 3.28Å; P19-Y42 WeakPolarHBondContact CA-OH 3.2Å
20	E	95	Very high	94.4	Very high	78 Å²	78	73.2 Å²	73.2	36%	0.364	39%	0.387	S	S	.	.			trans	-91.7	177.9	163.7	-62	175.9	178	0	0	110	F18 S22 S23 R44 K48	F18-E20 PolarHBondContact O-N 2.87Å; E20-S22 PolarHBondContact O-N 3.03Å; E20-S23 VanDerWaalsContact O-CB 3.31Å; E20-S23 WeakPolarHBondContact O-CB 3Å; E20-S23 PolarHBondContact O-N 3.33Å; E20-S23 VanDerWaalsContact O-N 3.13Å; E20-S23 PolarHBondContact O-OG 3.16Å; E20-R44 WeakPolarHBondContact CA-O 3.26Å; E20-R44 WeakPolarHBondContact CB-O 3.42Å; E20-R44 PolarHBondContact N-O 3.17Å; E20-R44 IonicContact OE1-CZ 3.13Å; E20-R44 IonicContact OE1-NH1 2.68Å; E20-R44 PolarHBondContact OE1-NH1 3.11Å; E20-R44 IonicContact OE1-NH2 3.74Å; E20-R44 PolarHBondContact OE1-NH2 2.69Å; E20-R44 IonicContact OE2-NH2 3.9Å; E20-K48 WeakPolarHBondContact OE2-CE 3.43Å; E20-K48 IonicContact OE2-NZ 3.93Å
21	F	94.7	Very high	94.7	Very high	188 Å²	188	77.9 Å²	77.9	83%	0.825	41%	0.41	S	S	*	.	T	Hydrogen-bonded Turn	trans	-55.5	136.5	172.4	-179.4	-100.3	0	0	0	111.1	S23 G45 H46	F21-S23 VanDerWaalsContact C-N 3.25Å; F21-S23 PolarHBondContact O-N 3.09Å; F21-G45 VanDerWaalsContact O-CA 3.28Å; F21-G45 WeakPolarHBondContact O-CA 3.22Å; F21-H46 PolarHBondContact O-N 2.93Å; F21-H46 VanDerWaalsContact O-N 3.08Å
22	S	95.6	Very high	94.9	Very high	50 Å²	50	81.9 Å²	81.9	35%	0.35	42%	0.416	S	S	.	.	T	Hydrogen-bonded Turn	trans	63.5	25.2	-175.8	-174.9	0	0	0	0	114.7	E20	E20-S22 PolarHBondContact O-N 3.03Å
23	S	96.8	Very high	95	Very high	28 Å²	28	85 Å²	85	20%	0.196	44%	0.443	C	S	.	.			trans	-62.3	146.3	165	43.6	0	0	0	0	111.4	L3 P19 E20 F21 R43 R44	L3-S23 VanDerWaalsContact CD1-OG 3.3Å; L3-S23 WeakPolarHBondContact CD1-OG 3.48Å; P19-S23 WeakPolarHBondContact CB-OG 3.45Å; E20-S23 VanDerWaalsContact O-CB 3.31Å; E20-S23 WeakPolarHBondContact O-CB 3Å; E20-S23 PolarHBondContact O-N 3.33Å; E20-S23 VanDerWaalsContact O-N 3.13Å; E20-S23 PolarHBondContact O-OG 3.16Å; F21-S23 VanDerWaalsContact C-N 3.25Å; F21-S23 PolarHBondContact O-N 3.09Å; S23-R43 CarbonylContact C-O 3.52Å; S23-R43 WeakPolarHBondContact CA-O 3.4Å; S23-R43 WeakPolarHBondContact CB-O 3.44Å; S23-R44 WeakPolarHBondContact CB-O 3.48Å
24	C	96.9	Very high	95.2	Very high	32 Å²	32	85.8 Å²	85.8	22%	0.216	46%	0.456	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-150.7	152.9	174.5	61.2	0	0	0	0	111.5	Y42 R43	C24-Y42 WeakPolarHBondContact O-CD2 3.45Å; C24-R43 PolarHBondContact N-O 3.19Å; C24-R43 PolarHBondContact O-N 2.83Å
25	I	96.5	Very high	95.5	Very high	31 Å²	31	83 Å²	83	16%	0.159	45%	0.447	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.8	135.4	165.1	-68.4	163.9	0	0	0	106.7	L3 L6 W10 V27 I40 W41 Y42	L3-I25 HydrophobicContact CB-CD1 4.22Å; L3-I25 HydrophobicContact CD2-CB 4.3Å; L3-I25 HydrophobicContact CD2-CD1 3.66Å; L3-I25 HydrophobicContact CD2-CG1 3.88Å; L6-I25 HydrophobicContact CB-CD1 3.8Å; L6-I25 HydrophobicContact CD1-CD1 3.84Å; L6-I25 HydrophobicContact CG-CD1 4.5Å; W10-I25 HydrophobicContact CH2-CD1 4.32Å; W10-I25 HydrophobicContact CH2-CG2 3.72Å; W10-I25 HydrophobicContact CZ3-CD1 3.89Å; W10-I25 HydrophobicContact CZ3-CG1 4.43Å; W10-I25 HydrophobicContact CZ3-CG2 3.73Å; I25-V27 HydrophobicContact CG2-CG2 3.95Å; I25-I40 HydrophobicContact CG2-CG2 3.78Å; I25-W41 CarbonylContact C-O 3.54Å; I25-W41 WeakPolarHBondContact CA-O 3.12Å; I25-Y42 HydrophobicContact CG1-CD2 3.66Å; I25-Y42 HydrophobicContact CG1-CE2 4.25Å
26	M	96.9	Very high	95.8	Very high	68 Å²	68	80.9 Å²	80.9	34%	0.335	43%	0.425	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.3	120.9	173.5	-61.9	163.7	-61.8	0	0	106.5	I40 W41 P50	M26-I40 WeakPolarHBondContact O-CA 3.38Å; M26-W41 HydrophobicContact CB-CB 4.22Å; M26-W41 HydrophobicContact CE-CB 3.59Å; M26-W41 PolarHBondContact N-O 3.43Å; M26-W41 PolarHBondContact O-N 3.33Å; M26-P50 HydrophobicContact CE-CB 3.73Å
27	V	95.5	Very high	96.1	Very high	84 Å²	84	77 Å²	77	51%	0.509	40%	0.403	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.3	119.3	177.2	-175.7	0	0	0	0	106.8	W10 I25 V38	W10-V27 HydrophobicContact CH2-CG2 4.25Å; I25-V27 HydrophobicContact CG2-CG2 3.95Å; V27-V38 HydrophobicContact CG1-CG1 3.91Å
28	E	96.6	Very high	96.4	Very high	92 Å²	92	76.3 Å²	76.3	43%	0.43	40%	0.4	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107	129.5	179.6	-65.9	-176.8	-155.6	0	0	108.8	V38 E39	E28-V38 CarbonylContact O-C 3.58Å; E28-V38 WeakPolarHBondContact O-CA 2.97Å; E28-E39 HydrophobicContact CB-CB 4.27Å; E28-E39 PolarHBondContact N-O 3.2Å; E28-E39 PolarHBondContact O-N 3.19Å
29	L	97.6	Very high	96.5	Very high	110 Å²	110	72.3 Å²	72.3	58%	0.576	38%	0.383	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-113.1	124.2	172.3	175.6	65.8	0	0	0	107.2	H36 Y37 V38 L64	L29-H36 HydrophobicContact CD1-CB 4.16Å; L29-Y37 WeakPolarHBondContact CA-O 3.35Å; L29-Y37 WeakPolarHBondContact CD1-O 3.37Å; L29-V38 HydrophobicContact CD1-CG2 4.21Å; L29-L64 HydrophobicContact CD1-CD1 4.26Å; L29-L64 HydrophobicContact CD1-CD2 4.22Å
30	Y	97	Very high	96.5	Very high	75 Å²	75	70.8 Å²	70.8	29%	0.294	37%	0.373	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-137.5	159.5	176.1	63.9	-90	0	0	0	111.5	H36 Y37 E39	Y30-H36 CarbonylContact O-C 3.58Å; Y30-H36 WeakPolarHBondContact O-CA 3.32Å; Y30-Y37 HydrophobicContact CD2-CD2 4.21Å; Y30-Y37 AromaticContact CE2-CD2 3.78Å; Y30-Y37 HydrophobicContact CE2-CD2 3.78Å; Y30-Y37 AromaticContact CE2-CG 3.92Å; Y30-Y37 HydrophobicContact CE2-CG 3.92Å; Y30-Y37 VanDerWaalsContact CZ-CB 3.47Å; Y30-Y37 PolarHBondContact N-O 3.08Å; Y30-Y37 PolarHBondContact O-N 3.4Å; Y30-E39 HydrophobicContact CE1-CB 4.21Å; Y30-E39 HydrophobicContact CE1-CG 3.7Å; Y30-E39 VanDerWaalsContact CE1-OE1 3.32Å; Y30-E39 WeakPolarHBondContact CE1-OE1 3.46Å; Y30-E39 PolarHBondContact OH-OE1 2.82Å
31	E	97.6	Very high	96.6	Very high	118 Å²	118	70.4 Å²	70.4	55%	0.551	37%	0.368	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-112	134.1	178.4	-171.3	-172.4	170.7	0	0	109.9	S34 I35	E31-S34 WeakPolarHBondContact OE1-CA 3.32Å; E31-I35 WeakPolarHBondContact CA-O 3.09Å
32	H	95.6	Very high	96.8	Very high	127 Å²	127	61.5 Å²	61.5	59%	0.588	33%	0.329	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-139.5	123.5	170.2	-178.3	77.3	0	0	0	109.9	S34 I35 Y37	H32-S34 VanDerWaalsContact C-N 3.3Å; H32-S34 PolarHBondContact O-N 3.14Å; H32-I35 PolarHBondContact N-O 2.9Å; H32-I35 PolarHBondContact O-N 2.9Å; H32-Y37 HydrophobicContact CB-CD2 4.27Å; H32-Y37 HydrophobicContact CB-CE2 3.93Å
33	A	95.5	Very high	96.8	Very high	79 Å²	79	63.3 Å²	63.3	65%	0.653	33%	0.328	S	S	*	.	T	Hydrogen-bonded Turn	trans	50.6	46.9	-178.3	0	0	0	0	0	113.2	I35	A33-I35 PolarHBondContact O-N 3.28Å
34	S	95.9	Very high	96.8	Very high	103 Å²	103	65.3 Å²	65.3	72%	0.72	33%	0.331	S	S	*	.	T	Hydrogen-bonded Turn	trans	63.6	14.8	-178.6	-53.9	0	0	0	0	115.6	E31 H32	E31-S34 WeakPolarHBondContact OE1-CA 3.32Å; H32-S34 VanDerWaalsContact C-N 3.3Å; H32-S34 PolarHBondContact O-N 3.14Å
35	I	97.7	Very high	96.7	Very high	68 Å²	68	63.8 Å²	63.8	35%	0.349	32%	0.321	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.1	131.1	172.7	-56.9	172.3	0	0	0	108.1	E31 H32 A33 Y37 K63	E31-I35 WeakPolarHBondContact CA-O 3.09Å; H32-I35 PolarHBondContact N-O 2.9Å; H32-I35 PolarHBondContact O-N 2.9Å; A33-I35 PolarHBondContact O-N 3.28Å; I35-Y37 HydrophobicContact CB-CE2 3.68Å; I35-Y37 HydrophobicContact CG2-CD2 4.36Å; I35-Y37 HydrophobicContact CG2-CE1 3.96Å; I35-Y37 HydrophobicContact CG2-CE2 3.64Å; I35-Y37 VanDerWaalsContact CG2-CZ 3.41Å; I35-Y37 WeakPolarHBondContact CG2-OH 2.97Å; I35-Y37 VanDerWaalsContact O-CD2 3.26Å; I35-Y37 WeakPolarHBondContact O-CD2 3.22Å; I35-Y37 WeakPolarHBondContact O-CE2 3.16Å; I35-K63 HydrophobicContact CG2-CD 4.3Å; I35-K63 HydrophobicContact CG2-CG 4.11Å
36	H	98.3	Very high	96.7	Very high	79 Å²	79	69.5 Å²	69.5	37%	0.366	35%	0.347	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.3	138.3	176.5	-68.7	78.3	0	0	0	110.7	L29 Y30 L64	L29-H36 HydrophobicContact CD1-CB 4.16Å; Y30-H36 CarbonylContact O-C 3.58Å; Y30-H36 WeakPolarHBondContact O-CA 3.32Å; H36-L64 HydrophobicContact CB-CB 3.84Å; H36-L64 HydrophobicContact CB-CD2 3.93Å; H36-L64 PolarHBondContact O-N 3.22Å
37	Y	97.9	Very high	96.6	Very high	25 Å²	25	69.8 Å²	69.8	10%	0.098	37%	0.367	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.5	148.8	-179.3	-59.6	-87.6	0	0	0	110.6	L29 Y30 H32 I35 P61 C62 K63	L29-Y37 WeakPolarHBondContact CA-O 3.35Å; L29-Y37 WeakPolarHBondContact CD1-O 3.37Å; Y30-Y37 HydrophobicContact CD2-CD2 4.21Å; Y30-Y37 AromaticContact CE2-CD2 3.78Å; Y30-Y37 HydrophobicContact CE2-CD2 3.78Å; Y30-Y37 AromaticContact CE2-CG 3.92Å; Y30-Y37 HydrophobicContact CE2-CG 3.92Å; Y30-Y37 VanDerWaalsContact CZ-CB 3.47Å; Y30-Y37 PolarHBondContact N-O 3.08Å; Y30-Y37 PolarHBondContact O-N 3.4Å; H32-Y37 HydrophobicContact CB-CD2 4.27Å; H32-Y37 HydrophobicContact CB-CE2 3.93Å; I35-Y37 HydrophobicContact CB-CE2 3.68Å; I35-Y37 HydrophobicContact CG2-CD2 4.36Å; I35-Y37 HydrophobicContact CG2-CE1 3.96Å; I35-Y37 HydrophobicContact CG2-CE2 3.64Å; I35-Y37 VanDerWaalsContact CG2-CZ 3.41Å; I35-Y37 WeakPolarHBondContact CG2-OH 2.97Å; I35-Y37 VanDerWaalsContact O-CD2 3.26Å; I35-Y37 WeakPolarHBondContact O-CD2 3.22Å; I35-Y37 WeakPolarHBondContact O-CE2 3.16Å; Y37-P61 HydrophobicContact CD1-CB 3.67Å; Y37-P61 HydrophobicContact CD1-CG 3.73Å; Y37-P61 HydrophobicContact CE1-CB 4.13Å; Y37-P61 HydrophobicContact CE1-CG 3.64Å; Y37-P61 HydrophobicContact CG-CB 4.28Å; Y37-C62 CarbonylContact C-O 3.02Å; Y37-C62 WeakPolarHBondContact CA-O 3.49Å; Y37-K63 HydrophobicContact CD1-CG 4.02Å; Y37-K63 HydrophobicContact CE1-CG 3.65Å
38	V	97.4	Very high	96.6	Very high	7 Å²	7	70 Å²	70	4%	0.042	36%	0.361	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.1	128.7	177	177.9	0	0	0	0	108.5	V27 E28 L29 I40 C62 L64 F67	V27-V38 HydrophobicContact CG1-CG1 3.91Å; E28-V38 CarbonylContact O-C 3.58Å; E28-V38 WeakPolarHBondContact O-CA 2.97Å; L29-V38 HydrophobicContact CD1-CG2 4.21Å; V38-I40 HydrophobicContact CG1-CD1 4.5Å; V38-I40 HydrophobicContact CG1-CG1 4.04Å; V38-C62 PolarHBondContact N-O 2.84Å; V38-L64 HydrophobicContact CG2-CB 4.33Å; V38-L64 HydrophobicContact CG2-CD1 3.61Å; V38-F67 HydrophobicContact CB-CB 4.37Å; V38-F67 HydrophobicContact CB-CG 4.25Å; V38-F67 HydrophobicContact CG1-CD1 4.35Å; V38-F67 HydrophobicContact CG1-CD2 4.26Å; V38-F67 HydrophobicContact CG1-CE2 4.41Å; V38-F67 HydrophobicContact CG1-CG 4.21Å; V38-F67 HydrophobicContact CG2-CB 4.23Å; V38-F67 HydrophobicContact CG2-CD1 4.04Å; V38-F67 HydrophobicContact CG2-CG 4.15Å
39	E	96.4	Very high	96.7	Very high	43 Å²	43	74.4 Å²	74.4	20%	0.201	38%	0.379	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.5	140.3	167.7	-84.9	178.1	-155.9	0	0	109.9	E28 Y30 W41 Q52	E28-E39 HydrophobicContact CB-CB 4.27Å; E28-E39 PolarHBondContact N-O 3.2Å; E28-E39 PolarHBondContact O-N 3.19Å; Y30-E39 HydrophobicContact CE1-CB 4.21Å; Y30-E39 HydrophobicContact CE1-CG 3.7Å; Y30-E39 VanDerWaalsContact CE1-OE1 3.32Å; Y30-E39 WeakPolarHBondContact CE1-OE1 3.46Å; Y30-E39 PolarHBondContact OH-OE1 2.82Å; E39-W41 PolarHBondContact OE2-NE1 3.37Å; E39-Q52 PolarHBondContact OE2-NE2 3.41Å
40	I	96	Very high	96.6	Very high	2 Å²	2	72.2 Å²	72.2	1%	0.01	37%	0.371	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.5	122.2	179.7	-54.1	-172.3	0	0	0	107.9	W10 I25 M26 V38 L53 I55 F67	W10-I40 HydrophobicContact CD2-CD1 3.75Å; W10-I40 HydrophobicContact CE3-CD1 3.8Å; W10-I40 HydrophobicContact CE3-CG2 4.03Å; W10-I40 HydrophobicContact CH2-CD1 3.67Å; W10-I40 HydrophobicContact CH2-CG2 3.93Å; W10-I40 HydrophobicContact CZ2-CD1 3.61Å; W10-I40 HydrophobicContact CZ3-CD1 3.76Å; W10-I40 HydrophobicContact CZ3-CG2 3.45Å; W10-I40 VanDerWaalsContact CZ3-CG2 3.45Å; I25-I40 HydrophobicContact CG2-CG2 3.78Å; M26-I40 WeakPolarHBondContact O-CA 3.38Å; V38-I40 HydrophobicContact CG1-CD1 4.5Å; V38-I40 HydrophobicContact CG1-CG1 4.04Å; I40-L53 HydrophobicContact CB-CB 4.26Å; I40-L53 HydrophobicContact CG2-CB 4.21Å; I40-L53 HydrophobicContact CG2-CD1 3.81Å; I40-L53 HydrophobicContact CG2-CG 4.36Å; I40-L53 PolarHBondContact O-N 3.37Å; I40-I55 HydrophobicContact CD1-CD1 3.42Å; I40-I55 VanDerWaalsContact CD1-CD1 3.42Å; I40-I55 HydrophobicContact CD1-CG1 3.97Å; I40-I55 HydrophobicContact CG1-CD1 4.06Å; I40-F67 HydrophobicContact CD1-CE2 3.8Å; I40-F67 HydrophobicContact CD1-CZ 4.38Å
41	W	97.2	Very high	96.6	Very high	70 Å²	70	72 Å²	72	27%	0.265	38%	0.377	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.2	140.5	175.1	-64.6	89.2	0	0	0	109.4	I25 M26 E39 P50 V51 Q52	I25-W41 CarbonylContact C-O 3.54Å; I25-W41 WeakPolarHBondContact CA-O 3.12Å; M26-W41 HydrophobicContact CB-CB 4.22Å; M26-W41 HydrophobicContact CE-CB 3.59Å; M26-W41 PolarHBondContact N-O 3.43Å; M26-W41 PolarHBondContact O-N 3.33Å; E39-W41 PolarHBondContact OE2-NE1 3.37Å; W41-P50 HydrophobicContact CE3-CB 4.35Å; W41-V51 CarbonylContact C-O 3.59Å; W41-V51 WeakPolarHBondContact CA-O 3.48Å; W41-Q52 HydrophobicContact CD2-CB 4.15Å; W41-Q52 HydrophobicContact CD2-CG 4.28Å; W41-Q52 HydrophobicContact CE3-CB 3.85Å; W41-Q52 HydrophobicContact CE3-CG 4.47Å; W41-Q52 HydrophobicContact CH2-CB 3.87Å; W41-Q52 HydrophobicContact CH2-CG 4.29Å; W41-Q52 HydrophobicContact CZ2-CB 4.15Å; W41-Q52 HydrophobicContact CZ2-CG 4.07Å; W41-Q52 HydrophobicContact CZ3-CB 3.71Å; W41-Q52 HydrophobicContact CZ3-CG 4.49Å
42	Y	97.5	Very high	96.5	Very high	1 Å²	1	70.2 Å²	70.2	0%	0.004	37%	0.369	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.1	127.2	178.6	177.3	-113.6	0	0	0	110.8	L3 L7 L17 P19 C24 I25 R44 P50 V51 L53	L3-Y42 HydrophobicContact CD1-CE2 4.43Å; L7-Y42 HydrophobicContact CD1-CE2 4.44Å; L17-Y42 HydrophobicContact CB-CE1 4.19Å; L17-Y42 HydrophobicContact CD2-CD1 3.96Å; L17-Y42 HydrophobicContact CD2-CE1 4.16Å; L17-Y42 PolarHBondContact O-OH 3.02Å; L17-Y42 VanDerWaalsContact O-OH 3.09Å; P19-Y42 VanDerWaalsContact CA-OH 3.28Å; P19-Y42 WeakPolarHBondContact CA-OH 3.2Å; C24-Y42 WeakPolarHBondContact O-CD2 3.45Å; I25-Y42 HydrophobicContact CG1-CD2 3.66Å; I25-Y42 HydrophobicContact CG1-CE2 4.25Å; Y42-R44 HydrophobicContact CE1-CB 3.8Å; Y42-R44 HydrophobicContact CE1-CG 4.02Å; Y42-P50 CarbonylContact O-C 3.6Å; Y42-P50 VanDerWaalsContact O-CA 3.3Å; Y42-P50 WeakPolarHBondContact O-CA 3.24Å; Y42-V51 HydrophobicContact CD1-CG2 4.43Å; Y42-V51 PolarHBondContact N-O 2.8Å; Y42-V51 PolarHBondContact O-N 3.05Å; Y42-L53 HydrophobicContact CG-CD1 4.39Å
43	R	97.2	Very high	96.5	Very high	88 Å²	88	64.8 Å²	64.8	33%	0.332	35%	0.345	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.8	118.8	169.4	-173	175.6	65.2	-168.6	-1	108.6	S23 C24 G45 K48 P50	S23-R43 CarbonylContact C-O 3.52Å; S23-R43 WeakPolarHBondContact CA-O 3.4Å; S23-R43 WeakPolarHBondContact CB-O 3.44Å; C24-R43 PolarHBondContact N-O 3.19Å; C24-R43 PolarHBondContact O-N 2.83Å; R43-G45 VanDerWaalsContact C-N 3.3Å; R43-G45 WeakPolarHBondContact CG-O 3.42Å; R43-G45 PolarHBondContact O-N 2.71Å; R43-K48 VanDerWaalsContact CD-O 3.29Å; R43-K48 WeakPolarHBondContact CD-O 3.47Å; R43-K48 HydrophobicContact CG-CB 4.46Å; R43-K48 VanDerWaalsContact CG-O 3.29Å; R43-K48 WeakPolarHBondContact CG-O 3.5Å; R43-P50 HydrophobicContact CB-CB 4.44Å
44	R	95.4	Very high	96.5	Very high	69 Å²	69	67.3 Å²	67.3	26%	0.26	34%	0.341	S	S	.	.			trans	-71	-20	-174.4	-164.7	171.2	69	77	8.2	114.7	D16 F18 E20 S23 Y42	D16-R44 WeakPolarHBondContact O-CD 2.97Å; D16-R44 PolarHBondContact O-NE 3.24Å; F18-R44 WeakPolarHBondContact O-CD 3.43Å; F18-R44 WeakPolarHBondContact O-CG 3.35Å; E20-R44 WeakPolarHBondContact CA-O 3.26Å; E20-R44 WeakPolarHBondContact CB-O 3.42Å; E20-R44 PolarHBondContact N-O 3.17Å; E20-R44 IonicContact OE1-CZ 3.13Å; E20-R44 IonicContact OE1-NH1 2.68Å; E20-R44 PolarHBondContact OE1-NH1 3.11Å; E20-R44 IonicContact OE1-NH2 3.74Å; E20-R44 PolarHBondContact OE1-NH2 2.69Å; E20-R44 IonicContact OE2-NH2 3.9Å; S23-R44 WeakPolarHBondContact CB-O 3.48Å; Y42-R44 HydrophobicContact CE1-CB 3.8Å; Y42-R44 HydrophobicContact CE1-CG 4.02Å
45	G	95.7	Very high	96.4	Very high	0 Å²	0	63.1 Å²	63.1	0%	0	31%	0.31	C	S	.	.	S	Bend	trans	174.8	177.2	-179.3	0	0	0	0	0	112.5	F21 R43 G47 K48	F21-G45 VanDerWaalsContact O-CA 3.28Å; F21-G45 WeakPolarHBondContact O-CA 3.22Å; R43-G45 VanDerWaalsContact C-N 3.3Å; R43-G45 WeakPolarHBondContact CG-O 3.42Å; R43-G45 PolarHBondContact O-N 2.71Å; G45-G47 PolarHBondContact O-N 3.02Å; G45-K48 WeakPolarHBondContact O-CB 3.27Å; G45-K48 PolarHBondContact O-N 3.38Å; G45-K48 VanDerWaalsContact O-N 3.15Å
46	H	95.6	Very high	96.1	Very high	151 Å²	151	65.7 Å²	65.7	70%	0.699	32%	0.319	S	S	*	.	T	Hydrogen-bonded Turn	trans	-55.3	135.3	175.5	-172.9	76.5	0	0	0	111.6	F21 K48	F21-H46 PolarHBondContact O-N 2.93Å; F21-H46 VanDerWaalsContact O-N 3.08Å; H46-K48 PolarHBondContact O-N 2.98Å; H46-K48 VanDerWaalsContact O-N 3.14Å
47	G	95.5	Very high	95.8	Very high	74 Å²	74	67 Å²	67	76%	0.763	33%	0.329	S	S	*	.	T	Hydrogen-bonded Turn	trans	71.1	-2.8	-179.1	0	0	0	0	0	115.7	G45	G45-G47 PolarHBondContact O-N 3.02Å
48	K	95.9	Very high	95.6	Very high	89 Å²	89	66.8 Å²	66.8	39%	0.387	33%	0.331	S	S	.	.	P	Polyproline II helix	trans	-83.8	143.6	174.1	-52.1	-57.9	-178.2	-176.9	0	110.3	E20 R43 G45 H46	E20-K48 WeakPolarHBondContact OE2-CE 3.43Å; E20-K48 IonicContact OE2-NZ 3.93Å; R43-K48 VanDerWaalsContact CD-O 3.29Å; R43-K48 WeakPolarHBondContact CD-O 3.47Å; R43-K48 HydrophobicContact CG-CB 4.46Å; R43-K48 VanDerWaalsContact CG-O 3.29Å; R43-K48 WeakPolarHBondContact CG-O 3.5Å; G45-K48 WeakPolarHBondContact O-CB 3.27Å; G45-K48 PolarHBondContact O-N 3.38Å; G45-K48 VanDerWaalsContact O-N 3.15Å; H46-K48 PolarHBondContact O-N 2.98Å; H46-K48 VanDerWaalsContact O-N 3.14Å
49	K	97.1	Very high	95.4	Very high	185 Å²	185	74.9 Å²	74.9	80%	0.804	36%	0.36	S	S	*	.	P	Polyproline II helix	trans	-70.7	142.4	172.2	-68.5	-176	179.1	-178.8	0	110
50	P	96.9	Very high	95.2	Very high	63 Å²	63	77.8 Å²	77.8	41%	0.409	37%	0.374	S	S	.	.	P	Polyproline II helix	trans	-67.5	145.4	171.3	29.6	-33.5	0	0	0	110.5	M26 W41 Y42 R43	M26-P50 HydrophobicContact CE-CB 3.73Å; W41-P50 HydrophobicContact CE3-CB 4.35Å; Y42-P50 CarbonylContact O-C 3.6Å; Y42-P50 VanDerWaalsContact O-CA 3.3Å; Y42-P50 WeakPolarHBondContact O-CA 3.24Å; R43-P50 HydrophobicContact CB-CB 4.44Å
51	V	96.3	Very high	95.1	Very high	70 Å²	70	81 Å²	81	42%	0.424	40%	0.395	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.7	140.5	173.3	-62.8	0	0	0	0	109.1	L17 W41 Y42 L53	L17-V51 HydrophobicContact CD2-CG2 4.27Å; W41-V51 CarbonylContact C-O 3.59Å; W41-V51 WeakPolarHBondContact CA-O 3.48Å; Y42-V51 HydrophobicContact CD1-CG2 4.43Å; Y42-V51 PolarHBondContact N-O 2.8Å; Y42-V51 PolarHBondContact O-N 3.05Å; V51-L53 HydrophobicContact CG2-CD2 4.44Å
52	Q	96.1	Very high	95.1	Very high	81 Å²	81	78.1 Å²	78.1	38%	0.379	39%	0.385	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.9	129.8	174.5	-161.9	176.3	17.1	0	0	109.2	E39 W41	E39-Q52 PolarHBondContact OE2-NE2 3.41Å; W41-Q52 HydrophobicContact CD2-CB 4.15Å; W41-Q52 HydrophobicContact CD2-CG 4.28Å; W41-Q52 HydrophobicContact CE3-CB 3.85Å; W41-Q52 HydrophobicContact CE3-CG 4.47Å; W41-Q52 HydrophobicContact CH2-CB 3.87Å; W41-Q52 HydrophobicContact CH2-CG 4.29Å; W41-Q52 HydrophobicContact CZ2-CB 4.15Å; W41-Q52 HydrophobicContact CZ2-CG 4.07Å; W41-Q52 HydrophobicContact CZ3-CB 3.71Å; W41-Q52 HydrophobicContact CZ3-CG 4.49Å
53	L	95.9	Very high	95.1	Very high	14 Å²	14	82 Å²	82	7%	0.073	40%	0.402	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.4	129.7	176.6	-63	-177.4	0	0	0	110	L7 W10 V12 L17 I40 Y42 V51	L7-L53 HydrophobicContact CD2-CD1 3.5Å; L7-L53 HydrophobicContact CD2-CD2 4.48Å; W10-L53 HydrophobicContact CE3-CD1 4.27Å; W10-L53 HydrophobicContact CZ3-CD1 4.37Å; V12-L53 HydrophobicContact CG2-CD1 4.13Å; V12-L53 HydrophobicContact CG2-CD2 4.36Å; L17-L53 HydrophobicContact CD1-CD2 4.17Å; I40-L53 HydrophobicContact CB-CB 4.26Å; I40-L53 HydrophobicContact CG2-CB 4.21Å; I40-L53 HydrophobicContact CG2-CD1 3.81Å; I40-L53 HydrophobicContact CG2-CG 4.36Å; I40-L53 PolarHBondContact O-N 3.37Å; Y42-L53 HydrophobicContact CG-CD1 4.39Å; V51-L53 HydrophobicContact CG2-CD2 4.44Å
54	K	94.5	Very high	95.1	Very high	131 Å²	131	80.4 Å²	80.4	57%	0.57	40%	0.4	S	S	*	.			trans	-96.1	100.8	177.1	-50.8	-160.7	162.6	-134.7	0	109.4	V12 K56 E60	V12-K54 WeakPolarHBondContact CG1-O 3.45Å; K54-K56 PolarHBondContact O-N 2.87Å; K54-E60 WeakPolarHBondContact CB-OE1 3.42Å; K54-E60 WeakPolarHBondContact CD-OE1 3.31Å; K54-E60 WeakPolarHBondContact CE-OE1 3.46Å; K54-E60 WeakPolarHBondContact CG-OE1 3.46Å; K54-E60 VanDerWaalsContact NZ-CD 3.32Å; K54-E60 IonicContact NZ-OE1 2.81Å; K54-E60 PolarHBondContact NZ-OE1 2.89Å; K54-E60 VanDerWaalsContact NZ-OE1 3.11Å; K54-E60 IonicContact NZ-OE2 3.11Å; K54-E60 PolarHBondContact NZ-OE2 3.05Å
55	I	93.7	Very high	95.1	Very high	15 Å²	15	85.1 Å²	85.1	8%	0.077	43%	0.425	C	S	.	.			trans	-62.7	128.4	-177.3	-52.4	177.1	0	0	0	108.8	W10 I40 D57 C58 F67 I70	W10-I55 HydrophobicContact CB-CG2 4.24Å; I40-I55 HydrophobicContact CD1-CD1 3.42Å; I40-I55 VanDerWaalsContact CD1-CD1 3.42Å; I40-I55 HydrophobicContact CD1-CG1 3.97Å; I40-I55 HydrophobicContact CG1-CD1 4.06Å; I55-D57 PolarHBondContact O-N 3.28Å; I55-C58 HydrophobicContact CB-CB 4.03Å; I55-C58 HydrophobicContact CG2-CB 4.31Å; I55-C58 PolarHBondContact O-N 3.01Å; I55-F67 HydrophobicContact CD1-CD2 3.36Å; I55-F67 HydrophobicContact CD1-CE2 3.61Å; I55-I70 HydrophobicContact CG2-CD1 4.18Å; I55-I70 HydrophobicContact CG2-CG2 4.08Å
56	K	92.2	Very high	95.1	Very high	122 Å²	122	87.1 Å²	87.1	53%	0.53	43%	0.434	S	S	.	.	T	Hydrogen-bonded Turn	trans	-60.1	136.8	178.7	-170.8	-176.8	174.3	-175.2	0	109.7	W10 K54 C58	W10-K56 PolarHBondContact O-N 3.19Å; W10-K56 VanDerWaalsContact O-N 3.08Å; K54-K56 PolarHBondContact O-N 2.87Å; K56-C58 PolarHBondContact O-N 3.39Å
57	D	91.5	Very high	95.1	Very high	108 Å²	108	81.3 Å²	81.3	58%	0.578	41%	0.407	S	S	*	.	T	Hydrogen-bonded Turn	trans	65	10.6	179.4	-48.7	-37	0	0	0	115.2	I55	I55-D57 PolarHBondContact O-N 3.28Å
58	C	94.7	Very high	95	Very high	20 Å²	20	80.6 Å²	80.6	14%	0.135	39%	0.388	C	S	.	.	P	Polyproline II helix	trans	-103.5	136.2	167.6	-154.8	0	0	0	0	111.2	I55 K56 C62 I70	I55-C58 HydrophobicContact CB-CB 4.03Å; I55-C58 HydrophobicContact CG2-CB 4.31Å; I55-C58 PolarHBondContact O-N 3.01Å; K56-C58 PolarHBondContact O-N 3.39Å; C58-C62 HydrophobicContact CB-CB 3.98Å; C58-C62 WeakPolarHBondContact CB-SG 3.42Å; C58-C62 WeakPolarHBondContact SG-CA 3Å; C58-C62 WeakPolarHBondContact SG-CB 3.26Å; C58-C62 CovalentContact SG-SG 2.03Å; C58-C62 PolarHBondContact SG-SG 3.1Å; C58-I70 HydrophobicContact CB-CD1 3.57Å
59	R	93.5	Very high	94.8	Very high	177 Å²	177	79 Å²	79	67%	0.668	39%	0.392	S	S	*	.	P	Polyproline II helix	trans	-74.8	150	175.3	-70.7	179.7	-77.6	-163.9	-8.3	110	P61 C62 E66	R59-P61 CarbonylContact O-C 3.59Å; R59-P61 VanDerWaalsContact O-O 3.06Å; R59-C62 WeakPolarHBondContact O-CA 3.48Å; R59-C62 PolarHBondContact O-N 3.41Å; R59-E66 IonicContact CZ-OE1 2.71Å; R59-E66 VanDerWaalsContact CZ-OE1 3.3Å; R59-E66 PolarHBondContact N-OE2 3.47Å; R59-E66 IonicContact NE-OE1 2.65Å; R59-E66 PolarHBondContact NE-OE1 3.1Å; R59-E66 VanDerWaalsContact NE-OE1 3.13Å; R59-E66 IonicContact NE-OE2 3.3Å; R59-E66 IonicContact NH2-OE1 3.11Å; R59-E66 PolarHBondContact NH2-OE1 3.35Å
60	E	91.5	Very high	94.5	Very high	103 Å²	103	71 Å²	71	48%	0.481	36%	0.357	S	S	.	.	S	Bend	trans	-98.3	130.8	174.7	-74.1	178.6	-176.1	0	0	111	K54	K54-E60 WeakPolarHBondContact CB-OE1 3.42Å; K54-E60 WeakPolarHBondContact CD-OE1 3.31Å; K54-E60 WeakPolarHBondContact CE-OE1 3.46Å; K54-E60 WeakPolarHBondContact CG-OE1 3.46Å; K54-E60 VanDerWaalsContact NZ-CD 3.32Å; K54-E60 IonicContact NZ-OE1 2.81Å; K54-E60 PolarHBondContact NZ-OE1 2.89Å; K54-E60 VanDerWaalsContact NZ-OE1 3.11Å; K54-E60 IonicContact NZ-OE2 3.11Å; K54-E60 PolarHBondContact NZ-OE2 3.05Å
61	P	93.9	Very high	94.1	Very high	69 Å²	69	69.5 Å²	69.5	45%	0.448	35%	0.35	S	S	.	.	S	Bend	cis	-68.9	142.3	-7.1	29.7	-35.2	0	0	0	112.7	Y37 R59 K63	Y37-P61 HydrophobicContact CD1-CB 3.67Å; Y37-P61 HydrophobicContact CD1-CG 3.73Å; Y37-P61 HydrophobicContact CE1-CB 4.13Å; Y37-P61 HydrophobicContact CE1-CG 3.64Å; Y37-P61 HydrophobicContact CG-CB 4.28Å; R59-P61 CarbonylContact O-C 3.59Å; R59-P61 VanDerWaalsContact O-O 3.06Å; P61-K63 PolarHBondContact O-N 3.46Å
62	C	96.8	Very high	93.6	Very high	10 Å²	10	73.6 Å²	73.6	7%	0.068	37%	0.365	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.8	111.3	-172.6	-176.4	0	0	0	0	110.6	Y37 V38 C58 R59	Y37-C62 CarbonylContact C-O 3.02Å; Y37-C62 WeakPolarHBondContact CA-O 3.49Å; V38-C62 PolarHBondContact N-O 2.84Å; C58-C62 HydrophobicContact CB-CB 3.98Å; C58-C62 WeakPolarHBondContact CB-SG 3.42Å; C58-C62 WeakPolarHBondContact SG-CA 3Å; C58-C62 WeakPolarHBondContact SG-CB 3.26Å; C58-C62 CovalentContact SG-SG 2.03Å; C58-C62 PolarHBondContact SG-SG 3.1Å; R59-C62 WeakPolarHBondContact O-CA 3.48Å; R59-C62 PolarHBondContact O-N 3.41Å
63	K	97.5	Very high	93.1	Very high	82 Å²	82	76.7 Å²	76.7	36%	0.357	38%	0.377	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-65.7	141	176.9	-68.2	179.9	179.8	-179.1	0	109.7	I35 Y37 P61 Q65 E66 F67	I35-K63 HydrophobicContact CG2-CD 4.3Å; I35-K63 HydrophobicContact CG2-CG 4.11Å; Y37-K63 HydrophobicContact CD1-CG 4.02Å; Y37-K63 HydrophobicContact CE1-CG 3.65Å; P61-K63 PolarHBondContact O-N 3.46Å; K63-Q65 PolarHBondContact O-N 3.11Å; K63-Q65 VanDerWaalsContact O-N 3.16Å; K63-E66 HydrophobicContact CB-CB 4.48Å; K63-E66 HydrophobicContact CB-CG 4.21Å; K63-E66 PolarHBondContact O-N 2.99Å; K63-F67 PolarHBondContact O-N 2.83Å
64	L	97.4	Very high	92.5	Very high	56 Å²	56	80.3 Å²	80.3	29%	0.293	39%	0.39	S	S	.	.	H	α-helix	trans	-52.8	-41	179.2	176.9	62.6	0	0	0	112.4	L29 H36 V38 E66 F67 V68	L29-L64 HydrophobicContact CD1-CD1 4.26Å; L29-L64 HydrophobicContact CD1-CD2 4.22Å; H36-L64 HydrophobicContact CB-CB 3.84Å; H36-L64 HydrophobicContact CB-CD2 3.93Å; H36-L64 PolarHBondContact O-N 3.22Å; V38-L64 HydrophobicContact CG2-CB 4.33Å; V38-L64 HydrophobicContact CG2-CD1 3.61Å; L64-E66 PolarHBondContact O-N 3.17Å; L64-F67 HydrophobicContact CD1-CD1 4.49Å; L64-F67 WeakPolarHBondContact O-CB 3.47Å; L64-F67 PolarHBondContact O-N 3.1Å; L64-V68 HydrophobicContact CD1-CG2 4.1Å; L64-V68 HydrophobicContact CG-CG2 4.41Å; L64-V68 VanDerWaalsContact O-CG2 3.3Å; L64-V68 WeakPolarHBondContact O-CG2 3.48Å; L64-V68 PolarHBondContact O-N 3Å
65	Q	95.5	Very high	91.8	Very high	168 Å²	168	76.4 Å²	76.4	79%	0.785	38%	0.382	S	S	*	.	H	α-helix	trans	-65.2	-38.6	178.9	-68.3	178.4	-10.8	0	0	112.9	K63 A69	K63-Q65 PolarHBondContact O-N 3.11Å; K63-Q65 VanDerWaalsContact O-N 3.16Å; Q65-A69 PolarHBondContact O-N 3.43Å; Q65-A69 VanDerWaalsContact O-N 3.14Å
66	E	95.5	Very high	90.6	Very high	41 Å²	41	79.2 Å²	79.2	19%	0.192	40%	0.403	C	S	.	.	H	α-helix	trans	-67.6	-42.8	175.6	-65.8	-176.3	179.5	0	0	110.3	R59 K63 L64 A69 I70	R59-E66 IonicContact CZ-OE1 2.71Å; R59-E66 VanDerWaalsContact CZ-OE1 3.3Å; R59-E66 PolarHBondContact N-OE2 3.47Å; R59-E66 IonicContact NE-OE1 2.65Å; R59-E66 PolarHBondContact NE-OE1 3.1Å; R59-E66 VanDerWaalsContact NE-OE1 3.13Å; R59-E66 IonicContact NE-OE2 3.3Å; R59-E66 IonicContact NH2-OE1 3.11Å; R59-E66 PolarHBondContact NH2-OE1 3.35Å; K63-E66 HydrophobicContact CB-CB 4.48Å; K63-E66 HydrophobicContact CB-CG 4.21Å; K63-E66 PolarHBondContact O-N 2.99Å; L64-E66 PolarHBondContact O-N 3.17Å; E66-A69 PolarHBondContact O-N 3.13Å; E66-I70 WeakPolarHBondContact O-CD1 3.45Å; E66-I70 VanDerWaalsContact O-CG1 3.31Å; E66-I70 WeakPolarHBondContact O-CG1 3.3Å; E66-I70 PolarHBondContact O-N 2.93Å; E66-I70 VanDerWaalsContact O-N 3.08Å
67	F	95.2	Very high	89.6	Confident	30 Å²	30	76.2 Å²	76.2	13%	0.132	40%	0.395	C	S	.	.	H	α-helix	trans	-58	-48.5	175.1	176.1	-105	0	0	0	112.6	W10 V38 I40 I55 K63 L64 A69 I70 A71	W10-F67 HydrophobicContact CZ2-CZ 4.38Å; W10-F67 AromaticContact NE1-CE2 3.62Å; W10-F67 AromaticContact NE1-CZ 3.93Å; V38-F67 HydrophobicContact CB-CB 4.37Å; V38-F67 HydrophobicContact CB-CG 4.25Å; V38-F67 HydrophobicContact CG1-CD1 4.35Å; V38-F67 HydrophobicContact CG1-CD2 4.26Å; V38-F67 HydrophobicContact CG1-CE2 4.41Å; V38-F67 HydrophobicContact CG1-CG 4.21Å; V38-F67 HydrophobicContact CG2-CB 4.23Å; V38-F67 HydrophobicContact CG2-CD1 4.04Å; V38-F67 HydrophobicContact CG2-CG 4.15Å; I40-F67 HydrophobicContact CD1-CE2 3.8Å; I40-F67 HydrophobicContact CD1-CZ 4.38Å; I55-F67 HydrophobicContact CD1-CD2 3.36Å; I55-F67 HydrophobicContact CD1-CE2 3.61Å; K63-F67 PolarHBondContact O-N 2.83Å; L64-F67 HydrophobicContact CD1-CD1 4.49Å; L64-F67 WeakPolarHBondContact O-CB 3.47Å; L64-F67 PolarHBondContact O-N 3.1Å; F67-A69 PolarHBondContact O-N 3Å; F67-I70 PolarHBondContact O-N 2.79Å; F67-A71 WeakPolarHBondContact O-CB 3.47Å; F67-A71 PolarHBondContact O-N 3.2Å
68	V	93.1	Very high	88.7	Confident	59 Å²	59	76 Å²	76	36%	0.358	39%	0.394	S	S	.	.	H	α-helix	trans	-61	-44.9	179.7	169.8	0	0	0	0	110.7	L64 I70 A71 E72	L64-V68 HydrophobicContact CD1-CG2 4.1Å; L64-V68 HydrophobicContact CG-CG2 4.41Å; L64-V68 VanDerWaalsContact O-CG2 3.3Å; L64-V68 WeakPolarHBondContact O-CG2 3.48Å; L64-V68 PolarHBondContact O-N 3Å; V68-I70 VanDerWaalsContact C-N 3.29Å; V68-I70 PolarHBondContact O-N 2.87Å; V68-A71 PolarHBondContact O-N 3.39Å; V68-A71 VanDerWaalsContact O-N 3.14Å; V68-E72 HydrophobicContact CG1-CG 4.27Å; V68-E72 WeakPolarHBondContact O-CG 3.2Å; V68-E72 PolarHBondContact O-N 2.78Å
69	A	92.8	Very high	87.6	Confident	56 Å²	56	80.7 Å²	80.7	46%	0.463	42%	0.416	S	S	.	.	H	α-helix	trans	-61.6	-36.8	178.1	0	0	0	0	0	112.7	Q65 E66 F67 K73	Q65-A69 PolarHBondContact O-N 3.43Å; Q65-A69 VanDerWaalsContact O-N 3.14Å; E66-A69 PolarHBondContact O-N 3.13Å; F67-A69 PolarHBondContact O-N 3Å; A69-K73 WeakPolarHBondContact O-CB 3.3Å; A69-K73 PolarHBondContact O-N 3.45Å
70	I	90.7	Very high	86.7	Confident	15 Å²	15	76.4 Å²	76.4	8%	0.077	41%	0.41	C	S	.	.	H	α-helix	trans	-67	-46.1	173.8	-68.5	164.3	0	0	0	110.3	I55 C58 E66 F67 V68 K73 Y74	I55-I70 HydrophobicContact CG2-CD1 4.18Å; I55-I70 HydrophobicContact CG2-CG2 4.08Å; C58-I70 HydrophobicContact CB-CD1 3.57Å; E66-I70 WeakPolarHBondContact O-CD1 3.45Å; E66-I70 VanDerWaalsContact O-CG1 3.31Å; E66-I70 WeakPolarHBondContact O-CG1 3.3Å; E66-I70 PolarHBondContact O-N 2.93Å; E66-I70 VanDerWaalsContact O-N 3.08Å; F67-I70 PolarHBondContact O-N 2.79Å; V68-I70 VanDerWaalsContact C-N 3.29Å; V68-I70 PolarHBondContact O-N 2.87Å; I70-K73 PolarHBondContact O-N 3.41Å; I70-Y74 HydrophobicContact CG2-CD2 3.8Å; I70-Y74 HydrophobicContact CG2-CE2 4.23Å; I70-Y74 WeakPolarHBondContact O-CD2 3.45Å; I70-Y74 PolarHBondContact O-N 3.27Å
71	A	88.6	Confident	86.1	Confident	32 Å²	32	73.4 Å²	73.4	26%	0.264	40%	0.403	S	S	.	.	H	α-helix	trans	-61.5	-45.1	179.5	0	0	0	0	0	111.7	F67 V68 K73 Y74 A75	F67-A71 WeakPolarHBondContact O-CB 3.47Å; F67-A71 PolarHBondContact O-N 3.2Å; V68-A71 PolarHBondContact O-N 3.39Å; V68-A71 VanDerWaalsContact O-N 3.14Å; A71-K73 PolarHBondContact O-N 3.3Å; A71-Y74 PolarHBondContact O-N 3.3Å; A71-A75 WeakPolarHBondContact O-CA 3.19Å; A71-A75 WeakPolarHBondContact O-CB 3.28Å; A71-A75 PolarHBondContact O-N 3.25Å
72	E	86.1	Confident	85.3	Confident	156 Å²	156	73.4 Å²	73.4	73%	0.729	40%	0.399	S	S	*	.	H	α-helix	trans	-60.7	-33.1	176.5	-73.2	176.7	168	0	0	112.8	V68	V68-E72 HydrophobicContact CG1-CG 4.27Å; V68-E72 WeakPolarHBondContact O-CG 3.2Å; V68-E72 PolarHBondContact O-N 2.78Å
73	K	85.4	Confident	84.3	Confident	146 Å²	146	74.8 Å²	74.8	64%	0.635	41%	0.408	S	S	*	.	H	α-helix	trans	-78.4	-38.9	-178.9	-174.4	179.1	177.9	-166.6	0	113.3	A69 I70 A71	A69-K73 WeakPolarHBondContact O-CB 3.3Å; A69-K73 PolarHBondContact O-N 3.45Å; I70-K73 PolarHBondContact O-N 3.41Å; A71-K73 PolarHBondContact O-N 3.3Å
74	Y	83	Confident	83.7	Confident	91 Å²	91	76.3 Å²	76.3	36%	0.357	42%	0.417	S	S	.	.	H	α-helix	trans	-115.7	-7	-168.5	-59.1	-62.8	0	0	0	114.7	I70 A71 S76	I70-Y74 HydrophobicContact CG2-CD2 3.8Å; I70-Y74 HydrophobicContact CG2-CE2 4.23Å; I70-Y74 WeakPolarHBondContact O-CD2 3.45Å; I70-Y74 PolarHBondContact O-N 3.27Å; A71-Y74 PolarHBondContact O-N 3.3Å; Y74-S76 PolarHBondContact O-N 2.85Å; Y74-S76 VanDerWaalsContact O-N 3.14Å
75	A	79.2	Confident	83.1	Confident	48 Å²	48	79.5 Å²	79.5	40%	0.397	43%	0.428	S	S	.	.			trans	-55.9	124.3	177.4	0	0	0	0	0	110.1	A71 V77	A71-A75 WeakPolarHBondContact O-CA 3.19Å; A71-A75 WeakPolarHBondContact O-CB 3.28Å; A71-A75 PolarHBondContact O-N 3.25Å; A75-V77 PolarHBondContact O-N 3.13Å; A75-V77 VanDerWaalsContact O-N 3.1Å
76	S	69	Low	82.6	Confident	74 Å²	74	75.8 Å²	75.8	52%	0.517	41%	0.41	S	S	.	.	S	Bend	trans	-62.9	-15.7	-179.8	47.8	0	0	0	0	114.1	D9 Y74	D9-S76 PolarHBondContact OD2-N 3.46Å; D9-S76 VanDerWaalsContact OD2-N 3.1Å; D9-S76 PolarHBondContact OD2-OG 3.43Å; Y74-S76 PolarHBondContact O-N 2.85Å; Y74-S76 VanDerWaalsContact O-N 3.14Å
77	V	70.1	Confident	82	Confident	60 Å²	60	81.7 Å²	81.7	36%	0.364	44%	0.435	S	S	.	.	S	Bend	trans	-127.8	125.7	-175.4	-178.3	0	0	0	0	110	M1 A75 I79 D82	M1-V77 HydrophobicContact CE-CG2 4.46Å; A75-V77 PolarHBondContact O-N 3.13Å; A75-V77 VanDerWaalsContact O-N 3.1Å; V77-I79 PolarHBondContact O-N 2.97Å; V77-I79 VanDerWaalsContact O-N 3.17Å; V77-D82 WeakPolarHBondContact CG1-OD2 2.96Å
78	N	74	Confident	81.7	Confident	103 Å²	103	88.2 Å²	88.2	55%	0.551	47%	0.466	S	S	*	.			trans	-82.8	87.6	167.6	-174.7	-18.2	0	0	0	109.2	T80 A81 D82	N78-T80 PolarHBondContact O-N 3.29Å; N78-T80 WeakPolarHBondContact OD1-CB 3.31Å; N78-T80 PolarHBondContact OD1-N 3.28Å; N78-A81 HydrophobicContact CB-CB 4.08Å; N78-A81 PolarHBondContact O-N 2.79Å; N78-A81 VanDerWaalsContact O-N 3.16Å; N78-A81 PolarHBondContact OD1-N 3.19Å; N78-A81 VanDerWaalsContact OD1-N 3.09Å; N78-D82 PolarHBondContact O-N 3.31Å; N78-D82 VanDerWaalsContact O-N 3.11Å
79	I	71.2	Confident	81.6	Confident	119 Å²	119	90.8 Å²	90.8	61%	0.61	48%	0.477	S	S	*	.	H	α-helix	trans	-60.3	-27.9	-178.4	-165.4	166	0	0	0	112.6	V77 D82 C83	V77-I79 PolarHBondContact O-N 2.97Å; V77-I79 VanDerWaalsContact O-N 3.17Å; I79-D82 PolarHBondContact O-N 3.33Å; I79-C83 VanDerWaalsContact O-CB 3.27Å; I79-C83 WeakPolarHBondContact O-CB 3.3Å; I79-C83 PolarHBondContact O-N 2.95Å; I79-C83 PolarHBondContact O-SG 3.41Å
80	T	74.7	Confident	81.2	Confident	86 Å²	86	91 Å²	91	53%	0.528	49%	0.485	S	S	.	.	H	α-helix	trans	-66.1	-47.7	176.7	-53.6	0	0	0	0	110.8	N78 D82 C83 E84	N78-T80 PolarHBondContact O-N 3.29Å; N78-T80 WeakPolarHBondContact OD1-CB 3.31Å; N78-T80 PolarHBondContact OD1-N 3.28Å; T80-D82 VanDerWaalsContact C-N 3.31Å; T80-D82 PolarHBondContact O-N 3.29Å; T80-C83 WeakPolarHBondContact O-CB 3.34Å; T80-C83 PolarHBondContact O-N 2.98Å; T80-E84 WeakPolarHBondContact O-CG 3.12Å; T80-E84 PolarHBondContact O-N 3.09Å
81	A	77.7	Confident	80.5	Confident	41 Å²	41	94.8 Å²	94.8	34%	0.339	51%	0.505	S	S	.	.	H	α-helix	trans	-62.3	-39.5	176.5	0	0	0	0	0	111.7	N78 E84 K85	N78-A81 HydrophobicContact CB-CB 4.08Å; N78-A81 PolarHBondContact O-N 2.79Å; N78-A81 VanDerWaalsContact O-N 3.16Å; N78-A81 PolarHBondContact OD1-N 3.19Å; N78-A81 VanDerWaalsContact OD1-N 3.09Å; A81-E84 PolarHBondContact O-N 2.84Å; A81-K85 WeakPolarHBondContact O-CB 3.29Å; A81-K85 PolarHBondContact O-N 3.49Å
82	D	76.8	Confident	79.7	Confident	69 Å²	69	101.7 Å²	101.7	37%	0.369	53%	0.531	S	S	.	.	H	α-helix	trans	-64.7	-43.1	174.5	-75.4	-16.7	0	0	0	111.4	V77 N78 I79 T80 E84 K85 F86	V77-D82 WeakPolarHBondContact CG1-OD2 2.96Å; N78-D82 PolarHBondContact O-N 3.31Å; N78-D82 VanDerWaalsContact O-N 3.11Å; I79-D82 PolarHBondContact O-N 3.33Å; T80-D82 VanDerWaalsContact C-N 3.31Å; T80-D82 PolarHBondContact O-N 3.29Å; D82-E84 PolarHBondContact O-N 2.81Å; D82-K85 WeakPolarHBondContact O-CB 3.49Å; D82-K85 PolarHBondContact O-N 3.03Å; D82-F86 HydrophobicContact CB-CE2 4.1Å; D82-F86 WeakPolarHBondContact O-CD2 3.4Å; D82-F86 WeakPolarHBondContact O-CG 3.48Å; D82-F86 PolarHBondContact O-N 2.8Å
83	C	77.7	Confident	78.6	Confident	39 Å²	39	102.1 Å²	102.1	26%	0.264	53%	0.531	S	S	.	.	H	α-helix	trans	-61	-40.4	175.1	-79.7	0	0	0	0	112.9	I79 T80 F86 K87	I79-C83 VanDerWaalsContact O-CB 3.27Å; I79-C83 WeakPolarHBondContact O-CB 3.3Å; I79-C83 PolarHBondContact O-N 2.95Å; I79-C83 PolarHBondContact O-SG 3.41Å; T80-C83 WeakPolarHBondContact O-CB 3.34Å; T80-C83 PolarHBondContact O-N 2.98Å; C83-F86 PolarHBondContact O-N 2.91Å; C83-K87 WeakPolarHBondContact O-CG 3.43Å; C83-K87 PolarHBondContact O-N 3.43Å
84	E	84.6	Confident	77.7	Confident	113 Å²	113	100.9 Å²	100.9	53%	0.528	54%	0.535	S	S	.	.	H	α-helix	trans	-63.3	-46.7	174.7	-73.7	174.2	170.9	0	0	110.9	T80 A81 D82 F86 K87 E88	T80-E84 WeakPolarHBondContact O-CG 3.12Å; T80-E84 PolarHBondContact O-N 3.09Å; A81-E84 PolarHBondContact O-N 2.84Å; D82-E84 PolarHBondContact O-N 2.81Å; E84-F86 VanDerWaalsContact C-N 3.31Å; E84-F86 PolarHBondContact O-N 2.65Å; E84-K87 WeakPolarHBondContact O-CB 3.47Å; E84-K87 PolarHBondContact O-N 2.82Å; E84-K87 VanDerWaalsContact O-N 3.1Å; E84-E88 WeakPolarHBondContact O-CG 3.28Å; E84-E88 PolarHBondContact O-N 2.81Å
85	K	85	Confident	76.7	Confident	124 Å²	124	103.7 Å²	103.7	54%	0.539	56%	0.557	S	S	.	*	H	α-helix	trans	-59.9	-40	175	-173.2	177.7	179.6	179.8	0	112.4	A81 D82 K87 E88 L89	A81-K85 WeakPolarHBondContact O-CB 3.29Å; A81-K85 PolarHBondContact O-N 3.49Å; D82-K85 WeakPolarHBondContact O-CB 3.49Å; D82-K85 PolarHBondContact O-N 3.03Å; K85-K87 VanDerWaalsContact C-N 3.34Å; K85-E88 PolarHBondContact O-N 3.16Å; K85-L89 HydrophobicContact CG-CD1 4.13Å; K85-L89 WeakPolarHBondContact O-CB 3.17Å; K85-L89 VanDerWaalsContact O-CG 3.24Å; K85-L89 WeakPolarHBondContact O-CG 3.07Å; K85-L89 PolarHBondContact O-N 2.78Å
86	F	83.4	Confident	75.7	Confident	89 Å²	89	109.3 Å²	109.3	39%	0.39	58%	0.575	S	S	.	*	H	α-helix	trans	-61.7	-43.2	174.5	-70.9	-52.9	0	0	0	111.5	D82 C83 E84 L89 G90 L91	D82-F86 HydrophobicContact CB-CE2 4.1Å; D82-F86 WeakPolarHBondContact O-CD2 3.4Å; D82-F86 WeakPolarHBondContact O-CG 3.48Å; D82-F86 PolarHBondContact O-N 2.8Å; C83-F86 PolarHBondContact O-N 2.91Å; E84-F86 VanDerWaalsContact C-N 3.31Å; E84-F86 PolarHBondContact O-N 2.65Å; F86-L89 CarbonylContact O-C 3.58Å; F86-L89 PolarHBondContact O-N 2.93Å; F86-G90 PolarHBondContact O-N 3.4Å; F86-L91 CarbonylContact C-O 3.5Å; F86-L91 HydrophobicContact CB-CB 4.24Å; F86-L91 HydrophobicContact CD1-CB 4.28Å; F86-L91 HydrophobicContact CD1-CD1 3.81Å; F86-L91 HydrophobicContact CE1-CD1 4.42Å; F86-L91 WeakPolarHBondContact O-CA 3.29Å; F86-L91 WeakPolarHBondContact O-CB 3.37Å; F86-L91 PolarHBondContact O-N 3.46Å
87	K	84.5	Confident	75	Confident	166 Å²	166	114.6 Å²	114.6	72%	0.722	59%	0.588	S	S	*	*	H	α-helix	trans	-62.3	-43.6	175.8	-72.6	175.9	-178.4	176.5	0	112.4	C83 E84 K85 L89 G90	C83-K87 WeakPolarHBondContact O-CG 3.43Å; C83-K87 PolarHBondContact O-N 3.43Å; E84-K87 WeakPolarHBondContact O-CB 3.47Å; E84-K87 PolarHBondContact O-N 2.82Å; E84-K87 VanDerWaalsContact O-N 3.1Å; K85-K87 VanDerWaalsContact C-N 3.34Å; K87-L89 VanDerWaalsContact C-N 3.27Å; K87-L89 PolarHBondContact O-N 3.34Å; K87-G90 PolarHBondContact O-N 2.89Å
88	E	88.8	Confident	74.5	Confident	167 Å²	167	120 Å²	120	78%	0.78	62%	0.615	S	S	*	*	H	α-helix	trans	-61.7	-36.4	176.6	-71.4	-180	170.9	0	0	112.4	E84 K85 G90	E84-E88 WeakPolarHBondContact O-CG 3.28Å; E84-E88 PolarHBondContact O-N 2.81Å; K85-E88 PolarHBondContact O-N 3.16Å; E88-G90 PolarHBondContact O-N 2.81Å
89	L	89.4	Confident	73.7	Confident	112 Å²	112	124.7 Å²	124.7	59%	0.586	65%	0.647	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.1	0.4	174.4	-67.1	171.4	0	0	0	113.3	K85 F86 K87 L91	K85-L89 HydrophobicContact CG-CD1 4.13Å; K85-L89 WeakPolarHBondContact O-CB 3.17Å; K85-L89 VanDerWaalsContact O-CG 3.24Å; K85-L89 WeakPolarHBondContact O-CG 3.07Å; K85-L89 PolarHBondContact O-N 2.78Å; F86-L89 CarbonylContact O-C 3.58Å; F86-L89 PolarHBondContact O-N 2.93Å; K87-L89 VanDerWaalsContact C-N 3.27Å; K87-L89 PolarHBondContact O-N 3.34Å; L89-L91 HydrophobicContact CB-CD1 3.85Å; L89-L91 HydrophobicContact CB-CG 3.94Å; L89-L91 HydrophobicContact CD1-CD1 4.07Å; L89-L91 PolarHBondContact O-N 3.13Å
90	G	85.1	Confident	73.9	Confident	61 Å²	61	125 Å²	125	63%	0.629	65%	0.649	S	S	*	*	T	Hydrogen-bonded Turn	trans	68	16.3	-175.8	0	0	0	0	0	113.7	F86 K87 E88	F86-G90 PolarHBondContact O-N 3.4Å; K87-G90 PolarHBondContact O-N 2.89Å; E88-G90 PolarHBondContact O-N 2.81Å
91	L	76.6	Confident	73.8	Confident	95 Å²	95	127.1 Å²	127.1	50%	0.497	66%	0.655	S	S	.	*			trans	-85.2	125.8	178.9	-62.7	170.2	0	0	0	109	F86 L89	F86-L91 CarbonylContact C-O 3.5Å; F86-L91 HydrophobicContact CB-CB 4.24Å; F86-L91 HydrophobicContact CD1-CB 4.28Å; F86-L91 HydrophobicContact CD1-CD1 3.81Å; F86-L91 HydrophobicContact CE1-CD1 4.42Å; F86-L91 WeakPolarHBondContact O-CA 3.29Å; F86-L91 WeakPolarHBondContact O-CB 3.37Å; F86-L91 PolarHBondContact O-N 3.46Å; L89-L91 HydrophobicContact CB-CD1 3.85Å; L89-L91 HydrophobicContact CB-CG 3.94Å; L89-L91 HydrophobicContact CD1-CD1 4.07Å; L89-L91 PolarHBondContact O-N 3.13Å
92	Q	70.9	Confident	73.6	Confident	176 Å²	176	131.8 Å²	131.8	82%	0.822	67%	0.673	S	S	*	*			trans	-111.6	145	173.8	-64.1	-176.1	-4.4	0	0	108.9	V94	Q92-V94 PolarHBondContact O-N 2.82Å
93	F	62.9	Low	73.4	Confident	165 Å²	165	135.5 Å²	135.5	72%	0.724	69%	0.691	S	S	*	*			trans	-61.9	111.7	167.8	-74.8	-82.4	0	0	0	107.9	D95	F93-D95 PolarHBondContact O-N 3.15Å; F93-D95 VanDerWaalsContact O-N 3.16Å
94	V	66.8	Low	73.1	Confident	120 Å²	120	141.6 Å²	141.6	73%	0.727	72%	0.717	S	S	*	*			trans	-75	106.5	170.8	-172.8	0	0	0	0	105.8	Q92 Q96	Q92-V94 PolarHBondContact O-N 2.82Å; V94-Q96 HydrophobicContact CB-CG 4.44Å; V94-Q96 HydrophobicContact CG1-CG 3.75Å; V94-Q96 PolarHBondContact O-N 3.08Å
95	D	61.7	Low	72.4	Confident	151 Å²	151	143.5 Å²	143.5	81%	0.807	73%	0.73	S	S	*	*			trans	-69.2	77.9	168.2	-135.3	-1.9	0	0	0	106.7	F93 K97	F93-D95 PolarHBondContact O-N 3.15Å; F93-D95 VanDerWaalsContact O-N 3.16Å; D95-K97 PolarHBondContact O-N 3.14Å
96	Q	58.2	Low	71.5	Confident	166 Å²	166	144.9 Å²	144.9	78%	0.776	74%	0.744	S	S	*	*			trans	-67.5	89.4	171.2	-78.6	-167.5	-45.9	0	0	106.3	V94 L98	V94-Q96 HydrophobicContact CB-CG 4.44Å; V94-Q96 HydrophobicContact CG1-CG 3.75Å; V94-Q96 PolarHBondContact O-N 3.08Å; Q96-L98 VanDerWaalsContact C-N 3.35Å; Q96-L98 PolarHBondContact O-N 3.44Å
97	K	55.3	Low	70.6	Confident	184 Å²	184	149.2 Å²	149.2	80%	0.8	77%	0.771	S	S	*	*			trans	-54.2	109.7	155.8	-76.4	-172.5	-176.8	-176.4	0	105.6	D95 T99	D95-K97 PolarHBondContact O-N 3.14Å; K97-T99 PolarHBondContact O-N 2.82Å
98	L	58.9	Low	69.4	Low	175 Å²	175	147.8 Å²	147.8	92%	0.916	78%	0.775	S	S	*	*			trans	-60.5	92.1	164.5	-82	142.6	0	0	0	106.3	Q96	Q96-L98 VanDerWaalsContact C-N 3.35Å; Q96-L98 PolarHBondContact O-N 3.44Å
99	T	58.3	Low	67.6	Low	201 Å²	201	146 Å²	146	100%	1.233	77%	0.774	S	S	*	*			trans	-65.9	0	159.3	-3.1	0	0	0	0	108.8	K97	K97-T99 PolarHBondContact O-N 2.82Å

Retrieved 99 of 99 residues in 67.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).