A0A077ZMU6_TRITR Loading...

Neur chan LBD domain containing protein

AlphaFold DB , UniProt , Accession A0A077ZMU6, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 92 aa.

						>A0A077ZMU6_TRITR|A0A077ZMU6
MAKQRKLLKIAKQVLLRSVIFLLVSVCHCYKEQFEAFGTSELSRNRSQILNLLINKTYYDKRLRPNYGGPTVDVGITMHVSSISAVSEVEMV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	63.1	Low	79.7	Confident	197 Å²	197	131.5 Å²	131.5	97%	0.97	65%	0.647	S	S	*	*				0	-35.4	0	-65.1	-69.5	-109.4	0	0	114.8
2	A	70.9	Confident	80.7	Confident	74 Å²	74	132.5 Å²	132.5	61%	0.612	65%	0.646	S	S	*	*	H	α-helix	trans	-69.8	-35.5	-176.4	0	0	0	0	0	115.6	R5 K6	A2-R5 PolarHBondContact O-N 3.19Å; A2-K6 PolarHBondContact O-N 2.84Å
3	K	74.3	Confident	81.4	Confident	172 Å²	172	131.5 Å²	131.5	75%	0.748	64%	0.639	S	S	*	*	H	α-helix	trans	-63.9	-42.9	-179.7	-169.8	175.6	179.6	179.2	0	112.8	K6 L7	K3-K6 PolarHBondContact O-N 2.9Å; K3-L7 HydrophobicContact CG-CD1 4.41Å; K3-L7 PolarHBondContact O-N 3.42Å; K3-L7 VanDerWaalsContact O-N 3.08Å
4	Q	76.6	Confident	82.2	Confident	146 Å²	146	128.6 Å²	128.6	68%	0.682	63%	0.632	S	S	*	*	H	α-helix	trans	-61.7	-42.4	177.3	-75.1	-85.3	-26.4	0	0	112.3	K6 L7 L8	Q4-K6 PolarHBondContact O-N 3.37Å; Q4-L7 PolarHBondContact O-N 3.41Å; Q4-L8 PolarHBondContact O-N 3.47Å
5	R	77.4	Confident	82.9	Confident	185 Å²	185	127.8 Å²	127.8	70%	0.698	63%	0.631	S	S	*	*	H	α-helix	trans	-66.3	-36	176.3	-68.3	-177.3	178.8	-177.8	-0.9	112.9	A2 K9	A2-R5 PolarHBondContact O-N 3.19Å; R5-K9 WeakPolarHBondContact O-CG 3.43Å; R5-K9 PolarHBondContact O-N 3.12Å; R5-K9 VanDerWaalsContact O-N 3.16Å
6	K	80	Confident	83.5	Confident	153 Å²	153	126.6 Å²	126.6	67%	0.665	63%	0.627	S	S	*	*	H	α-helix	trans	-65.8	-44.5	174.7	-74.8	-173.5	178.9	-175	0	111.5	A2 K3 Q4 L8 K9 I10	A2-K6 PolarHBondContact O-N 2.84Å; K3-K6 PolarHBondContact O-N 2.9Å; Q4-K6 PolarHBondContact O-N 3.37Å; K6-L8 PolarHBondContact O-N 3.35Å; K6-K9 PolarHBondContact O-N 3.43Å; K6-I10 WeakPolarHBondContact O-CG1 3.43Å; K6-I10 PolarHBondContact O-N 3.46Å; K6-I10 VanDerWaalsContact O-N 3.07Å
7	L	82	Confident	84.2	Confident	101 Å²	101	129.8 Å²	129.8	53%	0.529	63%	0.631	S	S	.	*	H	α-helix	trans	-58.7	-45.7	175.5	-88.1	155.1	0	0	0	112.2	K3 Q4 K9 I10 A11	K3-L7 HydrophobicContact CG-CD1 4.41Å; K3-L7 PolarHBondContact O-N 3.42Å; K3-L7 VanDerWaalsContact O-N 3.08Å; Q4-L7 PolarHBondContact O-N 3.41Å; L7-K9 VanDerWaalsContact C-N 3.34Å; L7-K9 PolarHBondContact O-N 3.47Å; L7-I10 PolarHBondContact O-N 3.19Å; L7-A11 WeakPolarHBondContact O-CB 3.15Å; L7-A11 PolarHBondContact O-N 2.73Å
8	L	86.1	Confident	84.7	Confident	103 Å²	103	125.9 Å²	125.9	54%	0.539	62%	0.618	S	S	.	*	H	α-helix	trans	-63.4	-37.8	177.7	-173.9	66.2	0	0	0	112.7	Q4 K6 K12	Q4-L8 PolarHBondContact O-N 3.47Å; K6-L8 PolarHBondContact O-N 3.35Å; L8-K12 WeakPolarHBondContact O-CB 3.41Å; L8-K12 WeakPolarHBondContact O-CG 3.33Å; L8-K12 PolarHBondContact O-N 3.23Å
9	K	87.6	Confident	85.3	Confident	158 Å²	158	122.7 Å²	122.7	69%	0.687	61%	0.607	S	S	*	*	H	α-helix	trans	-64	-44.5	175.7	-75.6	-176.8	179.4	-170.9	0	111.7	R5 K6 L7 K12 Q13	R5-K9 WeakPolarHBondContact O-CG 3.43Å; R5-K9 PolarHBondContact O-N 3.12Å; R5-K9 VanDerWaalsContact O-N 3.16Å; K6-K9 PolarHBondContact O-N 3.43Å; L7-K9 VanDerWaalsContact C-N 3.34Å; L7-K9 PolarHBondContact O-N 3.47Å; K9-K12 PolarHBondContact O-N 3.02Å; K9-Q13 WeakPolarHBondContact O-CB 3.42Å; K9-Q13 PolarHBondContact O-N 3.34Å
10	I	88.6	Confident	85.8	Confident	98 Å²	98	121 Å²	121	50%	0.503	60%	0.599	S	S	.	*	H	α-helix	trans	-63.7	-46.9	177.2	-65.4	165.8	0	0	0	110.2	K6 L7 K12 Q13 V14	K6-I10 WeakPolarHBondContact O-CG1 3.43Å; K6-I10 PolarHBondContact O-N 3.46Å; K6-I10 VanDerWaalsContact O-N 3.07Å; L7-I10 PolarHBondContact O-N 3.19Å; I10-K12 PolarHBondContact O-N 2.96Å; I10-Q13 PolarHBondContact O-N 3.4Å; I10-Q13 VanDerWaalsContact O-N 3.08Å; I10-V14 HydrophobicContact CG2-CG2 4.3Å; I10-V14 WeakPolarHBondContact O-CG2 3.26Å; I10-V14 PolarHBondContact O-N 3.11Å
11	A	90.4	Very high	86.2	Confident	59 Å²	59	122.7 Å²	122.7	49%	0.488	60%	0.603	S	S	.	*	H	α-helix	trans	-58.5	-45.5	178.4	0	0	0	0	0	112.1	L7 Q13 V14 L15	L7-A11 WeakPolarHBondContact O-CB 3.15Å; L7-A11 PolarHBondContact O-N 2.73Å; A11-Q13 VanDerWaalsContact C-N 3.33Å; A11-Q13 PolarHBondContact O-N 3.07Å; A11-V14 PolarHBondContact O-N 3.17Å; A11-L15 WeakPolarHBondContact O-CB 3.45Å; A11-L15 PolarHBondContact O-N 3.12Å
12	K	91	Very high	87.7	Confident	144 Å²	144	118.6 Å²	118.6	63%	0.626	59%	0.585	S	S	*	*	H	α-helix	trans	-61.4	-40	173.9	-75.6	-172.6	177.3	-167.3	0	112.3	L8 K9 I10 L15 L16	L8-K12 WeakPolarHBondContact O-CB 3.41Å; L8-K12 WeakPolarHBondContact O-CG 3.33Å; L8-K12 PolarHBondContact O-N 3.23Å; K9-K12 PolarHBondContact O-N 3.02Å; I10-K12 PolarHBondContact O-N 2.96Å; K12-L15 PolarHBondContact O-N 2.81Å; K12-L16 WeakPolarHBondContact O-CB 3.41Å; K12-L16 PolarHBondContact O-N 2.94Å
13	Q	90	Very high	88.8	Confident	119 Å²	119	120.1 Å²	120.1	56%	0.556	58%	0.582	S	S	*	*	H	α-helix	trans	-68.6	-38	179.8	-168	170.3	21	0	0	112.4	K9 I10 A11 R17	K9-Q13 WeakPolarHBondContact O-CB 3.42Å; K9-Q13 PolarHBondContact O-N 3.34Å; I10-Q13 PolarHBondContact O-N 3.4Å; I10-Q13 VanDerWaalsContact O-N 3.08Å; A11-Q13 VanDerWaalsContact C-N 3.33Å; A11-Q13 PolarHBondContact O-N 3.07Å; Q13-R17 WeakPolarHBondContact O-CG 3.41Å; Q13-R17 PolarHBondContact O-N 3.38Å
14	V	93.3	Very high	89.8	Confident	91 Å²	91	116.3 Å²	116.3	55%	0.552	57%	0.573	S	S	*	*	H	α-helix	trans	-66.9	-44.6	174	175.7	0	0	0	0	110.7	I10 A11 L16 R17 S18	I10-V14 HydrophobicContact CG2-CG2 4.3Å; I10-V14 WeakPolarHBondContact O-CG2 3.26Å; I10-V14 PolarHBondContact O-N 3.11Å; A11-V14 PolarHBondContact O-N 3.17Å; V14-L16 VanDerWaalsContact C-N 3.33Å; V14-L16 PolarHBondContact O-N 3.23Å; V14-R17 PolarHBondContact O-N 3.16Å; V14-S18 PolarHBondContact O-N 3Å
15	L	92.7	Very high	90.6	Very high	117 Å²	117	112.6 Å²	112.6	61%	0.613	56%	0.563	S	S	*	*	H	α-helix	trans	-62.6	-40.4	177.4	-163.9	117.6	0	0	0	111.8	A11 K12 S18 V19	A11-L15 WeakPolarHBondContact O-CB 3.45Å; A11-L15 PolarHBondContact O-N 3.12Å; K12-L15 PolarHBondContact O-N 2.81Å; L15-S18 PolarHBondContact O-N 3.22Å; L15-S18 PolarHBondContact O-OG 3.18Å; L15-V19 VanDerWaalsContact O-CG2 3.24Å; L15-V19 WeakPolarHBondContact O-CG2 3.35Å; L15-V19 PolarHBondContact O-N 3.41Å; L15-V19 VanDerWaalsContact O-N 3.07Å
16	L	92.7	Very high	91.4	Very high	108 Å²	108	107 Å²	107	57%	0.565	55%	0.549	S	S	*	.	H	α-helix	trans	-63.8	-42.9	175.4	-176.3	62.8	0	0	0	111.5	K12 V14 V19 I20	K12-L16 WeakPolarHBondContact O-CB 3.41Å; K12-L16 PolarHBondContact O-N 2.94Å; V14-L16 VanDerWaalsContact C-N 3.33Å; V14-L16 PolarHBondContact O-N 3.23Å; L16-V19 PolarHBondContact O-N 3.01Å; L16-I20 HydrophobicContact CD1-CD1 4.31Å; L16-I20 HydrophobicContact CG-CD1 4.02Å; L16-I20 WeakPolarHBondContact O-CD1 3.31Å; L16-I20 VanDerWaalsContact O-CG1 3.26Å; L16-I20 WeakPolarHBondContact O-CG1 3.48Å; L16-I20 PolarHBondContact O-N 3.37Å
17	R	94.5	Very high	91.9	Very high	182 Å²	182	103.7 Å²	103.7	69%	0.687	54%	0.544	S	S	*	.	H	α-helix	trans	-65.2	-40.5	177.5	-77.9	-174.3	169.5	-144.6	-2	112.6	Q13 V14 I20 F21	Q13-R17 WeakPolarHBondContact O-CG 3.41Å; Q13-R17 PolarHBondContact O-N 3.38Å; V14-R17 PolarHBondContact O-N 3.16Å; R17-I20 PolarHBondContact O-N 3.07Å; R17-F21 PolarHBondContact O-N 3.39Å
18	S	93	Very high	92.3	Very high	59 Å²	59	104.1 Å²	104.1	41%	0.413	54%	0.543	S	S	.	.	H	α-helix	trans	-66.5	-39.7	177.9	67.8	0	0	0	0	111.9	V14 L15 F21 L22	V14-S18 PolarHBondContact O-N 3Å; L15-S18 PolarHBondContact O-N 3.22Å; L15-S18 PolarHBondContact O-OG 3.18Å; S18-F21 PolarHBondContact O-N 2.95Å; S18-L22 WeakPolarHBondContact O-CG 3.49Å; S18-L22 PolarHBondContact O-N 3.46Å
19	V	96.1	Very high	92.2	Very high	66 Å²	66	102.8 Å²	102.8	40%	0.4	54%	0.542	S	S	.	.	H	α-helix	trans	-62.8	-44.1	175	171.8	0	0	0	0	111.2	L15 L16 F21 L22 L23	L15-V19 VanDerWaalsContact O-CG2 3.24Å; L15-V19 WeakPolarHBondContact O-CG2 3.35Å; L15-V19 PolarHBondContact O-N 3.41Å; L15-V19 VanDerWaalsContact O-N 3.07Å; L16-V19 PolarHBondContact O-N 3.01Å; V19-F21 VanDerWaalsContact C-N 3.35Å; V19-F21 PolarHBondContact O-N 3.32Å; V19-L22 PolarHBondContact O-N 2.88Å; V19-L23 HydrophobicContact CG1-CD1 4.12Å; V19-L23 WeakPolarHBondContact O-CG 3.5Å; V19-L23 PolarHBondContact O-N 3.06Å
20	I	95.3	Very high	92	Very high	88 Å²	88	102.7 Å²	102.7	45%	0.451	54%	0.538	S	S	.	.	H	α-helix	trans	-61.8	-43.4	177.2	-68.6	164.1	0	0	0	111	L16 R17 L22 L23 V24	L16-I20 HydrophobicContact CD1-CD1 4.31Å; L16-I20 HydrophobicContact CG-CD1 4.02Å; L16-I20 WeakPolarHBondContact O-CD1 3.31Å; L16-I20 VanDerWaalsContact O-CG1 3.26Å; L16-I20 WeakPolarHBondContact O-CG1 3.48Å; L16-I20 PolarHBondContact O-N 3.37Å; R17-I20 PolarHBondContact O-N 3.07Å; I20-L22 PolarHBondContact O-N 3.5Å; I20-L23 PolarHBondContact O-N 3.32Å; I20-V24 HydrophobicContact CG2-CG2 4.38Å; I20-V24 WeakPolarHBondContact O-CG2 3.49Å; I20-V24 PolarHBondContact O-N 3.38Å
21	F	94.8	Very high	91.9	Very high	156 Å²	156	104.2 Å²	104.2	68%	0.684	54%	0.541	S	S	*	.	H	α-helix	trans	-62.5	-42.3	179.1	-169.7	-96.3	0	0	0	112.2	R17 S18 V19 V24 S25	R17-F21 PolarHBondContact O-N 3.39Å; S18-F21 PolarHBondContact O-N 2.95Å; V19-F21 VanDerWaalsContact C-N 3.35Å; V19-F21 PolarHBondContact O-N 3.32Å; F21-V24 PolarHBondContact O-N 3.21Å; F21-S25 WeakPolarHBondContact O-CB 3.35Å; F21-S25 PolarHBondContact O-N 3.2Å
22	L	94.5	Very high	91.3	Very high	112 Å²	112	107 Å²	107	59%	0.586	55%	0.545	S	S	*	.	H	α-helix	trans	-61.3	-45.2	174.2	-75.1	170.4	0	0	0	111.7	S18 V19 I20 V24 S25 V26	S18-L22 WeakPolarHBondContact O-CG 3.49Å; S18-L22 PolarHBondContact O-N 3.46Å; V19-L22 PolarHBondContact O-N 2.88Å; I20-L22 PolarHBondContact O-N 3.5Å; L22-V24 PolarHBondContact O-N 3.39Å; L22-S25 PolarHBondContact O-N 2.92Å; L22-V26 WeakPolarHBondContact O-CB 3.29Å; L22-V26 VanDerWaalsContact O-CG2 3.23Å; L22-V26 WeakPolarHBondContact O-CG2 3.44Å; L22-V26 PolarHBondContact O-N 3.25Å
23	L	94	Very high	90.6	Very high	106 Å²	106	106.5 Å²	106.5	56%	0.555	54%	0.544	S	S	*	.	H	α-helix	trans	-61.5	-42	177.7	-71.7	172.6	0	0	0	112.3	V19 I20 V26 C27	V19-L23 HydrophobicContact CG1-CD1 4.12Å; V19-L23 WeakPolarHBondContact O-CG 3.5Å; V19-L23 PolarHBondContact O-N 3.06Å; I20-L23 PolarHBondContact O-N 3.32Å; L23-V26 PolarHBondContact O-N 3.02Å; L23-C27 WeakPolarHBondContact O-CB 3.33Å; L23-C27 PolarHBondContact O-N 3.32Å; L23-C27 PolarHBondContact O-SG 2.98Å
24	V	94.9	Very high	89.9	Confident	92 Å²	92	108.1 Å²	108.1	56%	0.558	55%	0.55	S	S	*	.	H	α-helix	trans	-66.3	-44.1	177.5	172.9	0	0	0	0	111.2	I20 F21 L22 V26 C27 H28	I20-V24 HydrophobicContact CG2-CG2 4.38Å; I20-V24 WeakPolarHBondContact O-CG2 3.49Å; I20-V24 PolarHBondContact O-N 3.38Å; F21-V24 PolarHBondContact O-N 3.21Å; L22-V24 PolarHBondContact O-N 3.39Å; V24-V26 VanDerWaalsContact C-N 3.35Å; V24-V26 PolarHBondContact O-N 2.83Å; V24-C27 PolarHBondContact O-N 2.9Å; V24-H28 WeakPolarHBondContact O-CB 3.29Å; V24-H28 PolarHBondContact O-N 3.22Å
25	S	92.8	Very high	89	Confident	67 Å²	67	109.2 Å²	109.2	47%	0.469	55%	0.549	S	S	.	.	H	α-helix	trans	-61.7	-43.1	177.1	176.3	0	0	0	0	111.8	F21 L22 H28 C29	F21-S25 WeakPolarHBondContact O-CB 3.35Å; F21-S25 PolarHBondContact O-N 3.2Å; L22-S25 PolarHBondContact O-N 2.92Å; S25-H28 PolarHBondContact O-N 3.38Å; S25-C29 PolarHBondContact O-N 2.78Å
26	V	94.6	Very high	87.8	Confident	67 Å²	67	106.5 Å²	106.5	41%	0.406	54%	0.543	S	S	.	.	H	α-helix	trans	-63.4	-44.7	174.9	169.1	0	0	0	0	111	L22 L23 V24 H28 C29 Y30	L22-V26 WeakPolarHBondContact O-CB 3.29Å; L22-V26 VanDerWaalsContact O-CG2 3.23Å; L22-V26 WeakPolarHBondContact O-CG2 3.44Å; L22-V26 PolarHBondContact O-N 3.25Å; L23-V26 PolarHBondContact O-N 3.02Å; V24-V26 VanDerWaalsContact C-N 3.35Å; V24-V26 PolarHBondContact O-N 2.83Å; V26-H28 VanDerWaalsContact C-N 3.32Å; V26-H28 PolarHBondContact O-N 2.92Å; V26-C29 WeakPolarHBondContact O-CB 3.46Å; V26-C29 PolarHBondContact O-N 3.09Å; V26-Y30 HydrophobicContact CG1-CD2 3.66Å; V26-Y30 HydrophobicContact CG1-CE2 3.22Å; V26-Y30 WeakPolarHBondContact O-CD2 3.49Å; V26-Y30 PolarHBondContact O-N 3.17Å
27	C	91	Very high	86.9	Confident	84 Å²	84	107 Å²	107	57%	0.568	54%	0.541	S	S	*	.	H	α-helix	trans	-61	-39.4	175.2	-71.8	0	0	0	0	112.4	L23 V24 Y30 K31	L23-C27 WeakPolarHBondContact O-CB 3.33Å; L23-C27 PolarHBondContact O-N 3.32Å; L23-C27 PolarHBondContact O-SG 2.98Å; V24-C27 PolarHBondContact O-N 2.9Å; C27-Y30 PolarHBondContact O-N 3.25Å; C27-K31 PolarHBondContact O-N 3.43Å
28	H	90.2	Very high	85.7	Confident	110 Å²	110	100.3 Å²	100.3	51%	0.509	53%	0.528	S	S	.	.	H	α-helix	trans	-64.4	-43.7	176.8	-163.1	-82.2	0	0	0	111.5	V24 S25 V26 Y30 K31 E32	V24-H28 WeakPolarHBondContact O-CB 3.29Å; V24-H28 PolarHBondContact O-N 3.22Å; S25-H28 PolarHBondContact O-N 3.38Å; V26-H28 VanDerWaalsContact C-N 3.32Å; V26-H28 PolarHBondContact O-N 2.92Å; H28-Y30 PolarHBondContact O-N 3.01Å; H28-K31 PolarHBondContact O-N 3.12Å; H28-E32 IonicContact CE1-OE1 3.17Å; H28-E32 PolarHBondContact CE1-OE1 3.11Å; H28-E32 IonicContact ND1-OE1 3.46Å; H28-E32 PolarHBondContact ND1-OE1 3.45Å; H28-E32 PolarHBondContact O-N 2.68Å; H28-E32 VanDerWaalsContact O-N 3.12Å
29	C	84.5	Confident	84.8	Confident	76 Å²	76	101.8 Å²	101.8	51%	0.514	54%	0.535	S	S	.	.	H	α-helix	trans	-58.9	-45	176.1	-173.1	0	0	0	0	111.9	S25 V26 K31 E32 Q33	S25-C29 PolarHBondContact O-N 2.78Å; V26-C29 WeakPolarHBondContact O-CB 3.46Å; V26-C29 PolarHBondContact O-N 3.09Å; C29-K31 VanDerWaalsContact C-N 3.33Å; C29-K31 PolarHBondContact O-N 3.19Å; C29-E32 PolarHBondContact O-N 3.17Å; C29-Q33 PolarHBondContact O-N 3.02Å
30	Y	82.9	Confident	83.8	Confident	155 Å²	155	101.8 Å²	101.8	61%	0.608	54%	0.538	S	S	*	.	H	α-helix	trans	-64.7	-35.9	176.7	-74.1	-59.8	0	0	0	113	V26 C27 H28 Q33 F34	V26-Y30 HydrophobicContact CG1-CD2 3.66Å; V26-Y30 HydrophobicContact CG1-CE2 3.22Å; V26-Y30 WeakPolarHBondContact O-CD2 3.49Å; V26-Y30 PolarHBondContact O-N 3.17Å; C27-Y30 PolarHBondContact O-N 3.25Å; H28-Y30 PolarHBondContact O-N 3.01Å; Y30-Q33 PolarHBondContact O-N 3.48Å; Y30-F34 WeakPolarHBondContact O-CB 3.2Å; Y30-F34 PolarHBondContact O-N 3.28Å
31	K	86.2	Confident	83	Confident	130 Å²	130	100.6 Å²	100.6	57%	0.565	53%	0.531	S	S	*	.	H	α-helix	trans	-64.4	-46.3	178	-173.4	176.8	175	177.3	0	111.8	C27 H28 C29 Q33 F34 E35	C27-K31 PolarHBondContact O-N 3.43Å; H28-K31 PolarHBondContact O-N 3.12Å; C29-K31 VanDerWaalsContact C-N 3.33Å; C29-K31 PolarHBondContact O-N 3.19Å; K31-Q33 VanDerWaalsContact C-N 3.32Å; K31-Q33 PolarHBondContact O-N 2.95Å; K31-F34 PolarHBondContact O-N 2.97Å; K31-E35 WeakPolarHBondContact CE-OE1 3.46Å; K31-E35 IonicContact NZ-OE1 3.97Å; K31-E35 PolarHBondContact O-N 3.46Å
32	E	79.2	Confident	82.2	Confident	119 Å²	119	98.1 Å²	98.1	56%	0.556	52%	0.524	S	S	*	.	H	α-helix	trans	-60.4	-42.5	177	-73.1	-175.5	176.9	0	0	111.8	H28 C29 F34 E35 A36	H28-E32 IonicContact CE1-OE1 3.17Å; H28-E32 PolarHBondContact CE1-OE1 3.11Å; H28-E32 IonicContact ND1-OE1 3.46Å; H28-E32 PolarHBondContact ND1-OE1 3.45Å; H28-E32 PolarHBondContact O-N 2.68Å; H28-E32 VanDerWaalsContact O-N 3.12Å; C29-E32 PolarHBondContact O-N 3.17Å; E32-F34 VanDerWaalsContact C-N 3.34Å; E32-F34 PolarHBondContact O-N 3.02Å; E32-E35 PolarHBondContact O-N 3Å; E32-A36 WeakPolarHBondContact O-CB 3.33Å; E32-A36 PolarHBondContact O-N 3.45Å
33	Q	74.9	Confident	81.4	Confident	132 Å²	132	94.8 Å²	94.8	62%	0.617	51%	0.51	S	S	*	.	H	α-helix	trans	-65.4	-37.3	178.3	-164.9	172.5	21.6	0	0	112.3	C29 Y30 K31 F37	C29-Q33 PolarHBondContact O-N 3.02Å; Y30-Q33 PolarHBondContact O-N 3.48Å; K31-Q33 VanDerWaalsContact C-N 3.32Å; K31-Q33 PolarHBondContact O-N 2.95Å; Q33-F37 WeakPolarHBondContact O-CB 3.33Å; Q33-F37 PolarHBondContact O-N 3.25Å
34	F	75.4	Confident	80.7	Confident	154 Å²	154	96.4 Å²	96.4	68%	0.675	51%	0.509	S	S	*	.	H	α-helix	trans	-70.3	-41.4	177.9	-172.4	-99.1	0	0	0	112.5	Y30 K31 E32 F37 G38	Y30-F34 WeakPolarHBondContact O-CB 3.2Å; Y30-F34 PolarHBondContact O-N 3.28Å; K31-F34 PolarHBondContact O-N 2.97Å; E32-F34 VanDerWaalsContact C-N 3.34Å; E32-F34 PolarHBondContact O-N 3.02Å; F34-F37 PolarHBondContact O-N 3Å; F34-G38 PolarHBondContact O-N 3.43Å
35	E	73.9	Confident	80.4	Confident	114 Å²	114	95.9 Å²	95.9	53%	0.533	50%	0.503	S	S	.	.	H	α-helix	trans	-64.9	-39.7	175.2	-74.3	-176.4	-172.2	0	0	111.7	K31 E32 G38 T39	K31-E35 WeakPolarHBondContact CE-OE1 3.46Å; K31-E35 IonicContact NZ-OE1 3.97Å; K31-E35 PolarHBondContact O-N 3.46Å; E32-E35 PolarHBondContact O-N 3Å; E35-G38 PolarHBondContact O-N 3.45Å; E35-T39 WeakPolarHBondContact O-CG2 3.43Å; E35-T39 PolarHBondContact O-N 3.17Å; E35-T39 PolarHBondContact O-OG1 3.44Å; E35-T39 VanDerWaalsContact O-OG1 3.11Å
36	A	69.4	Low	80.3	Confident	59 Å²	59	98.7 Å²	98.7	49%	0.488	50%	0.503	S	S	.	.	H	α-helix	trans	-64.3	-39.1	173.2	0	0	0	0	0	112.4	E32 T39 S40	E32-A36 WeakPolarHBondContact O-CB 3.33Å; E32-A36 PolarHBondContact O-N 3.45Å; A36-T39 PolarHBondContact O-OG1 3.12Å; A36-S40 WeakPolarHBondContact O-CB 3.08Å; A36-S40 PolarHBondContact O-N 3.43Å; A36-S40 VanDerWaalsContact O-N 3.12Å
37	F	72.3	Confident	80.2	Confident	119 Å²	119	98.5 Å²	98.5	52%	0.522	51%	0.505	S	S	.	.	H	α-helix	trans	-66.4	-45.2	176.7	-175.3	-99.7	0	0	0	112.2	Q33 F34 T39 S40 E41	Q33-F37 WeakPolarHBondContact O-CB 3.33Å; Q33-F37 PolarHBondContact O-N 3.25Å; F34-F37 PolarHBondContact O-N 3Å; F37-T39 PolarHBondContact O-N 3.06Å; F37-S40 WeakPolarHBondContact O-CB 3.39Å; F37-S40 PolarHBondContact O-N 3.19Å; F37-E41 HydrophobicContact CD1-CG 4.34Å; F37-E41 HydrophobicContact CE1-CG 3.78Å; F37-E41 HydrophobicContact CE2-CG 4.15Å; F37-E41 HydrophobicContact CZ-CG 3.68Å; F37-E41 PolarHBondContact O-N 3.03Å
38	G	70.3	Confident	80.3	Confident	41 Å²	41	98.9 Å²	98.9	42%	0.423	50%	0.498	S	S	.	.	H	α-helix	trans	-63.1	-40.5	-179.6	0	0	0	0	0	113.4	F34 E35 S40 L42	F34-G38 PolarHBondContact O-N 3.43Å; E35-G38 PolarHBondContact O-N 3.45Å; G38-S40 VanDerWaalsContact C-N 3.35Å; G38-L42 WeakPolarHBondContact O-CB 3.41Å; G38-L42 PolarHBondContact O-N 3.41Å
39	T	73.6	Confident	80.5	Confident	90 Å²	90	98.4 Å²	98.4	55%	0.552	50%	0.498	S	S	*	.	H	α-helix	trans	-68.8	-34.3	175.1	54.3	0	0	0	0	112.3	E35 A36 F37 S43	E35-T39 WeakPolarHBondContact O-CG2 3.43Å; E35-T39 PolarHBondContact O-N 3.17Å; E35-T39 PolarHBondContact O-OG1 3.44Å; E35-T39 VanDerWaalsContact O-OG1 3.11Å; A36-T39 PolarHBondContact O-OG1 3.12Å; F37-T39 PolarHBondContact O-N 3.06Å; T39-S43 WeakPolarHBondContact O-CB 3.39Å; T39-S43 PolarHBondContact O-N 2.87Å; T39-S43 PolarHBondContact O-OG 3.43Å
40	S	75.2	Confident	80.9	Confident	66 Å²	66	99.6 Å²	99.6	46%	0.462	50%	0.499	S	S	.	.	H	α-helix	trans	-64.4	-50.2	175.8	-178	0	0	0	0	112.1	A36 F37 G38 S43 R44	A36-S40 WeakPolarHBondContact O-CB 3.08Å; A36-S40 PolarHBondContact O-N 3.43Å; A36-S40 VanDerWaalsContact O-N 3.12Å; F37-S40 WeakPolarHBondContact O-CB 3.39Å; F37-S40 PolarHBondContact O-N 3.19Å; G38-S40 VanDerWaalsContact C-N 3.35Å; S40-S43 CarbonylContact O-C 3.6Å; S40-S43 PolarHBondContact O-N 3.17Å; S40-R44 WeakPolarHBondContact O-CB 3.49Å; S40-R44 PolarHBondContact O-N 2.89Å
41	E	78.6	Confident	81.5	Confident	63 Å²	63	97.1 Å²	97.1	29%	0.294	50%	0.496	S	S	.	.	H	α-helix	trans	-66.3	-41.2	-179.8	-72.5	-60.8	133.2	0	0	112.3	F37 S43 R44 N45	F37-E41 HydrophobicContact CD1-CG 4.34Å; F37-E41 HydrophobicContact CE1-CG 3.78Å; F37-E41 HydrophobicContact CE2-CG 4.15Å; F37-E41 HydrophobicContact CZ-CG 3.68Å; F37-E41 PolarHBondContact O-N 3.03Å; E41-S43 VanDerWaalsContact C-N 3.31Å; E41-S43 PolarHBondContact O-N 3.45Å; E41-R44 WeakPolarHBondContact O-CB 3.4Å; E41-R44 PolarHBondContact O-N 3.17Å; E41-R44 IonicContact OE1-NH1 3.61Å; E41-N45 PolarHBondContact O-N 3.46Å
42	L	77.1	Confident	81.9	Confident	105 Å²	105	96.6 Å²	96.6	55%	0.55	50%	0.499	S	S	.	.	H	α-helix	trans	-61.7	-42.5	173.6	-179.6	63.6	0	0	0	111.3	G38 R44 N45 R46	G38-L42 WeakPolarHBondContact O-CB 3.41Å; G38-L42 PolarHBondContact O-N 3.41Å; L42-R44 VanDerWaalsContact C-N 3.33Å; L42-N45 PolarHBondContact O-N 3.3Å; L42-R46 WeakPolarHBondContact O-CG 3.1Å; L42-R46 PolarHBondContact O-N 2.99Å
43	S	78.2	Confident	82.7	Confident	42 Å²	42	95.8 Å²	95.8	29%	0.294	50%	0.498	S	S	.	.	H	α-helix	trans	-66.5	-37.2	177.4	-60.1	0	0	0	0	111.8	T39 S40 E41 R46 S47	T39-S43 WeakPolarHBondContact O-CB 3.39Å; T39-S43 PolarHBondContact O-N 2.87Å; T39-S43 PolarHBondContact O-OG 3.43Å; S40-S43 CarbonylContact O-C 3.6Å; S40-S43 PolarHBondContact O-N 3.17Å; E41-S43 VanDerWaalsContact C-N 3.31Å; E41-S43 PolarHBondContact O-N 3.45Å; S43-R46 PolarHBondContact O-N 2.92Å; S43-R46 PolarHBondContact OG-NH2 3.38Å; S43-S47 PolarHBondContact O-N 2.96Å; S43-S47 PolarHBondContact O-OG 3.26Å; S43-S47 VanDerWaalsContact O-OG 3.09Å
44	R	79.5	Confident	83.6	Confident	140 Å²	140	94.6 Å²	94.6	53%	0.528	50%	0.495	S	S	.	.	H	α-helix	trans	-62.7	-44.5	174.3	-169.7	179.7	-175.8	-177.7	0.7	111.4	S40 E41 L42 R46 S47 Q48	S40-R44 WeakPolarHBondContact O-CB 3.49Å; S40-R44 PolarHBondContact O-N 2.89Å; E41-R44 WeakPolarHBondContact O-CB 3.4Å; E41-R44 PolarHBondContact O-N 3.17Å; E41-R44 IonicContact OE1-NH1 3.61Å; L42-R44 VanDerWaalsContact C-N 3.33Å; R44-R46 PolarHBondContact O-N 3.45Å; R44-S47 PolarHBondContact O-N 3.49Å; R44-Q48 WeakPolarHBondContact O-CB 3.37Å; R44-Q48 VanDerWaalsContact O-CG 3.29Å; R44-Q48 WeakPolarHBondContact O-CG 3.37Å; R44-Q48 PolarHBondContact O-N 2.95Å
45	N	88.3	Confident	84.6	Confident	81 Å²	81	90.7 Å²	90.7	43%	0.433	48%	0.481	S	S	.	.	H	α-helix	trans	-60.6	-43.2	175.3	-76.1	-10.6	0	0	0	111.7	E41 L42 Q48 I49	E41-N45 PolarHBondContact O-N 3.46Å; L42-N45 PolarHBondContact O-N 3.3Å; N45-Q48 PolarHBondContact O-N 3.27Å; N45-Q48 PolarHBondContact OD1-OE1 3.26Å; N45-I49 WeakPolarHBondContact O-CD1 3.23Å; N45-I49 VanDerWaalsContact O-CG1 3.29Å; N45-I49 WeakPolarHBondContact O-CG1 3.43Å; N45-I49 PolarHBondContact O-N 3.48Å
46	R	91.4	Very high	85.5	Confident	126 Å²	126	94.4 Å²	94.4	48%	0.475	50%	0.495	S	S	.	.	H	α-helix	trans	-61.6	-48	174.4	-68.1	-165.2	-51.8	-85.6	-5.2	111.6	L42 S43 R44 Q48 I49 L50	L42-R46 WeakPolarHBondContact O-CG 3.1Å; L42-R46 PolarHBondContact O-N 2.99Å; S43-R46 PolarHBondContact O-N 2.92Å; S43-R46 PolarHBondContact OG-NH2 3.38Å; R44-R46 PolarHBondContact O-N 3.45Å; R46-Q48 VanDerWaalsContact C-N 3.3Å; R46-Q48 PolarHBondContact O-N 3.35Å; R46-I49 PolarHBondContact O-N 3.47Å; R46-L50 WeakPolarHBondContact O-CG 3.26Å; R46-L50 PolarHBondContact O-N 3.4Å
47	S	91.8	Very high	86.6	Confident	62 Å²	62	97.6 Å²	97.6	43%	0.434	51%	0.509	S	S	.	.	H	α-helix	trans	-60.5	-40	178.5	-64.1	0	0	0	0	112	S43 R44 L50 N51	S43-S47 PolarHBondContact O-N 2.96Å; S43-S47 PolarHBondContact O-OG 3.26Å; S43-S47 VanDerWaalsContact O-OG 3.09Å; R44-S47 PolarHBondContact O-N 3.49Å; S47-L50 PolarHBondContact O-N 3.35Å; S47-N51 WeakPolarHBondContact O-CB 3.46Å; S47-N51 PolarHBondContact O-N 3.05Å; S47-N51 PolarHBondContact O-ND2 2.99Å
48	Q	93.8	Very high	87.5	Confident	93 Å²	93	101.1 Å²	101.1	44%	0.435	52%	0.52	S	S	.	.	H	α-helix	trans	-62	-45.5	175.4	-76.5	173.2	-37.8	0	0	111.8	R44 N45 R46 L50 N51 L52	R44-Q48 WeakPolarHBondContact O-CB 3.37Å; R44-Q48 VanDerWaalsContact O-CG 3.29Å; R44-Q48 WeakPolarHBondContact O-CG 3.37Å; R44-Q48 PolarHBondContact O-N 2.95Å; N45-Q48 PolarHBondContact O-N 3.27Å; N45-Q48 PolarHBondContact OD1-OE1 3.26Å; R46-Q48 VanDerWaalsContact C-N 3.3Å; R46-Q48 PolarHBondContact O-N 3.35Å; Q48-L50 PolarHBondContact O-N 3.46Å; Q48-N51 PolarHBondContact O-N 3.34Å; Q48-L52 WeakPolarHBondContact O-CG 3.35Å; Q48-L52 PolarHBondContact O-N 3.04Å
49	I	93.1	Very high	88.7	Confident	99 Å²	99	105.7 Å²	105.7	51%	0.508	53%	0.526	S	S	.	.	H	α-helix	trans	-60.8	-47.2	176.6	-67.6	163.3	0	0	0	110.6	N45 R46 N51 L52 L53	N45-I49 WeakPolarHBondContact O-CD1 3.23Å; N45-I49 VanDerWaalsContact O-CG1 3.29Å; N45-I49 WeakPolarHBondContact O-CG1 3.43Å; N45-I49 PolarHBondContact O-N 3.48Å; R46-I49 PolarHBondContact O-N 3.47Å; I49-N51 VanDerWaalsContact C-N 3.32Å; I49-N51 PolarHBondContact O-N 3.03Å; I49-L52 WeakPolarHBondContact O-CB 3.47Å; I49-L52 PolarHBondContact O-N 3.46Å; I49-L52 VanDerWaalsContact O-N 3.16Å; I49-L53 HydrophobicContact CG2-CD1 4.05Å; I49-L53 HydrophobicContact CG2-CG 4.45Å; I49-L53 WeakPolarHBondContact O-CG 3.24Å; I49-L53 PolarHBondContact O-N 3.45Å
50	L	94.7	Very high	89.8	Confident	102 Å²	102	104 Å²	104	53%	0.534	51%	0.513	S	S	.	.	H	α-helix	trans	-60.8	-43.2	178.4	-66.8	176.2	0	0	0	111.5	R46 S47 Q48 L52 L53 I54	R46-L50 WeakPolarHBondContact O-CG 3.26Å; R46-L50 PolarHBondContact O-N 3.4Å; S47-L50 PolarHBondContact O-N 3.35Å; Q48-L50 PolarHBondContact O-N 3.46Å; L50-L52 VanDerWaalsContact C-N 3.29Å; L50-L52 PolarHBondContact O-N 3.06Å; L50-L53 PolarHBondContact O-N 2.92Å; L50-I54 VanDerWaalsContact O-CG1 3.31Å; L50-I54 WeakPolarHBondContact O-CG1 3.37Å; L50-I54 PolarHBondContact O-N 3.07Å; L50-I54 VanDerWaalsContact O-N 3.07Å
51	N	95.2	Very high	90.7	Very high	102 Å²	102	109.4 Å²	109.4	55%	0.545	53%	0.528	S	S	.	.	H	α-helix	trans	-60.5	-37.1	176.4	-74.2	-23.9	0	0	0	112.5	S47 Q48 I49 N55	S47-N51 WeakPolarHBondContact O-CB 3.46Å; S47-N51 PolarHBondContact O-N 3.05Å; S47-N51 PolarHBondContact O-ND2 2.99Å; Q48-N51 PolarHBondContact O-N 3.34Å; I49-N51 VanDerWaalsContact C-N 3.32Å; I49-N51 PolarHBondContact O-N 3.03Å; N51-N55 WeakPolarHBondContact O-CB 3.5Å; N51-N55 PolarHBondContact O-N 2.91Å
52	L	94.4	Very high	91.5	Very high	120 Å²	120	116 Å²	116	63%	0.628	55%	0.551	S	S	*	*	H	α-helix	trans	-67.5	-45.4	175.2	-70.2	170.8	0	0	0	111.6	Q48 I49 L50 I54 N55	Q48-L52 WeakPolarHBondContact O-CG 3.35Å; Q48-L52 PolarHBondContact O-N 3.04Å; I49-L52 WeakPolarHBondContact O-CB 3.47Å; I49-L52 PolarHBondContact O-N 3.46Å; I49-L52 VanDerWaalsContact O-N 3.16Å; L50-L52 VanDerWaalsContact C-N 3.29Å; L50-L52 PolarHBondContact O-N 3.06Å; L52-I54 VanDerWaalsContact C-N 3.32Å; L52-I54 PolarHBondContact O-N 3.45Å; L52-N55 WeakPolarHBondContact O-CB 3.5Å; L52-N55 PolarHBondContact O-N 2.97Å
53	L	95	Very high	92.3	Very high	102 Å²	102	115.2 Å²	115.2	53%	0.534	55%	0.546	S	S	.	.	H	α-helix	trans	-65.3	-33.2	-177.7	-68.8	174.5	0	0	0	113.2	I49 L50 Y59	I49-L53 HydrophobicContact CG2-CD1 4.05Å; I49-L53 HydrophobicContact CG2-CG 4.45Å; I49-L53 WeakPolarHBondContact O-CG 3.24Å; I49-L53 PolarHBondContact O-N 3.45Å; L50-L53 PolarHBondContact O-N 2.92Å; L53-Y59 WeakPolarHBondContact O-CB 3.41Å
54	I	94.9	Very high	93.1	Very high	106 Å²	106	118.1 Å²	118.1	54%	0.544	55%	0.551	S	S	.	*	T	Hydrogen-bonded Turn	trans	-99	6	-179.1	74.1	-175.4	0	0	0	113.5	L50 L52 K56	L50-I54 VanDerWaalsContact O-CG1 3.31Å; L50-I54 WeakPolarHBondContact O-CG1 3.37Å; L50-I54 PolarHBondContact O-N 3.07Å; L50-I54 VanDerWaalsContact O-N 3.07Å; L52-I54 VanDerWaalsContact C-N 3.32Å; L52-I54 PolarHBondContact O-N 3.45Å; I54-K56 PolarHBondContact O-N 3.22Å
55	N	96	Very high	93.9	Very high	73 Å²	73	115.7 Å²	115.7	39%	0.39	55%	0.553	S	S	.	*			trans	-61.9	121.4	-179.2	-172.9	-13.7	0	0	0	110.1	N51 L52 T57 Y58 Y59	N51-N55 WeakPolarHBondContact O-CB 3.5Å; N51-N55 PolarHBondContact O-N 2.91Å; L52-N55 WeakPolarHBondContact O-CB 3.5Å; L52-N55 PolarHBondContact O-N 2.97Å; N55-T57 VanDerWaalsContact CG-OG1 3.31Å; N55-T57 PolarHBondContact ND2-OG1 3.46Å; N55-T57 PolarHBondContact O-N 3.46Å; N55-T57 VanDerWaalsContact O-N 3.12Å; N55-T57 PolarHBondContact OD1-N 3Å; N55-T57 PolarHBondContact OD1-OG1 3.4Å; N55-T57 VanDerWaalsContact OD1-OG1 3.07Å; N55-Y58 PolarHBondContact O-N 3.08Å; N55-Y59 PolarHBondContact O-N 2.96Å
56	K	92.8	Very high	94.2	Very high	191 Å²	191	117.1 Å²	117.1	83%	0.83	56%	0.561	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63.6	-18.3	-175.6	-65.6	-177.4	-179.6	175.5	0	114.3	I54 Y58	I54-K56 PolarHBondContact O-N 3.22Å; K56-Y58 VanDerWaalsContact C-N 3.25Å
57	T	93.3	Very high	94.4	Very high	127 Å²	127	119.2 Å²	119.2	78%	0.779	57%	0.57	S	S	*	*	T	Hydrogen-bonded Turn	trans	-73.1	-21.4	173.6	60.6	0	0	0	0	112.4	N55	N55-T57 VanDerWaalsContact CG-OG1 3.31Å; N55-T57 PolarHBondContact ND2-OG1 3.46Å; N55-T57 PolarHBondContact O-N 3.46Å; N55-T57 VanDerWaalsContact O-N 3.12Å; N55-T57 PolarHBondContact OD1-N 3Å; N55-T57 PolarHBondContact OD1-OG1 3.4Å; N55-T57 VanDerWaalsContact OD1-OG1 3.07Å
58	Y	90.3	Very high	94.6	Very high	193 Å²	193	120.1 Å²	120.1	76%	0.757	59%	0.589	S	S	*	*	T	Hydrogen-bonded Turn	trans	-113.5	-43.1	-177.5	177.3	-102.7	0	0	0	112.5	N55 K56	N55-Y58 PolarHBondContact O-N 3.08Å; K56-Y58 VanDerWaalsContact C-N 3.25Å
59	Y	94.9	Very high	94.7	Very high	137 Å²	137	117.6 Å²	117.6	54%	0.537	59%	0.588	S	S	.	*			trans	-100.6	110.8	-177.6	-177.3	-102.1	0	0	0	111.9	L53 N55 K61	L53-Y59 WeakPolarHBondContact O-CB 3.41Å; N55-Y59 PolarHBondContact O-N 2.96Å; Y59-K61 HydrophobicContact CE1-CB 3.93Å
60	D	96.5	Very high	94.9	Very high	54 Å²	54	117.7 Å²	117.7	29%	0.289	60%	0.595	S	S	.	*			trans	-104.8	108.5	170.4	-170.8	-13.1	0	0	0	111.1	R62 L63	D60-R62 PolarHBondContact O-N 3.45Å; D60-R62 VanDerWaalsContact O-N 3.11Å; D60-R62 WeakPolarHBondContact OD1-CB 3.39Å; D60-R62 WeakPolarHBondContact OD1-CG 3.37Å; D60-R62 IonicContact OD1-CZ 3.89Å; D60-R62 PolarHBondContact OD1-N 2.87Å; D60-R62 IonicContact OD1-NE 3.02Å; D60-R62 PolarHBondContact OD1-NE 2.96Å; D60-R62 IonicContact OD1-NH2 3.87Å; D60-R62 IonicContact OD2-CZ 3.41Å; D60-R62 IonicContact OD2-NE 3.23Å; D60-R62 PolarHBondContact OD2-NE 3.39Å; D60-R62 IonicContact OD2-NH2 2.73Å; D60-R62 PolarHBondContact OD2-NH2 3.07Å; D60-L63 HydrophobicContact CB-CD1 4.26Å; D60-L63 HydrophobicContact CB-CG 4.32Å; D60-L63 PolarHBondContact O-N 3.29Å
61	K	94.8	Very high	95	Very high	179 Å²	179	118.1 Å²	118.1	78%	0.778	60%	0.602	S	S	*	*	T	Hydrogen-bonded Turn	trans	-66	-10.1	-179.3	70.8	179.3	-178.1	173.8	0	115.1	Y59 L63	Y59-K61 HydrophobicContact CE1-CB 3.93Å; K61-L63 VanDerWaalsContact C-N 3.32Å
62	R	94.8	Very high	95	Very high	203 Å²	203	115.8 Å²	115.8	77%	0.766	59%	0.592	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.5	-15.3	178.1	-58.7	173.1	-64.6	174.1	6.2	112	D60	D60-R62 PolarHBondContact O-N 3.45Å; D60-R62 VanDerWaalsContact O-N 3.11Å; D60-R62 WeakPolarHBondContact OD1-CB 3.39Å; D60-R62 WeakPolarHBondContact OD1-CG 3.37Å; D60-R62 IonicContact OD1-CZ 3.89Å; D60-R62 PolarHBondContact OD1-N 2.87Å; D60-R62 IonicContact OD1-NE 3.02Å; D60-R62 PolarHBondContact OD1-NE 2.96Å; D60-R62 IonicContact OD1-NH2 3.87Å; D60-R62 IonicContact OD2-CZ 3.41Å; D60-R62 IonicContact OD2-NE 3.23Å; D60-R62 PolarHBondContact OD2-NE 3.39Å; D60-R62 IonicContact OD2-NH2 2.73Å; D60-R62 PolarHBondContact OD2-NH2 3.07Å
63	L	95.2	Very high	95.2	Very high	87 Å²	87	117.5 Å²	117.5	46%	0.455	60%	0.601	S	S	.	*	S	Bend	trans	-97.2	130.3	-179.5	-59.3	-179.2	0	0	0	110.2	D60 K61 Y67	D60-L63 HydrophobicContact CB-CD1 4.26Å; D60-L63 HydrophobicContact CB-CG 4.32Å; D60-L63 PolarHBondContact O-N 3.29Å; K61-L63 VanDerWaalsContact C-N 3.32Å; L63-Y67 HydrophobicContact CB-CG 4.45Å; L63-Y67 HydrophobicContact CD2-CD1 4.03Å; L63-Y67 HydrophobicContact CD2-CD2 3.95Å; L63-Y67 HydrophobicContact CD2-CE1 4.15Å; L63-Y67 HydrophobicContact CD2-CE2 4.08Å; L63-Y67 HydrophobicContact CD2-CG 3.92Å
64	R	95.1	Very high	95.2	Very high	103 Å²	103	118 Å²	118	39%	0.389	61%	0.608	S	S	.	*	P	Polyproline II helix	trans	-64	146.7	168.1	-179.7	179.9	55.1	83.7	-16.5	109.4	N66 Y67 P70 V72	R64-N66 PolarHBondContact O-N 3.26Å; R64-Y67 WeakPolarHBondContact O-CB 3.41Å; R64-Y67 PolarHBondContact O-N 3.16Å; R64-Y67 VanDerWaalsContact O-N 3.12Å; R64-P70 PolarHBondContact NH1-O 3.38Å; R64-V72 HydrophobicContact CG-CG2 3.8Å
65	P	95.7	Very high	95.4	Very high	89 Å²	89	116.7 Å²	116.7	58%	0.578	62%	0.621	S	S	*	*	T	Hydrogen-bonded Turn	trans	-51.7	140.8	167.3	-25.3	33.7	0	0	0	111.7	Y67 V72	P65-Y67 VanDerWaalsContact C-N 3.31Å; P65-Y67 PolarHBondContact O-N 3.42Å; P65-V72 HydrophobicContact CB-CG2 3.85Å; P65-V72 HydrophobicContact CG-CG2 4.38Å; P65-V72 WeakPolarHBondContact O-CG2 3.42Å
66	N	94.5	Very high	95.4	Very high	112 Å²	112	119.8 Å²	119.8	60%	0.599	64%	0.636	S	S	*	*	T	Hydrogen-bonded Turn	trans	55.2	42.4	-172.5	-55.5	-30.3	0	0	0	113.1	R64 G68 G69	R64-N66 PolarHBondContact O-N 3.26Å; N66-G68 PolarHBondContact O-N 3.49Å; N66-G69 WeakPolarHBondContact O-CA 3.42Å; N66-G69 PolarHBondContact O-N 2.91Å
67	Y	95.2	Very high	95.6	Very high	170 Å²	170	117.3 Å²	117.3	67%	0.667	64%	0.637	S	S	*	*	T	Hydrogen-bonded Turn	trans	-56.6	129.8	176.1	-169.6	-98.6	0	0	0	111.1	L63 R64 P65 G69	L63-Y67 HydrophobicContact CB-CG 4.45Å; L63-Y67 HydrophobicContact CD2-CD1 4.03Å; L63-Y67 HydrophobicContact CD2-CD2 3.95Å; L63-Y67 HydrophobicContact CD2-CE1 4.15Å; L63-Y67 HydrophobicContact CD2-CE2 4.08Å; L63-Y67 HydrophobicContact CD2-CG 3.92Å; R64-Y67 WeakPolarHBondContact O-CB 3.41Å; R64-Y67 PolarHBondContact O-N 3.16Å; R64-Y67 VanDerWaalsContact O-N 3.12Å; P65-Y67 VanDerWaalsContact C-N 3.31Å; P65-Y67 PolarHBondContact O-N 3.42Å; Y67-G69 PolarHBondContact O-N 3.05Å
68	G	95.9	Very high	95.8	Very high	81 Å²	81	119 Å²	119	84%	0.835	64%	0.638	S	S	*	*	T	Hydrogen-bonded Turn	trans	78.5	-6.4	-173.1	0	0	0	0	0	115.2	N66	N66-G68 PolarHBondContact O-N 3.49Å
69	G	97	Very high	96.1	Very high	40 Å²	40	117.5 Å²	117.5	41%	0.412	64%	0.638	S	S	.	*	S	Bend	trans	-106.8	-157.3	174.9	0	0	0	0	0	113	N66 Y67	N66-G69 WeakPolarHBondContact O-CA 3.42Å; N66-G69 PolarHBondContact O-N 2.91Å; Y67-G69 PolarHBondContact O-N 3.05Å
70	P	96.9	Very high	96.2	Very high	101 Å²	101	115.8 Å²	115.8	66%	0.656	64%	0.641	S	S	*	*	S	Bend	trans	-55.3	162.2	177.2	-25.5	34.9	0	0	0	113.8	R64	R64-P70 PolarHBondContact NH1-O 3.38Å
71	T	96.4	Very high	96.2	Very high	110 Å²	110	118.1 Å²	118.1	68%	0.675	66%	0.662	S	S	*	*	P	Polyproline II helix	trans	-63.6	155.9	173.5	47.5	0	0	0	0	111.5
72	V	96.4	Very high	96.3	Very high	54 Å²	54	114 Å²	114	33%	0.327	66%	0.655	S	S	.	*	P	Polyproline II helix	trans	-94.3	125.7	173.8	173.9	0	0	0	0	108.5	R64 P65 V74	R64-V72 HydrophobicContact CG-CG2 3.8Å; P65-V72 HydrophobicContact CB-CG2 3.85Å; P65-V72 HydrophobicContact CG-CG2 4.38Å; P65-V72 WeakPolarHBondContact O-CG2 3.42Å; V72-V74 HydrophobicContact CG1-CG2 4.25Å
73	D	97	Very high	96.3	Very high	155 Å²	155	111 Å²	111	83%	0.829	65%	0.653	S	S	*	*	P	Polyproline II helix	trans	-77.4	124.9	171.7	-62.7	-36.6	0	0	0	109.8
74	V	96.3	Very high	96.3	Very high	113 Å²	113	111.6 Å²	111.6	69%	0.685	66%	0.664	S	S	*	*			trans	-113.9	109	-179.8	-177.9	0	0	0	0	108.9	V72 I76	V72-V74 HydrophobicContact CG1-CG2 4.25Å; V74-I76 HydrophobicContact CG1-CG1 4.33Å
75	G	97.5	Very high	96.1	Very high	78 Å²	78	111.8 Å²	111.8	80%	0.804	69%	0.688	S	S	*	*			trans	-73.7	123.7	171.3	0	0	0	0	0	110.6
76	I	96.9	Very high	96	Very high	139 Å²	139	113.3 Å²	113.3	71%	0.713	70%	0.695	S	S	*	*			trans	-109.5	127.1	179.6	-58	172.7	0	0	0	109	V74 M78	V74-I76 HydrophobicContact CG1-CG1 4.33Å; I76-M78 HydrophobicContact CG2-CG 4.2Å
77	T	97.7	Very high	95.9	Very high	139 Å²	139	110 Å²	110	85%	0.853	68%	0.681	S	S	*	*			trans	-124.2	122.9	171.9	-55.5	0	0	0	0	108.4
78	M	96.9	Very high	95.6	Very high	162 Å²	162	110.6 Å²	110.6	80%	0.798	69%	0.69	S	S	*	*			trans	-106.8	131.9	177.2	-64.5	-171.8	-64.3	0	0	110.4	I76	I76-M78 HydrophobicContact CG2-CG 4.2Å
79	H	97.5	Very high	95.5	Very high	162 Å²	162	112.6 Å²	112.6	75%	0.75	69%	0.686	S	S	*	*			trans	-114.8	107.7	169.1	179.3	-83.2	0	0	0	108.9
80	V	95.3	Very high	95.2	Very high	101 Å²	101	118.4 Å²	118.4	61%	0.612	70%	0.702	S	S	*	*			trans	-91.8	109.2	179.2	-178.8	0	0	0	0	108.8	I83	V80-I83 HydrophobicContact CG1-CD1 4.49Å; V80-I83 HydrophobicContact CG1-CG1 3.8Å
81	S	97.6	Very high	94.7	Very high	103 Å²	103	121 Å²	121	72%	0.72	71%	0.707	S	S	*	*			trans	-74.4	-40.3	-179	-56.8	0	0	0	0	112.6
82	S	97.3	Very high	93.7	Very high	91 Å²	91	125.1 Å²	125.1	64%	0.636	73%	0.732	S	S	*	*			trans	-158.2	151.2	173.3	61.5	0	0	0	0	109.9
83	I	94.3	Very high	93.6	Very high	142 Å²	142	128.7 Å²	128.7	73%	0.728	75%	0.752	S	S	*	*			trans	-104.4	119	165.9	-58.8	175.1	0	0	0	106.1	V80 V86	V80-I83 HydrophobicContact CG1-CD1 4.49Å; V80-I83 HydrophobicContact CG1-CG1 3.8Å; I83-V86 HydrophobicContact CG2-CG2 4.41Å
84	S	94.6	Very high	93.4	Very high	98 Å²	98	127.3 Å²	127.3	69%	0.685	75%	0.748	S	S	*	*			trans	-75.8	-173.5	177.6	-60.4	0	0	0	0	110.9	V86	S84-V86 PolarHBondContact O-N 3.08Å
85	A	91.5	Very high	93.2	Very high	107 Å²	107	128.1 Å²	128.1	88%	0.884	75%	0.752	S	S	*	*	P	Polyproline II helix	trans	-58.4	136.5	176.8	0	0	0	0	0	111.8
86	V	92.7	Very high	93	Very high	121 Å²	121	131.1 Å²	131.1	73%	0.733	75%	0.749	S	S	*	*	P	Polyproline II helix	trans	-102.5	122.4	174.4	-179.2	0	0	0	0	107.7	I83 S84	I83-V86 HydrophobicContact CG2-CG2 4.41Å; S84-V86 PolarHBondContact O-N 3.08Å
87	S	93.1	Very high	92.7	Very high	43 Å²	43	130.6 Å²	130.6	30%	0.301	75%	0.751	S	S	.	*	P	Polyproline II helix	trans	-98.6	120.3	-178.6	179.5	0	0	0	0	111	V89 E90 M91	S87-V89 VanDerWaalsContact C-N 3.27Å; S87-V89 PolarHBondContact O-N 3.49Å; S87-V89 PolarHBondContact OG-N 3.3Å; S87-E90 PolarHBondContact OG-N 3.23Å; S87-M91 VanDerWaalsContact O-CG 3.26Å; S87-M91 WeakPolarHBondContact O-CG 3.46Å
88	E	89.5	Confident	92.4	Very high	182 Å²	182	130 Å²	130	85%	0.85	74%	0.744	S	S	*	*	S	Bend	trans	-66.9	-29.8	173	-65.1	173.2	-168.7	0	0	112.1
89	V	92.4	Very high	92.1	Very high	123 Å²	123	127.7 Å²	127.7	75%	0.745	74%	0.74	S	S	*	*	S	Bend	trans	-75.7	-28.3	-176.4	-177.8	0	0	0	0	112	S87 V92	S87-V89 VanDerWaalsContact C-N 3.27Å; S87-V89 PolarHBondContact O-N 3.49Å; S87-V89 PolarHBondContact OG-N 3.3Å; V89-V92 WeakPolarHBondContact O-CG2 3.4Å
90	E	91.4	Very high	91.7	Very high	163 Å²	163	125.1 Å²	125.1	76%	0.762	74%	0.74	S	S	*	*	S	Bend	trans	-88.1	-9.4	-178.1	-66.3	178.7	165.7	0	0	113.1	S87 V92	S87-E90 PolarHBondContact OG-N 3.23Å; E90-V92 VanDerWaalsContact C-N 3.3Å; E90-V92 PolarHBondContact O-N 3.44Å
91	M	86.5	Confident	91.4	Very high	155 Å²	155	127.1 Å²	127.1	76%	0.764	75%	0.75	S	S	*	*			trans	-89.6	57.9	178.8	-65.4	-69	-63.9	0	0	111.1	S87	S87-M91 VanDerWaalsContact O-CG 3.26Å; S87-M91 WeakPolarHBondContact O-CG 3.46Å
92	V	75.9	Confident	90.8	Very high	197 Å²	197	129.3 Å²	129.3	100%	1.194	75%	0.753	S	S	*	*			trans	-95.4	0	176.8	-174.8	0	0	0	0	111.5	V89 E90	V89-V92 WeakPolarHBondContact O-CG2 3.4Å; E90-V92 VanDerWaalsContact C-N 3.3Å; E90-V92 PolarHBondContact O-N 3.44Å

Retrieved 92 of 92 residues in 58.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).