A0A077ZMV1_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZMV1, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 78 aa.

						>A0A077ZMV1_TRITR|A0A077ZMV1
MQFPVAAKPEEVSASDWGHWCAVDREVHQCGQLTSTIAPSTEEAGLCLRVFTHMEGLFNHQRSMNADTSFAVQLLKAR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	45.3	Very low	51	Low	226 Å²	226	159.5 Å²	159.5	100%	1.113	86%	0.859	S	S	*	*				0	112.1	0	-65.3	-144.7	-86.2	0	0	107.5
2	Q	45.3	Very low	51.2	Low	204 Å²	204	154.8 Å²	154.8	95%	0.953	84%	0.839	S	S	*	*	P	Polyproline II helix	trans	-92.1	127	175.8	-93.1	172.1	18.4	0	0	108.3
3	F	53.7	Low	51	Low	186 Å²	186	148.8 Å²	148.8	82%	0.816	82%	0.816	S	S	*	*	P	Polyproline II helix	trans	-83.6	135.2	177	-69.4	-88.8	0	0	0	109.4	V5	F3-V5 PolarHBondContact O-N 2.58Å
4	P	57.3	Low	51.4	Low	124 Å²	124	144.2 Å²	144.2	81%	0.805	81%	0.808	S	S	*	*	P	Polyproline II helix	trans	-67.5	126.1	177.7	26.5	-30.9	0	0	0	109.8	A6	P4-A6 PolarHBondContact O-N 2.84Å; P4-A6 VanDerWaalsContact O-N 3.12Å
5	V	49.5	Very low	51.9	Low	144 Å²	144	141.2 Å²	141.2	87%	0.873	80%	0.8	S	S	*	*			trans	-58.4	112.7	171.9	170.5	0	0	0	0	107.8	F3 A7	F3-V5 PolarHBondContact O-N 2.58Å; V5-A7 PolarHBondContact O-N 3.27Å
6	A	52.5	Low	52.1	Low	91 Å²	91	137.8 Å²	137.8	75%	0.752	78%	0.779	S	S	*	*	P	Polyproline II helix	trans	-56.5	129.9	179.4	0	0	0	0	0	110	P4	P4-A6 PolarHBondContact O-N 2.84Å; P4-A6 VanDerWaalsContact O-N 3.12Å
7	A	50.9	Low	52.3	Low	97 Å²	97	139.5 Å²	139.5	80%	0.802	77%	0.77	S	S	*	*	P	Polyproline II helix	trans	-53.4	141.2	176.7	0	0	0	0	0	110.4	V5	V5-A7 PolarHBondContact O-N 3.27Å
8	K	46	Very low	52.5	Low	197 Å²	197	134.5 Å²	134.5	86%	0.857	76%	0.756	S	S	*	*	P	Polyproline II helix	trans	-48.7	138.8	-175.1	-71.1	178.8	173	-179.8	0	111.5	E10	K8-E10 PolarHBondContact O-N 2.78Å
9	P	52.5	Low	52.8	Low	114 Å²	114	133.9 Å²	133.9	74%	0.74	75%	0.746	S	S	*	*	P	Polyproline II helix	trans	-60.3	123.4	176.4	25.5	-31.9	0	0	0	108.8	E11	P9-E11 PolarHBondContact O-N 3.1Å; P9-E11 VanDerWaalsContact O-N 3.12Å
10	E	54.6	Low	52.8	Low	186 Å²	186	135.1 Å²	135.1	87%	0.869	74%	0.739	S	S	*	*	P	Polyproline II helix	trans	-51.7	116.4	169.5	-129.2	172.5	155.5	0	0	107.5	K8 V12	K8-E10 PolarHBondContact O-N 2.78Å; E10-V12 VanDerWaalsContact C-N 3.31Å; E10-V12 PolarHBondContact O-N 3.24Å
11	E	53.1	Low	52.9	Low	186 Å²	186	133.2 Å²	133.2	87%	0.869	73%	0.734	S	S	*	*			trans	-63.9	95.2	176.6	-70.7	179.8	172.1	0	0	107.7	P9 S13	P9-E11 PolarHBondContact O-N 3.1Å; P9-E11 VanDerWaalsContact O-N 3.12Å; E11-S13 PolarHBondContact O-N 3.35Å
12	V	53.5	Low	53.5	Low	103 Å²	103	125 Å²	125	62%	0.624	70%	0.703	S	S	*	*			trans	-59.1	103.3	170.3	177.6	0	0	0	0	106.5	E10 D16	E10-V12 VanDerWaalsContact C-N 3.31Å; E10-V12 PolarHBondContact O-N 3.24Å; V12-D16 HydrophobicContact CG1-CB 4.26Å
13	S	48.4	Very low	54.2	Low	77 Å²	77	117.7 Å²	117.7	54%	0.538	67%	0.672	S	S	.	*			trans	-60.8	140	-174.4	-99.4	0	0	0	0	110.3	E11 S15 D16	E11-S13 PolarHBondContact O-N 3.35Å; S13-S15 PolarHBondContact O-N 2.71Å; S13-D16 PolarHBondContact O-N 2.91Å
14	A	57.2	Low	54	Low	84 Å²	84	113.4 Å²	113.4	69%	0.694	66%	0.658	S	S	*	*	T	Hydrogen-bonded Turn	trans	-53.3	-19.2	179.6	0	0	0	0	0	114.1	D16 W17	A14-D16 PolarHBondContact O-N 3.36Å; A14-W17 PolarHBondContact O-N 2.89Å
15	S	58.1	Low	53.9	Low	99 Å²	99	116.6 Å²	116.6	69%	0.692	65%	0.653	S	S	*	*	H	α-helix	trans	-58.2	-31.2	173.2	-57.9	0	0	0	0	113.8	S13 W17 G18	S13-S15 PolarHBondContact O-N 2.71Å; S15-W17 VanDerWaalsContact C-N 3.32Å; S15-W17 PolarHBondContact O-N 3.15Å; S15-G18 PolarHBondContact O-N 3.43Å
16	D	55.2	Low	54.3	Low	87 Å²	87	116.1 Å²	116.1	47%	0.465	64%	0.642	S	S	.	*	H	α-helix	trans	-67.9	-32.2	-179	-77.8	-16.5	0	0	0	112.2	V12 S13 A14 G18 H19 W20	V12-D16 HydrophobicContact CG1-CB 4.26Å; S13-D16 PolarHBondContact O-N 2.91Å; A14-D16 PolarHBondContact O-N 3.36Å; D16-G18 VanDerWaalsContact C-N 3.32Å; D16-G18 PolarHBondContact O-N 3.48Å; D16-H19 WeakPolarHBondContact O-CB 2.93Å; D16-H19 PolarHBondContact O-N 2.78Å; D16-W20 PolarHBondContact O-N 3.15Å
17	W	56.4	Low	54.6	Low	166 Å²	166	115.2 Å²	115.2	63%	0.629	63%	0.627	S	S	*	*	H	α-helix	trans	-65	-36.2	177.6	-70.9	88.6	0	0	0	112.6	A14 S15 H19 W20 C21	A14-W17 PolarHBondContact O-N 2.89Å; S15-W17 VanDerWaalsContact C-N 3.32Å; S15-W17 PolarHBondContact O-N 3.15Å; W17-H19 PolarHBondContact O-N 2.86Å; W17-W20 PolarHBondContact O-N 3.38Å; W17-C21 PolarHBondContact O-N 3.42Å
18	G	55.4	Low	54.8	Low	50 Å²	50	116.8 Å²	116.8	52%	0.515	62%	0.617	S	S	.	*	H	α-helix	trans	-63.8	-31.4	176.4	0	0	0	0	0	112.8	S15 D16 A22	S15-G18 PolarHBondContact O-N 3.43Å; D16-G18 VanDerWaalsContact C-N 3.32Å; D16-G18 PolarHBondContact O-N 3.48Å; G18-A22 PolarHBondContact O-N 3.23Å
19	H	58.8	Low	55.4	Low	124 Å²	124	113.4 Å²	113.4	57%	0.574	60%	0.604	S	S	*	*	H	α-helix	trans	-67.2	-44	178.1	-173.8	54.4	0	0	0	111.8	D16 W17 C21 A22 V23	D16-H19 WeakPolarHBondContact O-CB 2.93Å; D16-H19 PolarHBondContact O-N 2.78Å; W17-H19 PolarHBondContact O-N 2.86Å; H19-C21 PolarHBondContact O-N 3.24Å; H19-A22 PolarHBondContact O-N 3.48Å; H19-V23 WeakPolarHBondContact O-CG2 3.35Å; H19-V23 PolarHBondContact O-N 2.93Å
20	W	51.8	Low	55.6	Low	156 Å²	156	111.5 Å²	111.5	59%	0.591	59%	0.593	S	S	*	*	H	α-helix	trans	-63.3	-38.9	178.9	-65.1	103.9	0	0	0	113	D16 W17 A22 V23 D24	D16-W20 PolarHBondContact O-N 3.15Å; W17-W20 PolarHBondContact O-N 3.38Å; W20-A22 VanDerWaalsContact C-N 3.33Å; W20-A22 PolarHBondContact O-N 3.45Å; W20-V23 PolarHBondContact O-N 3.28Å; W20-D24 PolarHBondContact O-N 3.22Å
21	C	56.3	Low	55.7	Low	96 Å²	96	104.7 Å²	104.7	65%	0.649	57%	0.573	S	S	*	*	H	α-helix	trans	-66.7	-32.8	175.7	-71.3	0	0	0	0	113	W17 H19 R25	W17-C21 PolarHBondContact O-N 3.42Å; H19-C21 PolarHBondContact O-N 3.24Å; C21-R25 PolarHBondContact O-N 3.39Å
22	A	57.9	Low	55.9	Low	55 Å²	55	103.5 Å²	103.5	46%	0.455	57%	0.567	S	S	.	*	H	α-helix	trans	-67.4	-41.9	176.6	0	0	0	0	0	111.4	G18 H19 W20 D24 R25 E26	G18-A22 PolarHBondContact O-N 3.23Å; H19-A22 PolarHBondContact O-N 3.48Å; W20-A22 VanDerWaalsContact C-N 3.33Å; W20-A22 PolarHBondContact O-N 3.45Å; A22-D24 PolarHBondContact O-N 3.46Å; A22-R25 PolarHBondContact O-N 3.38Å; A22-E26 PolarHBondContact O-N 3.3Å
23	V	58.1	Low	56	Low	50 Å²	50	105 Å²	105	30%	0.303	57%	0.571	S	S	.	*	H	α-helix	trans	-60.9	-43.6	177.8	175.9	0	0	0	0	111.3	H19 W20 R25 E26 V27	H19-V23 WeakPolarHBondContact O-CG2 3.35Å; H19-V23 PolarHBondContact O-N 2.93Å; W20-V23 PolarHBondContact O-N 3.28Å; V23-R25 VanDerWaalsContact C-N 3.25Å; V23-R25 PolarHBondContact O-N 3.17Å; V23-E26 PolarHBondContact O-N 2.96Å; V23-V27 HydrophobicContact CG1-CG2 4.48Å; V23-V27 WeakPolarHBondContact O-CG2 3.4Å; V23-V27 PolarHBondContact O-N 2.94Å
24	D	49.9	Very low	56.2	Low	96 Å²	96	102.4 Å²	102.4	51%	0.513	55%	0.552	S	S	.	*	H	α-helix	trans	-62	-34.5	179.7	-168.1	55.5	0	0	0	112.8	W20 A22 V27 H28	W20-D24 PolarHBondContact O-N 3.22Å; A22-D24 PolarHBondContact O-N 3.46Å; D24-V27 PolarHBondContact O-N 3.25Å; D24-H28 PolarHBondContact O-N 3.47Å; D24-H28 VanDerWaalsContact O-N 3.13Å; D24-H28 PolarHBondContact O-ND1 3.41Å; D24-H28 IonicContact OD1-CE1 3.81Å; D24-H28 IonicContact OD1-ND1 3.93Å; D24-H28 IonicContact OD2-CE1 3.92Å; D24-H28 IonicContact OD2-ND1 3.92Å
25	R	55.7	Low	56.2	Low	190 Å²	190	103.3 Å²	103.3	72%	0.717	55%	0.553	S	S	*	*	H	α-helix	trans	-70	-37.4	177.4	-153.2	-179.3	-163.2	-177.8	5	112.4	C21 A22 V23 Q29	C21-R25 PolarHBondContact O-N 3.39Å; A22-R25 PolarHBondContact O-N 3.38Å; V23-R25 VanDerWaalsContact C-N 3.25Å; V23-R25 PolarHBondContact O-N 3.17Å; R25-Q29 PolarHBondContact O-N 3.4Å
26	E	58.1	Low	56.1	Low	135 Å²	135	104.9 Å²	104.9	63%	0.631	56%	0.559	S	S	*	*	H	α-helix	trans	-66.6	-42.4	173.5	-79.5	-173.6	158.4	0	0	111.6	A22 V23 H28 Q29 C30	A22-E26 PolarHBondContact O-N 3.3Å; V23-E26 PolarHBondContact O-N 2.96Å; E26-H28 VanDerWaalsContact C-N 3.3Å; E26-H28 PolarHBondContact O-N 3.25Å; E26-Q29 PolarHBondContact O-N 3.39Å; E26-Q29 VanDerWaalsContact O-N 3.09Å; E26-C30 PolarHBondContact O-N 3.18Å; E26-C30 PolarHBondContact O-SG 3.35Å
27	V	57.7	Low	56.1	Low	72 Å²	72	103.5 Å²	103.5	44%	0.436	55%	0.551	S	S	.	*	H	α-helix	trans	-59.6	-41.9	177.7	174.7	0	0	0	0	111.3	V23 D24 Q29 C30 G31	V23-V27 HydrophobicContact CG1-CG2 4.48Å; V23-V27 WeakPolarHBondContact O-CG2 3.4Å; V23-V27 PolarHBondContact O-N 2.94Å; D24-V27 PolarHBondContact O-N 3.25Å; V27-Q29 PolarHBondContact O-N 2.94Å; V27-C30 PolarHBondContact O-N 3.3Å; V27-G31 PolarHBondContact O-N 3.24Å; V27-G31 VanDerWaalsContact O-N 3.08Å
28	H	57	Low	56	Low	130 Å²	130	98.2 Å²	98.2	60%	0.602	54%	0.543	S	S	*	.	H	α-helix	trans	-62.9	-39.9	175.2	-83.3	71.2	0	0	0	112.8	D24 E26 G31 Q32	D24-H28 PolarHBondContact O-N 3.47Å; D24-H28 VanDerWaalsContact O-N 3.13Å; D24-H28 PolarHBondContact O-ND1 3.41Å; D24-H28 IonicContact OD1-CE1 3.81Å; D24-H28 IonicContact OD1-ND1 3.93Å; D24-H28 IonicContact OD2-CE1 3.92Å; D24-H28 IonicContact OD2-ND1 3.92Å; E26-H28 VanDerWaalsContact C-N 3.3Å; E26-H28 PolarHBondContact O-N 3.25Å; H28-G31 PolarHBondContact O-N 3.13Å; H28-Q32 PolarHBondContact O-N 3.08Å
29	Q	57.8	Low	56	Low	125 Å²	125	100.7 Å²	100.7	58%	0.584	55%	0.549	S	S	*	.	H	α-helix	trans	-66.5	-39.2	175.8	-72.8	-175.7	23.1	0	0	111.9	R25 E26 V27 G31 Q32 L33	R25-Q29 PolarHBondContact O-N 3.4Å; E26-Q29 PolarHBondContact O-N 3.39Å; E26-Q29 VanDerWaalsContact O-N 3.09Å; V27-Q29 PolarHBondContact O-N 2.94Å; Q29-G31 VanDerWaalsContact C-N 3.28Å; Q29-G31 PolarHBondContact O-N 3.21Å; Q29-Q32 PolarHBondContact O-N 3.45Å; Q29-Q32 VanDerWaalsContact O-N 3.15Å; Q29-L33 PolarHBondContact O-N 3.04Å
30	C	56.7	Low	55.9	Low	74 Å²	74	99.9 Å²	99.9	50%	0.5	56%	0.558	S	S	.	*	H	α-helix	trans	-60.9	-36.7	174.5	-72.2	0	0	0	0	112.4	E26 V27 Q32 L33	E26-C30 PolarHBondContact O-N 3.18Å; E26-C30 PolarHBondContact O-SG 3.35Å; V27-C30 PolarHBondContact O-N 3.3Å; C30-Q32 VanDerWaalsContact C-N 3.29Å; C30-Q32 PolarHBondContact O-N 2.92Å; C30-L33 PolarHBondContact O-N 3.09Å
31	G	56.9	Low	56.2	Low	43 Å²	43	95 Å²	95	44%	0.443	55%	0.546	S	S	.	.	H	α-helix	trans	-59.1	-39.1	174.6	0	0	0	0	0	113	V27 H28 Q29 L33 T34	V27-G31 PolarHBondContact O-N 3.24Å; V27-G31 VanDerWaalsContact O-N 3.08Å; H28-G31 PolarHBondContact O-N 3.13Å; Q29-G31 VanDerWaalsContact C-N 3.28Å; Q29-G31 PolarHBondContact O-N 3.21Å; G31-L33 PolarHBondContact O-N 3.43Å; G31-T34 PolarHBondContact O-N 3.32Å; G31-T34 PolarHBondContact O-OG1 3.48Å
32	Q	55.9	Low	56.8	Low	161 Å²	161	96 Å²	96	75%	0.752	54%	0.54	S	S	*	.	H	α-helix	trans	-71.3	-28.9	-176.5	-136.9	175.3	11.1	0	0	113.3	H28 Q29 C30 T34	H28-Q32 PolarHBondContact O-N 3.08Å; Q29-Q32 PolarHBondContact O-N 3.45Å; Q29-Q32 VanDerWaalsContact O-N 3.15Å; C30-Q32 VanDerWaalsContact C-N 3.29Å; C30-Q32 PolarHBondContact O-N 2.92Å; Q32-T34 PolarHBondContact O-N 3.24Å
33	L	56.1	Low	57.4	Low	136 Å²	136	100.6 Å²	100.6	71%	0.712	55%	0.553	S	S	*	*	G	3₁₀ helix	trans	-67.6	-15.1	178.8	-72.9	168.3	0	0	0	113.7	Q29 C30 G31 S35	Q29-L33 PolarHBondContact O-N 3.04Å; C30-L33 PolarHBondContact O-N 3.09Å; G31-L33 PolarHBondContact O-N 3.43Å; L33-S35 PolarHBondContact O-N 2.78Å
34	T	53.9	Low	58.1	Low	21 Å²	21	101.1 Å²	101.1	13%	0.129	56%	0.562	C	S	.	*	G	3₁₀ helix	trans	-78.7	3	-177.3	59.6	0	0	0	0	115.3	G31 Q32 I37 L48 R49	G31-T34 PolarHBondContact O-N 3.32Å; G31-T34 PolarHBondContact O-OG1 3.48Å; Q32-T34 PolarHBondContact O-N 3.24Å; T34-I37 HydrophobicContact CG2-CD1 4.3Å; T34-L48 HydrophobicContact CG2-CD2 4.45Å; T34-R49 HydrophobicContact CG2-CG 4.33Å; T34-R49 PolarHBondContact O-NH2 3.46Å
35	S	55.9	Low	59.3	Low	104 Å²	104	96.7 Å²	96.7	73%	0.727	54%	0.54	S	S	*	.	G	3₁₀ helix	trans	-77.6	-15.8	-178.1	-177.6	0	0	0	0	114.8	L33	L33-S35 PolarHBondContact O-N 2.78Å
36	T	56.8	Low	60.3	Low	132 Å²	132	92.5 Å²	92.5	81%	0.81	53%	0.531	S	S	*	.	S	Bend	trans	-129.9	64.1	-172.9	-46	0	0	0	0	110.6
37	I	54.8	Low	61.4	Low	57 Å²	57	89.9 Å²	89.9	29%	0.292	53%	0.526	S	S	.	.			trans	-123.8	117.8	-176.5	-63.9	-171.8	0	0	0	106.9	T34 T41	T34-I37 HydrophobicContact CG2-CD1 4.3Å; I37-T41 HydrophobicContact CG2-CG2 4.39Å; I37-T41 WeakPolarHBondContact CG2-O 3.44Å; I37-T41 WeakPolarHBondContact CG2-OG1 3.05Å
38	A	55	Low	62.3	Low	56 Å²	56	90.7 Å²	90.7	46%	0.463	53%	0.528	S	S	.	.			trans	-58.5	164.8	-176.7	0	0	0	0	0	113.5	S40 T41 E42	A38-S40 PolarHBondContact O-N 3.24Å; A38-T41 VanDerWaalsContact C-OG1 3.28Å; A38-T41 WeakPolarHBondContact CA-OG1 3.31Å; A38-T41 PolarHBondContact N-OG1 3.43Å; A38-T41 CarbonylContact O-C 3.55Å; A38-T41 WeakPolarHBondContact O-CA 3.38Å; A38-T41 WeakPolarHBondContact O-CB 3.48Å; A38-T41 PolarHBondContact O-N 3.39Å; A38-T41 PolarHBondContact O-OG1 2.92Å; A38-E42 PolarHBondContact O-N 2.96Å
39	P	55.4	Low	63.4	Low	101 Å²	101	90.3 Å²	90.3	66%	0.656	52%	0.521	S	S	*	.	H	α-helix	trans	-57.8	-40	-169.8	-27.4	35.3	0	0	0	116	T41 E42	P39-T41 PolarHBondContact O-N 2.96Å; P39-E42 WeakPolarHBondContact O-CB 3.2Å; P39-E42 PolarHBondContact O-N 2.92Å; P39-E42 VanDerWaalsContact O-N 3.1Å
40	S	55.8	Low	64.5	Low	108 Å²	108	88.8 Å²	88.8	76%	0.755	52%	0.52	S	S	*	.	H	α-helix	trans	-69	-18	174.1	56.1	0	0	0	0	113.1	A38	A38-S40 PolarHBondContact O-N 3.24Å
41	T	59.6	Low	65.8	Low	54 Å²	54	91.4 Å²	91.4	33%	0.331	52%	0.523	S	S	.	.	H	α-helix	trans	-99.8	-4.9	174.6	52.2	0	0	0	0	112	I37 A38 P39 A44 G45	I37-T41 HydrophobicContact CG2-CG2 4.39Å; I37-T41 WeakPolarHBondContact CG2-O 3.44Å; I37-T41 WeakPolarHBondContact CG2-OG1 3.05Å; A38-T41 VanDerWaalsContact C-OG1 3.28Å; A38-T41 WeakPolarHBondContact CA-OG1 3.31Å; A38-T41 PolarHBondContact N-OG1 3.43Å; A38-T41 CarbonylContact O-C 3.55Å; A38-T41 WeakPolarHBondContact O-CA 3.38Å; A38-T41 WeakPolarHBondContact O-CB 3.48Å; A38-T41 PolarHBondContact O-N 3.39Å; A38-T41 PolarHBondContact O-OG1 2.92Å; P39-T41 PolarHBondContact O-N 2.96Å; T41-A44 CarbonylContact O-C 3.22Å; T41-A44 PolarHBondContact O-N 3.19Å; T41-G45 WeakPolarHBondContact O-CA 3.37Å; T41-G45 PolarHBondContact O-N 3.42Å
42	E	67	Low	67.1	Low	115 Å²	115	92 Å²	92	54%	0.537	52%	0.518	S	S	.	.	H	α-helix	trans	-63.4	-45.8	173.3	-77.5	176.1	-167.6	0	0	110.5	A38 P39 A44 G45 L46	A38-E42 PolarHBondContact O-N 2.96Å; P39-E42 WeakPolarHBondContact O-CB 3.2Å; P39-E42 PolarHBondContact O-N 2.92Å; P39-E42 VanDerWaalsContact O-N 3.1Å; E42-A44 PolarHBondContact O-N 3.36Å; E42-G45 CarbonylContact O-C 3.58Å; E42-G45 PolarHBondContact O-N 3.42Å; E42-G45 VanDerWaalsContact O-N 3.15Å; E42-L46 WeakPolarHBondContact O-CB 3.5Å; E42-L46 VanDerWaalsContact O-CG 3.31Å; E42-L46 WeakPolarHBondContact O-CG 3.45Å; E42-L46 PolarHBondContact O-N 3.16Å
43	E	71.7	Confident	68.6	Low	153 Å²	153	90.1 Å²	90.1	72%	0.715	51%	0.509	S	S	*	.	H	α-helix	trans	-60.3	-46.6	175	-172.6	173.4	-173	0	0	110.8	G45 L46 C47	E43-G45 VanDerWaalsContact C-N 3.29Å; E43-G45 PolarHBondContact O-N 3.47Å; E43-L46 PolarHBondContact O-N 3.42Å; E43-C47 PolarHBondContact O-N 3.33Å; E43-C47 PolarHBondContact O-SG 3.01Å
44	A	73.2	Confident	70.3	Confident	60 Å²	60	87.8 Å²	87.8	50%	0.496	50%	0.496	S	S	.	.	H	α-helix	trans	-60.9	-37.8	174.8	0	0	0	0	0	112.4	T41 E42 C47 L48	T41-A44 CarbonylContact O-C 3.22Å; T41-A44 PolarHBondContact O-N 3.19Å; E42-A44 PolarHBondContact O-N 3.36Å; A44-C47 PolarHBondContact O-N 3.39Å; A44-L48 WeakPolarHBondContact O-CB 3.44Å; A44-L48 PolarHBondContact O-N 3.19Å
45	G	75.2	Confident	71.9	Confident	4 Å²	4	91.4 Å²	91.4	4%	0.041	51%	0.511	C	S	.	.	H	α-helix	trans	-68.6	-38.6	177.1	0	0	0	0	0	112.2	T41 E42 E43 L48 R49	T41-G45 WeakPolarHBondContact O-CA 3.37Å; T41-G45 PolarHBondContact O-N 3.42Å; E42-G45 CarbonylContact O-C 3.58Å; E42-G45 PolarHBondContact O-N 3.42Å; E42-G45 VanDerWaalsContact O-N 3.15Å; E43-G45 VanDerWaalsContact C-N 3.29Å; E43-G45 PolarHBondContact O-N 3.47Å; G45-L48 PolarHBondContact O-N 3.28Å; G45-R49 VanDerWaalsContact O-CG 3.3Å; G45-R49 WeakPolarHBondContact O-CG 3.29Å; G45-R49 PolarHBondContact O-N 3.21Å
46	L	76.3	Confident	73.6	Confident	101 Å²	101	88.1 Å²	88.1	53%	0.529	49%	0.493	S	S	.	.	H	α-helix	trans	-65.6	-45.1	172.3	-70.5	174.7	0	0	0	110.7	E42 E43 L48 R49 V50	E42-L46 WeakPolarHBondContact O-CB 3.5Å; E42-L46 VanDerWaalsContact O-CG 3.31Å; E42-L46 WeakPolarHBondContact O-CG 3.45Å; E42-L46 PolarHBondContact O-N 3.16Å; E43-L46 PolarHBondContact O-N 3.42Å; L46-L48 VanDerWaalsContact C-N 3.31Å; L46-L48 PolarHBondContact O-N 3.27Å; L46-R49 PolarHBondContact O-N 3.24Å; L46-V50 WeakPolarHBondContact O-CG2 3.3Å; L46-V50 PolarHBondContact O-N 3.49Å
47	C	79.9	Confident	75.3	Confident	80 Å²	80	85.9 Å²	85.9	54%	0.541	48%	0.476	S	S	.	.	H	α-helix	trans	-57	-44.7	173.7	-68.6	0	0	0	0	111.6	E43 A44 V50 F51	E43-C47 PolarHBondContact O-N 3.33Å; E43-C47 PolarHBondContact O-SG 3.01Å; A44-C47 PolarHBondContact O-N 3.39Å; C47-V50 PolarHBondContact O-N 3.38Å; C47-F51 WeakPolarHBondContact O-CB 3.41Å; C47-F51 PolarHBondContact O-N 3.18Å
48	L	78.1	Confident	76.9	Confident	90 Å²	90	89.9 Å²	89.9	47%	0.471	49%	0.492	S	S	.	.	H	α-helix	trans	-63.9	-43.2	177.8	-174.4	64.4	0	0	0	112	T34 A44 G45 L46 F51 T52	T34-L48 HydrophobicContact CG2-CD2 4.45Å; A44-L48 WeakPolarHBondContact O-CB 3.44Å; A44-L48 PolarHBondContact O-N 3.19Å; G45-L48 PolarHBondContact O-N 3.28Å; L46-L48 VanDerWaalsContact C-N 3.31Å; L46-L48 PolarHBondContact O-N 3.27Å; L48-F51 PolarHBondContact O-N 3.44Å; L48-T52 HydrophobicContact CD1-CG2 4.44Å; L48-T52 WeakPolarHBondContact O-CG2 3.46Å; L48-T52 PolarHBondContact O-N 2.99Å; L48-T52 PolarHBondContact O-OG1 3.29Å
49	R	79.2	Confident	78.4	Confident	121 Å²	121	90.1 Å²	90.1	46%	0.457	49%	0.485	S	S	.	.	H	α-helix	trans	-62.8	-41.3	176.4	-72.9	178.7	-151.7	176.8	6.9	112.4	T34 G45 L46 F51 T52 H53	T34-R49 HydrophobicContact CG2-CG 4.33Å; T34-R49 PolarHBondContact O-NH2 3.46Å; G45-R49 VanDerWaalsContact O-CG 3.3Å; G45-R49 WeakPolarHBondContact O-CG 3.29Å; G45-R49 PolarHBondContact O-N 3.21Å; L46-R49 PolarHBondContact O-N 3.24Å; R49-F51 VanDerWaalsContact C-N 3.34Å; R49-T52 PolarHBondContact O-OG1 3.28Å; R49-H53 WeakPolarHBondContact O-CB 3.44Å; R49-H53 PolarHBondContact O-N 2.98Å
50	V	81.5	Confident	79.9	Confident	93 Å²	93	90.9 Å²	90.9	56%	0.564	48%	0.48	S	S	*	.	H	α-helix	trans	-64.4	-43	176.1	172.6	0	0	0	0	110.1	L46 C47 H53 M54	L46-V50 WeakPolarHBondContact O-CG2 3.3Å; L46-V50 PolarHBondContact O-N 3.49Å; C47-V50 PolarHBondContact O-N 3.38Å; V50-H53 PolarHBondContact O-N 3.34Å; V50-M54 HydrophobicContact CG1-CG 4.43Å; V50-M54 WeakPolarHBondContact O-CB 3.49Å; V50-M54 VanDerWaalsContact O-CG 3.29Å; V50-M54 WeakPolarHBondContact O-CG 3.2Å; V50-M54 PolarHBondContact O-N 3.4Å
51	F	83	Confident	81.4	Confident	129 Å²	129	90.4 Å²	90.4	57%	0.566	47%	0.466	S	S	*	.	H	α-helix	trans	-61.1	-51.6	177.8	-175.4	-90.5	0	0	0	112	C47 L48 R49 H53 M54 E55	C47-F51 WeakPolarHBondContact O-CB 3.41Å; C47-F51 PolarHBondContact O-N 3.18Å; L48-F51 PolarHBondContact O-N 3.44Å; R49-F51 VanDerWaalsContact C-N 3.34Å; F51-H53 VanDerWaalsContact C-N 3.3Å; F51-H53 PolarHBondContact O-N 2.91Å; F51-M54 PolarHBondContact O-N 3.46Å; F51-E55 WeakPolarHBondContact O-CB 3.4Å; F51-E55 PolarHBondContact O-N 2.98Å
52	T	84.5	Confident	82.6	Confident	55 Å²	55	95.8 Å²	95.8	34%	0.337	48%	0.48	S	S	.	.	H	α-helix	trans	-65	-34.9	179.7	56.2	0	0	0	0	112.2	L48 R49 G56	L48-T52 HydrophobicContact CD1-CG2 4.44Å; L48-T52 WeakPolarHBondContact O-CG2 3.46Å; L48-T52 PolarHBondContact O-N 2.99Å; L48-T52 PolarHBondContact O-OG1 3.29Å; R49-T52 PolarHBondContact O-OG1 3.28Å; T52-G56 PolarHBondContact O-N 2.86Å
53	H	88.1	Confident	83.4	Confident	122 Å²	122	93.1 Å²	93.1	57%	0.565	47%	0.474	S	S	*	.	H	α-helix	trans	-64	-47	173.9	-176.4	65	0	0	0	112	R49 V50 F51 G56 L57	R49-H53 WeakPolarHBondContact O-CB 3.44Å; R49-H53 PolarHBondContact O-N 2.98Å; V50-H53 PolarHBondContact O-N 3.34Å; F51-H53 VanDerWaalsContact C-N 3.3Å; F51-H53 PolarHBondContact O-N 2.91Å; H53-G56 PolarHBondContact O-N 3.34Å; H53-L57 WeakPolarHBondContact O-CG 3.43Å; H53-L57 PolarHBondContact O-N 2.92Å
54	M	91.1	Very high	83.9	Confident	87 Å²	87	90.1 Å²	90.1	43%	0.429	46%	0.461	S	S	.	.	H	α-helix	trans	-62.7	-43.6	177.2	-71.7	-61.1	-64.4	0	0	111.6	V50 F51 G56 L57 F58	V50-M54 HydrophobicContact CG1-CG 4.43Å; V50-M54 WeakPolarHBondContact O-CB 3.49Å; V50-M54 VanDerWaalsContact O-CG 3.29Å; V50-M54 WeakPolarHBondContact O-CG 3.2Å; V50-M54 PolarHBondContact O-N 3.4Å; F51-M54 PolarHBondContact O-N 3.46Å; M54-G56 VanDerWaalsContact C-N 3.33Å; M54-G56 PolarHBondContact O-N 3.34Å; M54-L57 PolarHBondContact O-N 2.89Å; M54-L57 HydrophobicContact SD-CD1 4.32Å; M54-F58 HydrophobicContact CE-CE2 4.06Å; M54-F58 WeakPolarHBondContact O-CD2 3.32Å; M54-F58 PolarHBondContact O-N 3.12Å
55	E	87.7	Confident	84.3	Confident	98 Å²	98	91.6 Å²	91.6	46%	0.458	46%	0.461	S	S	.	.	H	α-helix	trans	-60.4	-42.4	175.4	-173.8	169.5	-152.9	0	0	111.8	F51 L57 F58 N59	F51-E55 WeakPolarHBondContact O-CB 3.4Å; F51-E55 PolarHBondContact O-N 2.98Å; E55-L57 PolarHBondContact O-N 3.43Å; E55-F58 PolarHBondContact O-N 2.85Å; E55-N59 WeakPolarHBondContact O-CB 3.44Å; E55-N59 PolarHBondContact O-N 3.2Å; E55-N59 PolarHBondContact O-ND2 3.4Å
56	G	91.9	Very high	84.4	Confident	34 Å²	34	93.9 Å²	93.9	35%	0.351	48%	0.479	S	S	.	.	H	α-helix	trans	-59.3	-42.7	173.1	0	0	0	0	0	113.1	T52 H53 M54 N59 H60	T52-G56 PolarHBondContact O-N 2.86Å; H53-G56 PolarHBondContact O-N 3.34Å; M54-G56 VanDerWaalsContact C-N 3.33Å; M54-G56 PolarHBondContact O-N 3.34Å; G56-N59 PolarHBondContact O-N 2.92Å; G56-H60 WeakPolarHBondContact O-CB 3.14Å; G56-H60 PolarHBondContact O-N 3.42Å
57	L	91.8	Very high	84.4	Confident	85 Å²	85	92.9 Å²	92.9	45%	0.445	47%	0.474	S	S	.	.	H	α-helix	trans	-64.3	-42.5	175.7	-70.5	175.8	0	0	0	112.2	H53 M54 E55 H60 Q61	H53-L57 WeakPolarHBondContact O-CG 3.43Å; H53-L57 PolarHBondContact O-N 2.92Å; M54-L57 PolarHBondContact O-N 2.89Å; M54-L57 HydrophobicContact SD-CD1 4.32Å; E55-L57 PolarHBondContact O-N 3.43Å; L57-H60 PolarHBondContact O-N 3.28Å; L57-Q61 WeakPolarHBondContact O-CB 3.38Å; L57-Q61 PolarHBondContact O-N 2.92Å
58	F	88.5	Confident	84	Confident	142 Å²	142	93 Å²	93	62%	0.623	47%	0.472	S	S	*	.	H	α-helix	trans	-63.9	-42.5	175.8	-81.3	-67.3	0	0	0	112.1	M54 E55 Q61 R62	M54-F58 HydrophobicContact CE-CE2 4.06Å; M54-F58 WeakPolarHBondContact O-CD2 3.32Å; M54-F58 PolarHBondContact O-N 3.12Å; E55-F58 PolarHBondContact O-N 2.85Å; F58-Q61 PolarHBondContact O-N 2.97Å; F58-R62 WeakPolarHBondContact O-CB 3.37Å; F58-R62 PolarHBondContact O-N 3.37Å
59	N	86.8	Confident	83.7	Confident	61 Å²	61	91.3 Å²	91.3	33%	0.326	47%	0.468	S	S	.	.	H	α-helix	trans	-65.5	-42.9	177.2	-73.8	-25.6	0	0	0	111.6	E55 G56 R62 S63	E55-N59 WeakPolarHBondContact O-CB 3.44Å; E55-N59 PolarHBondContact O-N 3.2Å; E55-N59 PolarHBondContact O-ND2 3.4Å; G56-N59 PolarHBondContact O-N 2.92Å; N59-R62 PolarHBondContact O-N 3.44Å; N59-S63 PolarHBondContact O-N 3.2Å
60	H	87	Confident	83.1	Confident	116 Å²	116	91.7 Å²	91.7	54%	0.537	47%	0.474	S	S	.	.	H	α-helix	trans	-60.3	-47.3	174.5	-179	64.8	0	0	0	111.9	G56 L57 R62 S63 M64	G56-H60 WeakPolarHBondContact O-CB 3.14Å; G56-H60 PolarHBondContact O-N 3.42Å; L57-H60 PolarHBondContact O-N 3.28Å; H60-R62 VanDerWaalsContact C-N 3.32Å; H60-R62 PolarHBondContact O-N 2.88Å; H60-S63 WeakPolarHBondContact O-CB 3.45Å; H60-S63 PolarHBondContact O-N 2.67Å; H60-M64 PolarHBondContact NE2-SD 2.96Å; H60-M64 VanDerWaalsContact NE2-SD 3.38Å; H60-M64 PolarHBondContact O-N 2.92Å
61	Q	87.7	Confident	82.6	Confident	99 Å²	99	89.7 Å²	89.7	46%	0.463	47%	0.467	S	S	.	.	H	α-helix	trans	-60.5	-41.6	176.7	-176.1	64.3	65.8	0	0	111.8	L57 F58 M64 N65	L57-Q61 WeakPolarHBondContact O-CB 3.38Å; L57-Q61 PolarHBondContact O-N 2.92Å; F58-Q61 PolarHBondContact O-N 2.97Å; Q61-M64 PolarHBondContact O-N 3.47Å; Q61-N65 PolarHBondContact NE2-OD1 2.99Å; Q61-N65 WeakPolarHBondContact O-CB 3.47Å; Q61-N65 PolarHBondContact O-N 3.04Å; Q61-N65 PolarHBondContact O-ND2 3.26Å
62	R	85.6	Confident	82	Confident	167 Å²	167	86.9 Å²	86.9	63%	0.63	46%	0.46	S	S	*	.	H	α-helix	trans	-62.7	-43.2	176.3	-175.4	-177.1	-98.8	151.3	-9.1	111.2	F58 N59 H60 N65 A66	F58-R62 WeakPolarHBondContact O-CB 3.37Å; F58-R62 PolarHBondContact O-N 3.37Å; N59-R62 PolarHBondContact O-N 3.44Å; H60-R62 VanDerWaalsContact C-N 3.32Å; H60-R62 PolarHBondContact O-N 2.88Å; R62-N65 PolarHBondContact O-N 3.06Å; R62-A66 PolarHBondContact O-N 3.31Å
63	S	83.7	Confident	81.5	Confident	59 Å²	59	90 Å²	90	41%	0.413	47%	0.471	S	S	.	.	H	α-helix	trans	-60.4	-50.4	175.1	-169.4	0	0	0	0	111.4	N59 H60 N65 A66 D67	N59-S63 PolarHBondContact O-N 3.2Å; H60-S63 WeakPolarHBondContact O-CB 3.45Å; H60-S63 PolarHBondContact O-N 2.67Å; S63-N65 VanDerWaalsContact C-N 3.26Å; S63-N65 PolarHBondContact O-N 2.92Å; S63-A66 WeakPolarHBondContact O-CB 3.36Å; S63-A66 PolarHBondContact O-N 2.73Å; S63-D67 PolarHBondContact O-N 3.37Å
64	M	81.2	Confident	80.8	Confident	90 Å²	90	88.8 Å²	88.8	44%	0.443	47%	0.468	S	S	.	.	H	α-helix	trans	-58.7	-39	178.6	-74.2	-169.6	73.1	0	0	112.5	H60 Q61 D67 T68	H60-M64 PolarHBondContact NE2-SD 2.96Å; H60-M64 VanDerWaalsContact NE2-SD 3.38Å; H60-M64 PolarHBondContact O-N 2.92Å; Q61-M64 PolarHBondContact O-N 3.47Å; M64-D67 PolarHBondContact O-N 3.22Å; M64-T68 WeakPolarHBondContact O-CB 3.42Å; M64-T68 PolarHBondContact O-N 3.18Å; M64-T68 PolarHBondContact O-OG1 3.48Å
65	N	81.4	Confident	80.2	Confident	91 Å²	91	90.7 Å²	90.7	49%	0.487	48%	0.479	S	S	.	.	H	α-helix	trans	-68.6	-37.1	176.9	-70.6	-17.1	0	0	0	111.8	Q61 R62 S63 S69	Q61-N65 PolarHBondContact NE2-OD1 2.99Å; Q61-N65 WeakPolarHBondContact O-CB 3.47Å; Q61-N65 PolarHBondContact O-N 3.04Å; Q61-N65 PolarHBondContact O-ND2 3.26Å; R62-N65 PolarHBondContact O-N 3.06Å; S63-N65 VanDerWaalsContact C-N 3.26Å; S63-N65 PolarHBondContact O-N 2.92Å; N65-S69 WeakPolarHBondContact O-CB 3.4Å; N65-S69 PolarHBondContact O-N 2.92Å
66	A	77.7	Confident	79.5	Confident	52 Å²	52	94.3 Å²	94.3	43%	0.43	49%	0.493	S	S	.	.	H	α-helix	trans	-63.6	-45.4	174.1	0	0	0	0	0	111	R62 S63 T68 S69 F70	R62-A66 PolarHBondContact O-N 3.31Å; S63-A66 WeakPolarHBondContact O-CB 3.36Å; S63-A66 PolarHBondContact O-N 2.73Å; A66-T68 PolarHBondContact O-N 2.92Å; A66-S69 WeakPolarHBondContact O-CB 3.39Å; A66-S69 PolarHBondContact O-N 3.44Å; A66-S69 PolarHBondContact O-OG 3.34Å; A66-F70 PolarHBondContact O-N 3.38Å
67	D	76.7	Confident	78.7	Confident	80 Å²	80	96.8 Å²	96.8	43%	0.428	51%	0.51	S	S	.	.	H	α-helix	trans	-64.5	-41.4	177.9	-64.4	-32.9	0	0	0	112.1	S63 M64 S69 F70 A71	S63-D67 PolarHBondContact O-N 3.37Å; M64-D67 PolarHBondContact O-N 3.22Å; D67-S69 VanDerWaalsContact C-N 3.31Å; D67-S69 PolarHBondContact O-N 3.48Å; D67-F70 WeakPolarHBondContact O-CB 3.27Å; D67-F70 PolarHBondContact O-N 2.93Å; D67-A71 PolarHBondContact O-N 3.34Å
68	T	71.7	Confident	77.4	Confident	81 Å²	81	105.9 Å²	105.9	50%	0.497	54%	0.539	S	S	.	.	H	α-helix	trans	-63	-41.6	175.1	-54	0	0	0	0	110.5	M64 A66 F70 A71 V72	M64-T68 WeakPolarHBondContact O-CB 3.42Å; M64-T68 PolarHBondContact O-N 3.18Å; M64-T68 PolarHBondContact O-OG1 3.48Å; A66-T68 PolarHBondContact O-N 2.92Å; T68-F70 VanDerWaalsContact C-N 3.29Å; T68-F70 PolarHBondContact O-N 2.93Å; T68-A71 PolarHBondContact O-N 3.42Å; T68-V72 VanDerWaalsContact O-CG2 3.29Å; T68-V72 WeakPolarHBondContact O-CG2 3.49Å; T68-V72 PolarHBondContact O-N 2.98Å
69	S	71.3	Confident	76.8	Confident	56 Å²	56	104.1 Å²	104.1	39%	0.392	54%	0.535	S	S	.	.	H	α-helix	trans	-62.7	-38.1	176.8	84	0	0	0	0	111.8	N65 A66 D67 V72 Q73	N65-S69 WeakPolarHBondContact O-CB 3.4Å; N65-S69 PolarHBondContact O-N 2.92Å; A66-S69 WeakPolarHBondContact O-CB 3.39Å; A66-S69 PolarHBondContact O-N 3.44Å; A66-S69 PolarHBondContact O-OG 3.34Å; D67-S69 VanDerWaalsContact C-N 3.31Å; D67-S69 PolarHBondContact O-N 3.48Å; S69-V72 PolarHBondContact O-N 3.46Å; S69-Q73 WeakPolarHBondContact O-CB 3.49Å; S69-Q73 VanDerWaalsContact O-CG 3.27Å; S69-Q73 WeakPolarHBondContact O-CG 3.29Å; S69-Q73 PolarHBondContact O-N 2.97Å
70	F	67	Low	76.3	Confident	129 Å²	129	106.4 Å²	106.4	57%	0.566	55%	0.546	S	S	*	.	H	α-helix	trans	-67.1	-45.3	176.7	-175.4	-103.9	0	0	0	111.6	A66 D67 T68 V72 Q73 L74	A66-F70 PolarHBondContact O-N 3.38Å; D67-F70 WeakPolarHBondContact O-CB 3.27Å; D67-F70 PolarHBondContact O-N 2.93Å; T68-F70 VanDerWaalsContact C-N 3.29Å; T68-F70 PolarHBondContact O-N 2.93Å; F70-V72 VanDerWaalsContact C-N 3.34Å; F70-V72 PolarHBondContact O-N 3.22Å; F70-Q73 PolarHBondContact O-N 3.19Å; F70-L74 HydrophobicContact CD1-CD1 3.87Å; F70-L74 HydrophobicContact CD1-CG 4.38Å; F70-L74 HydrophobicContact CE1-CD1 3.39Å; F70-L74 HydrophobicContact CE1-CG 4.04Å; F70-L74 HydrophobicContact CZ-CD1 3.93Å; F70-L74 HydrophobicContact CZ-CD2 4.37Å; F70-L74 HydrophobicContact CZ-CG 4.18Å; F70-L74 PolarHBondContact O-N 3.12Å
71	A	70.6	Confident	75.7	Confident	50 Å²	50	105.8 Å²	105.8	41%	0.413	55%	0.546	S	S	.	.	H	α-helix	trans	-60.7	-41.3	176	0	0	0	0	0	112.4	D67 T68 L74 L75	D67-A71 PolarHBondContact O-N 3.34Å; T68-A71 PolarHBondContact O-N 3.42Å; A71-L74 PolarHBondContact O-N 3.4Å; A71-L75 WeakPolarHBondContact O-CG 3.48Å; A71-L75 PolarHBondContact O-N 3.41Å
72	V	70.1	Confident	75	Confident	70 Å²	70	106.2 Å²	106.2	42%	0.424	55%	0.551	S	S	.	*	H	α-helix	trans	-66	-39.1	175.9	171.8	0	0	0	0	111.6	T68 S69 F70 L75 K76	T68-V72 VanDerWaalsContact O-CG2 3.29Å; T68-V72 WeakPolarHBondContact O-CG2 3.49Å; T68-V72 PolarHBondContact O-N 2.98Å; S69-V72 PolarHBondContact O-N 3.46Å; F70-V72 VanDerWaalsContact C-N 3.34Å; F70-V72 PolarHBondContact O-N 3.22Å; V72-L75 PolarHBondContact O-N 3.13Å; V72-K76 PolarHBondContact O-N 3.36Å; V72-K76 VanDerWaalsContact O-N 3.13Å
73	Q	73.3	Confident	74.3	Confident	121 Å²	121	102.4 Å²	102.4	57%	0.565	55%	0.546	S	S	*	.	H	α-helix	trans	-65.1	-42.2	175.7	-75.1	179.5	45.4	0	0	112	S69 F70 L75 K76 A77	S69-Q73 WeakPolarHBondContact O-CB 3.49Å; S69-Q73 VanDerWaalsContact O-CG 3.27Å; S69-Q73 WeakPolarHBondContact O-CG 3.29Å; S69-Q73 PolarHBondContact O-N 2.97Å; F70-Q73 PolarHBondContact O-N 3.19Å; Q73-L75 VanDerWaalsContact C-N 3.32Å; Q73-L75 PolarHBondContact O-N 3.44Å; Q73-K76 PolarHBondContact O-N 3.42Å; Q73-A77 PolarHBondContact O-N 3.2Å
74	L	75.3	Confident	73.7	Confident	97 Å²	97	105.3 Å²	105.3	51%	0.508	56%	0.555	S	S	.	*	H	α-helix	trans	-62.2	-38.2	175.1	-76.1	178.4	0	0	0	112.7	F70 A71 A77	F70-L74 HydrophobicContact CD1-CD1 3.87Å; F70-L74 HydrophobicContact CD1-CG 4.38Å; F70-L74 HydrophobicContact CE1-CD1 3.39Å; F70-L74 HydrophobicContact CE1-CG 4.04Å; F70-L74 HydrophobicContact CZ-CD1 3.93Å; F70-L74 HydrophobicContact CZ-CD2 4.37Å; F70-L74 HydrophobicContact CZ-CG 4.18Å; F70-L74 PolarHBondContact O-N 3.12Å; A71-L74 PolarHBondContact O-N 3.4Å; L74-A77 PolarHBondContact O-N 3.06Å
75	L	77.2	Confident	73.2	Confident	127 Å²	127	106.4 Å²	106.4	67%	0.665	56%	0.563	S	S	*	*	H	α-helix	trans	-66.8	-34.7	175.8	-77.9	168.5	0	0	0	112.7	A71 V72 Q73 A77	A71-L75 WeakPolarHBondContact O-CG 3.48Å; A71-L75 PolarHBondContact O-N 3.41Å; V72-L75 PolarHBondContact O-N 3.13Å; Q73-L75 VanDerWaalsContact C-N 3.32Å; Q73-L75 PolarHBondContact O-N 3.44Å; L75-A77 VanDerWaalsContact C-N 3.31Å
76	K	73.2	Confident	72.5	Confident	173 Å²	173	107.6 Å²	107.6	75%	0.752	57%	0.569	S	S	*	*	H	α-helix	trans	-73.8	-20	176	-78.6	-177.4	179.1	178.1	0	114.1	V72 Q73 R78	V72-K76 PolarHBondContact O-N 3.36Å; V72-K76 VanDerWaalsContact O-N 3.13Å; Q73-K76 PolarHBondContact O-N 3.42Å; K76-R78 VanDerWaalsContact C-N 3.33Å
77	A	76.2	Confident	72.1	Confident	86 Å²	86	112.3 Å²	112.3	71%	0.711	58%	0.581	S	S	*	*	T	Hydrogen-bonded Turn	trans	-84.3	-5.4	-179.2	0	0	0	0	0	113.8	Q73 L74 L75	Q73-A77 PolarHBondContact O-N 3.2Å; L74-A77 PolarHBondContact O-N 3.06Å; L75-A77 VanDerWaalsContact C-N 3.31Å
78	R	62.9	Low	71.7	Confident	277 Å²	277	115.2 Å²	115.2	100%	1.045	59%	0.594	S	S	*	*			trans	-95.6	0	172.8	-71.5	-174.8	177.8	-173.7	0.1	111	K76	K76-R78 VanDerWaalsContact C-N 3.33Å

Retrieved 78 of 78 residues in 145.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).