A0A077ZN38_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZN38, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 54 aa.

						>A0A077ZN38_TRITR|A0A077ZN38
MELVDARSGAEISHHEPHRNWGKGVTVQLDESLFSKWESDPVCSTPNSGPSSLL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	56.1	Low	78.5	Confident	225 Å²	225	111.8 Å²	111.8	100%	1.108	63%	0.629	S	S	*	*				0	127.4	0	-78.2	-175.7	-162.3	0	0	106.3
2	E	70.9	Confident	78.4	Confident	126 Å²	126	111.6 Å²	111.6	59%	0.589	62%	0.623	S	S	*	*			trans	-99.8	132.5	-178.7	-69.8	163.1	-166	0	0	108
3	L	74.8	Confident	77.7	Confident	95 Å²	95	106.1 Å²	106.1	50%	0.497	60%	0.596	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-84.2	121	171.1	-68.6	179.3	0	0	0	107.7	I12 H15	L3-I12 PolarHBondContact O-N 3.06Å; L3-H15 WeakPolarHBondContact CD1-NE2 3.49Å
4	V	80.3	Confident	76.9	Confident	87 Å²	87	108.3 Å²	108.3	53%	0.527	60%	0.599	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-110.9	141.5	-178.8	-65.1	0	0	0	0	110.6	A6	V4-A6 PolarHBondContact O-N 3.15Å
5	D	78.7	Confident	75.7	Confident	56 Å²	56	105.7 Å²	105.7	30%	0.299	58%	0.581	S	S	.	*			trans	-71.7	113.7	173.2	-178.2	-83.5	0	0	0	108.5	R7 S8 G9 A10 I12	D5-R7 PolarHBondContact O-N 3.3Å; D5-R7 VanDerWaalsContact O-N 3.1Å; D5-R7 WeakPolarHBondContact OD1-CA 3.45Å; D5-R7 WeakPolarHBondContact OD1-CB 3.33Å; D5-R7 PolarHBondContact OD1-N 2.94Å; D5-S8 WeakPolarHBondContact CB-OG 3.27Å; D5-S8 VanDerWaalsContact CG-OG 3.23Å; D5-S8 PolarHBondContact O-N 2.64Å; D5-S8 WeakPolarHBondContact OD1-CB 3.28Å; D5-S8 PolarHBondContact OD1-N 2.92Å; D5-S8 PolarHBondContact OD1-OG 3.31Å; D5-G9 VanDerWaalsContact O-CA 3.28Å; D5-G9 WeakPolarHBondContact O-CA 3.43Å; D5-G9 PolarHBondContact O-N 2.79Å; D5-A10 WeakPolarHBondContact CB-O 3.3Å; D5-A10 PolarHBondContact N-O 3.41Å; D5-I12 HydrophobicContact CB-CD1 3.66Å; D5-I12 HydrophobicContact CB-CG1 3.55Å; D5-I12 VanDerWaalsContact N-CD1 3.33Å
6	A	82.9	Confident	74.8	Confident	110 Å²	110	109.5 Å²	109.5	91%	0.909	59%	0.593	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63.6	-19.1	-174.7	0	0	0	0	0	113.6	V4	V4-A6 PolarHBondContact O-N 3.15Å
7	R	81.9	Confident	73.8	Confident	242 Å²	242	109.3 Å²	109.3	91%	0.913	60%	0.599	S	S	*	*	T	Hydrogen-bonded Turn	trans	-92.3	-34.7	-175.8	-178.2	175.8	179.2	147.3	1.4	112.7	D5	D5-R7 PolarHBondContact O-N 3.3Å; D5-R7 VanDerWaalsContact O-N 3.1Å; D5-R7 WeakPolarHBondContact OD1-CA 3.45Å; D5-R7 WeakPolarHBondContact OD1-CB 3.33Å; D5-R7 PolarHBondContact OD1-N 2.94Å
8	S	88.9	Confident	73.1	Confident	84 Å²	84	109.7 Å²	109.7	59%	0.587	60%	0.595	S	S	*	*	T	Hydrogen-bonded Turn	trans	-112.8	-15.8	-175.2	60.2	0	0	0	0	113.6	D5 A10	D5-S8 WeakPolarHBondContact CB-OG 3.27Å; D5-S8 VanDerWaalsContact CG-OG 3.23Å; D5-S8 PolarHBondContact O-N 2.64Å; D5-S8 WeakPolarHBondContact OD1-CB 3.28Å; D5-S8 PolarHBondContact OD1-N 2.92Å; D5-S8 PolarHBondContact OD1-OG 3.31Å; S8-A10 PolarHBondContact O-N 2.7Å; S8-A10 PolarHBondContact OG-N 3.26Å
9	G	83.9	Confident	72.2	Confident	60 Å²	60	116.1 Å²	116.1	62%	0.619	61%	0.61	S	S	*	*			trans	71.5	4.5	-172.4	0	0	0	0	0	113.8	D5	D5-G9 VanDerWaalsContact O-CA 3.28Å; D5-G9 WeakPolarHBondContact O-CA 3.43Å; D5-G9 PolarHBondContact O-N 2.79Å
10	A	85	Confident	71.6	Confident	52 Å²	52	118.1 Å²	118.1	43%	0.43	62%	0.621	S	S	.	*			trans	-72.2	140	177.9	0	0	0	0	0	110.8	D5 S8 I12	D5-A10 WeakPolarHBondContact CB-O 3.3Å; D5-A10 PolarHBondContact N-O 3.41Å; S8-A10 PolarHBondContact O-N 2.7Å; S8-A10 PolarHBondContact OG-N 3.26Å; A10-I12 PolarHBondContact O-N 3.22Å
11	E	80.5	Confident	70.8	Confident	93 Å²	93	121.3 Å²	121.3	44%	0.435	63%	0.625	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-63.1	121.1	169.6	-171.4	-178.3	169.9	0	0	108.9	H14	E11-H14 VanDerWaalsContact OE1-CA 3.27Å; E11-H14 WeakPolarHBondContact OE1-CA 3.36Å; E11-H14 WeakPolarHBondContact OE1-CB 3.5Å; E11-H14 IonicContact OE1-CG 3.72Å; E11-H14 PolarHBondContact OE1-N 2.83Å; E11-H14 IonicContact OE1-ND1 3.15Å; E11-H14 PolarHBondContact OE1-ND1 2.91Å; E11-H14 VanDerWaalsContact OE1-ND1 3.15Å
12	I	77.2	Confident	70.9	Confident	109 Å²	109	113.6 Å²	113.6	56%	0.559	60%	0.603	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-83.7	-33	179.9	-58.6	165.2	0	0	0	110.2	L3 D5 A10	L3-I12 PolarHBondContact O-N 3.06Å; D5-I12 HydrophobicContact CB-CD1 3.66Å; D5-I12 HydrophobicContact CB-CG1 3.55Å; D5-I12 VanDerWaalsContact N-CD1 3.33Å; A10-I12 PolarHBondContact O-N 3.22Å
13	S	68.8	Low	70.5	Confident	40 Å²	40	117.4 Å²	117.4	28%	0.28	62%	0.618	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-158.4	129.8	175.7	68.7	0	0	0	0	112.8	H15	S13-H15 PolarHBondContact O-N 3.2Å
14	H	66.6	Low	69.9	Low	137 Å²	137	116.6 Å²	116.6	63%	0.634	63%	0.632	S	S	*	*			trans	-70.5	105.2	156.4	-152.9	76.4	0	0	0	107.2	E11 E16	E11-H14 VanDerWaalsContact OE1-CA 3.27Å; E11-H14 WeakPolarHBondContact OE1-CA 3.36Å; E11-H14 WeakPolarHBondContact OE1-CB 3.5Å; E11-H14 IonicContact OE1-CG 3.72Å; E11-H14 PolarHBondContact OE1-N 2.83Å; E11-H14 IonicContact OE1-ND1 3.15Å; E11-H14 PolarHBondContact OE1-ND1 2.91Å; E11-H14 VanDerWaalsContact OE1-ND1 3.15Å; H14-E16 PolarHBondContact O-N 3.1Å
15	H	58.5	Low	69.1	Low	70 Å²	70	118.3 Å²	118.3	32%	0.324	64%	0.642	S	S	.	*			trans	-64.9	103.5	168.2	-80.8	-75.8	0	0	0	107.1	L3 S13 W21	L3-H15 WeakPolarHBondContact CD1-NE2 3.49Å; S13-H15 PolarHBondContact O-N 3.2Å; H15-W21 AromaticContact ND1-CH2 3.9Å
16	E	61.1	Low	68.4	Low	166 Å²	166	122 Å²	122	78%	0.776	67%	0.667	S	S	*	*			trans	-49.2	135.1	164	-79.3	-149.1	161.1	0	0	107.9	H14 H18	H14-E16 PolarHBondContact O-N 3.1Å; E16-H18 VanDerWaalsContact C-N 3.32Å; E16-H18 PolarHBondContact O-N 2.98Å
17	P	57.9	Low	67.6	Low	106 Å²	106	122 Å²	122	69%	0.688	66%	0.656	S	S	*	*			trans	-62.6	94.2	-173.7	23	-32.6	0	0	0	110.1	R19	P17-R19 WeakPolarHBondContact O-CA 3.24Å; P17-R19 WeakPolarHBondContact O-CB 3.38Å; P17-R19 PolarHBondContact O-N 2.76Å
18	H	61.6	Low	67	Low	116 Å²	116	119.5 Å²	119.5	54%	0.537	65%	0.654	S	S	.	*			trans	24.4	36	157	-64.3	-122.6	0	0	0	117.4	E16 N20 W21	E16-H18 VanDerWaalsContact C-N 3.32Å; E16-H18 PolarHBondContact O-N 2.98Å; H18-N20 PolarHBondContact O-N 2.79Å; H18-W21 AromaticContact CE1-CE3 3.46Å; H18-W21 VanDerWaalsContact CE1-CE3 3.46Å; H18-W21 AromaticContact CE1-CZ3 3.3Å; H18-W21 WeakPolarHBondContact CE1-CZ3 3.41Å; H18-W21 AromaticContact CG-CE3 3.97Å; H18-W21 AromaticContact ND1-CE3 3.18Å; H18-W21 AromaticContact ND1-CZ3 3.56Å; H18-W21 AromaticContact NE2-CZ3 3.94Å
19	R	57	Low	66.1	Low	232 Å²	232	121 Å²	121	88%	0.875	66%	0.655	S	S	*	*	T	Hydrogen-bonded Turn	trans	-70.2	-8.4	-161.3	-146.9	-178.7	-178.6	-172.3	1	113.7	P17	P17-R19 WeakPolarHBondContact O-CA 3.24Å; P17-R19 WeakPolarHBondContact O-CB 3.38Å; P17-R19 PolarHBondContact O-N 2.76Å
20	N	60.3	Low	65.5	Low	155 Å²	155	122.7 Å²	122.7	83%	0.829	65%	0.65	S	S	*	*	T	Hydrogen-bonded Turn	trans	-152.8	21.1	-178.9	-82.7	-43	0	0	0	114.5	H18 G22	H18-N20 PolarHBondContact O-N 2.79Å; N20-G22 VanDerWaalsContact C-N 3.26Å; N20-G22 PolarHBondContact O-N 3.43Å
21	W	54.6	Low	64.6	Low	187 Å²	187	128.3 Å²	128.3	71%	0.708	67%	0.667	S	S	*	*	S	Bend	trans	-80.1	78.9	175.6	-75.9	-3.5	0	0	0	111.1	H15 H18	H15-W21 AromaticContact ND1-CH2 3.9Å; H18-W21 AromaticContact CE1-CE3 3.46Å; H18-W21 VanDerWaalsContact CE1-CE3 3.46Å; H18-W21 AromaticContact CE1-CZ3 3.3Å; H18-W21 WeakPolarHBondContact CE1-CZ3 3.41Å; H18-W21 AromaticContact CG-CE3 3.97Å; H18-W21 AromaticContact ND1-CE3 3.18Å; H18-W21 AromaticContact ND1-CZ3 3.56Å; H18-W21 AromaticContact NE2-CZ3 3.94Å
22	G	56.7	Low	64	Low	63 Å²	63	127 Å²	127	65%	0.649	67%	0.668	S	S	*	*			trans	94.9	113.5	162.4	0	0	0	0	0	113.9	N20 G24	N20-G22 VanDerWaalsContact C-N 3.26Å; N20-G22 PolarHBondContact O-N 3.43Å; G22-G24 PolarHBondContact O-N 3.28Å
23	K	62.4	Low	63.2	Low	206 Å²	206	127.9 Å²	127.9	90%	0.896	67%	0.674	S	S	*	*	P	Polyproline II helix	trans	-61.2	116.4	146.6	-71	-178.7	178.9	179.7	0	105.5	V25	K23-V25 PolarHBondContact O-N 2.77Å
24	G	62.7	Low	62.8	Low	77 Å²	77	132.7 Å²	132.7	79%	0.794	69%	0.69	S	S	*	*	P	Polyproline II helix	trans	-53.5	119.2	170.3	0	0	0	0	0	108.2	G22	G22-G24 PolarHBondContact O-N 3.28Å
25	V	63.4	Low	62.4	Low	123 Å²	123	130.7 Å²	130.7	75%	0.745	69%	0.691	S	S	*	*	P	Polyproline II helix	trans	-82.9	122.7	168.4	-70	0	0	0	0	106.7	K23 V27	K23-V25 PolarHBondContact O-N 2.77Å; V25-V27 PolarHBondContact O-N 3.45Å
26	T	65.2	Low	62.3	Low	135 Å²	135	136 Å²	136	83%	0.828	71%	0.713	S	S	*	*			trans	-76.9	108.6	167.5	-58.6	0	0	0	0	106.4
27	V	65.5	Low	62.3	Low	110 Å²	110	138.3 Å²	138.3	67%	0.667	72%	0.715	S	S	*	*			trans	-83.1	113.4	167	-77.1	0	0	0	0	107.7	V25 L29	V25-V27 PolarHBondContact O-N 3.45Å; V27-L29 PolarHBondContact O-N 3.26Å
28	Q	68.9	Low	62.6	Low	189 Å²	189	140.8 Å²	140.8	88%	0.883	72%	0.718	S	S	*	*			trans	-78.4	113.1	161.9	-112.2	169.4	22.3	0	0	106.5	D30	Q28-D30 PolarHBondContact O-N 3.35Å
29	L	69.9	Low	62.8	Low	114 Å²	114	139.4 Å²	139.4	60%	0.597	72%	0.721	S	S	*	*			trans	-72.7	115.4	171.9	-62.5	171.7	0	0	0	106.8	V27 E31 F34	V27-L29 PolarHBondContact O-N 3.26Å; L29-E31 PolarHBondContact O-N 3.3Å; L29-F34 HydrophobicContact CB-CE2 4.21Å; L29-F34 HydrophobicContact CD1-CE2 4.49Å; L29-F34 HydrophobicContact CD1-CZ 4.15Å
30	D	71.9	Confident	63	Low	97 Å²	97	133.4 Å²	133.4	52%	0.519	71%	0.706	S	S	.	*			trans	-66.3	122.7	166.4	-178.5	-1	0	0	0	107.6	Q28 S32 L33	Q28-D30 PolarHBondContact O-N 3.35Å; D30-S32 PolarHBondContact O-N 2.64Å; D30-S32 WeakPolarHBondContact OD1-CB 3.45Å; D30-S32 PolarHBondContact OD1-N 2.95Å; D30-S32 PolarHBondContact OD1-OG 2.97Å; D30-S32 WeakPolarHBondContact OD2-CB 3.34Å; D30-S32 PolarHBondContact OD2-OG 3.07Å; D30-L33 HydrophobicContact CB-CD1 4.45Å; D30-L33 HydrophobicContact CB-CG 4.49Å; D30-L33 WeakPolarHBondContact O-CB 3.33Å; D30-L33 PolarHBondContact O-N 3.29Å
31	E	66.4	Low	63.1	Low	169 Å²	169	130.7 Å²	130.7	79%	0.79	70%	0.697	S	S	*	*	G	3₁₀ helix	trans	-58.2	-21.1	177.8	-65.3	-174.3	164.4	0	0	111.9	L29 L33 F34	L29-E31 PolarHBondContact O-N 3.3Å; E31-L33 PolarHBondContact O-N 3.32Å; E31-F34 PolarHBondContact O-N 3.48Å; E31-F34 VanDerWaalsContact O-N 3.13Å
32	S	67.2	Low	63.3	Low	65 Å²	65	127.1 Å²	127.1	46%	0.455	70%	0.695	S	S	.	*	G	3₁₀ helix	trans	-59.7	-25.6	172.9	84.3	0	0	0	0	113.5	D30 F34 S35	D30-S32 PolarHBondContact O-N 2.64Å; D30-S32 WeakPolarHBondContact OD1-CB 3.45Å; D30-S32 PolarHBondContact OD1-N 2.95Å; D30-S32 PolarHBondContact OD1-OG 2.97Å; D30-S32 WeakPolarHBondContact OD2-CB 3.34Å; D30-S32 PolarHBondContact OD2-OG 3.07Å; S32-F34 PolarHBondContact O-N 3.08Å; S32-S35 WeakPolarHBondContact O-CB 3.45Å; S32-S35 PolarHBondContact O-N 3.13Å; S32-S35 PolarHBondContact O-OG 2.69Å
33	L	59.7	Low	63	Low	129 Å²	129	130 Å²	130	68%	0.675	70%	0.704	S	S	*	*	G	3₁₀ helix	trans	-68.3	-21	178	-69.6	167.1	0	0	0	112.9	D30 E31 S35	D30-L33 HydrophobicContact CB-CD1 4.45Å; D30-L33 HydrophobicContact CB-CG 4.49Å; D30-L33 WeakPolarHBondContact O-CB 3.33Å; D30-L33 PolarHBondContact O-N 3.29Å; E31-L33 PolarHBondContact O-N 3.32Å; L33-S35 VanDerWaalsContact C-N 3.3Å; L33-S35 PolarHBondContact O-N 3.31Å
34	F	62.3	Low	62.3	Low	140 Å²	140	124.4 Å²	124.4	61%	0.614	69%	0.691	S	S	*	*	G	3₁₀ helix	trans	-88.1	6.5	-180	-62.9	-80.5	0	0	0	113.5	L29 E31 S32 K36	L29-F34 HydrophobicContact CB-CE2 4.21Å; L29-F34 HydrophobicContact CD1-CE2 4.49Å; L29-F34 HydrophobicContact CD1-CZ 4.15Å; E31-F34 PolarHBondContact O-N 3.48Å; E31-F34 VanDerWaalsContact O-N 3.13Å; S32-F34 PolarHBondContact O-N 3.08Å; F34-K36 PolarHBondContact O-N 3.21Å; F34-K36 VanDerWaalsContact O-N 3.08Å
35	S	57.6	Low	61.7	Low	95 Å²	95	126.1 Å²	126.1	66%	0.664	69%	0.687	S	S	*	*	S	Bend	trans	-69.3	-6.5	-174.6	-50.5	0	0	0	0	115	S32 L33	S32-S35 WeakPolarHBondContact O-CB 3.45Å; S32-S35 PolarHBondContact O-N 3.13Å; S32-S35 PolarHBondContact O-OG 2.69Å; L33-S35 VanDerWaalsContact C-N 3.3Å; L33-S35 PolarHBondContact O-N 3.31Å
36	K	56.6	Low	61.2	Low	181 Å²	181	125.3 Å²	125.3	79%	0.787	68%	0.684	S	S	*	*			trans	-141.8	99.7	176.2	-84.4	-172.5	170.2	-172.5	0	111.4	F34	F34-K36 PolarHBondContact O-N 3.21Å; F34-K36 VanDerWaalsContact O-N 3.08Å
37	W	60.6	Low	60.3	Low	216 Å²	216	126.8 Å²	126.8	82%	0.818	69%	0.686	S	S	*	*			trans	-94.8	110.1	145.5	66.2	-81.1	0	0	0	105.5	S39	W37-S39 WeakPolarHBondContact CZ3-OG 3.43Å
38	E	65.2	Low	59.5	Low	158 Å²	158	126.8 Å²	126.8	74%	0.738	69%	0.692	S	S	*	*			trans	-95.1	125.9	166.4	-171	167	-177.2	0	0	105.7	D40	E38-D40 PolarHBondContact O-N 3.07Å; E38-D40 VanDerWaalsContact O-N 3.07Å
39	S	64.4	Low	58.2	Low	87 Å²	87	120.2 Å²	120.2	61%	0.608	67%	0.674	S	S	*	*			trans	-60	115.2	168.5	-76.9	0	0	0	0	107.6	W37 P41	W37-S39 WeakPolarHBondContact CZ3-OG 3.43Å; S39-P41 VanDerWaalsContact O-CD 3.24Å; S39-P41 WeakPolarHBondContact O-CD 3.31Å; S39-P41 VanDerWaalsContact O-N 3.1Å
40	D	61.6	Low	57.3	Low	106 Å²	106	120.7 Å²	120.7	57%	0.567	68%	0.684	S	S	*	*			trans	-56.7	115.6	172	-172.7	-17.5	0	0	0	108.5	E38 V42 C43	E38-D40 PolarHBondContact O-N 3.07Å; E38-D40 VanDerWaalsContact O-N 3.07Å; D40-V42 PolarHBondContact O-N 3.38Å; D40-V42 VanDerWaalsContact OD1-CB 3.31Å; D40-V42 WeakPolarHBondContact OD1-CB 3.24Å; D40-V42 VanDerWaalsContact OD1-CG2 3.26Å; D40-V42 WeakPolarHBondContact OD1-CG2 3.26Å; D40-V42 PolarHBondContact OD1-N 3.37Å; D40-C43 PolarHBondContact O-N 3.3Å
41	P	62.2	Low	56.2	Low	97 Å²	97	121.8 Å²	121.8	63%	0.63	70%	0.699	S	S	*	*	G	3₁₀ helix	trans	-66.5	-6.2	-179	27	-33.4	0	0	0	112.8	S39 C43 S44	S39-P41 VanDerWaalsContact O-CD 3.24Å; S39-P41 WeakPolarHBondContact O-CD 3.31Å; S39-P41 VanDerWaalsContact O-N 3.1Å; P41-C43 PolarHBondContact O-N 3.08Å; P41-S44 PolarHBondContact O-N 3.05Å; P41-S44 PolarHBondContact O-OG 3.45Å; P41-S44 VanDerWaalsContact O-OG 3.08Å
42	V	58.4	Low	55.5	Low	112 Å²	112	118.9 Å²	118.9	68%	0.679	70%	0.698	S	S	*	*	G	3₁₀ helix	trans	-73.7	-13.1	177.1	-177.8	0	0	0	0	112.7	D40 S44	D40-V42 PolarHBondContact O-N 3.38Å; D40-V42 VanDerWaalsContact OD1-CB 3.31Å; D40-V42 WeakPolarHBondContact OD1-CB 3.24Å; D40-V42 VanDerWaalsContact OD1-CG2 3.26Å; D40-V42 WeakPolarHBondContact OD1-CG2 3.26Å; D40-V42 PolarHBondContact OD1-N 3.37Å; V42-S44 VanDerWaalsContact C-N 3.28Å; V42-S44 PolarHBondContact O-N 2.96Å
43	C	50.4	Low	54.6	Low	123 Å²	123	124.3 Å²	124.3	83%	0.831	72%	0.721	S	S	*	*	G	3₁₀ helix	trans	-82.2	5.1	174.1	-91.3	0	0	0	0	115.3	D40 P41	D40-C43 PolarHBondContact O-N 3.3Å; P41-C43 PolarHBondContact O-N 3.08Å
44	S	48.6	Very low	54.6	Low	89 Å²	89	129.5 Å²	129.5	62%	0.622	75%	0.748	S	S	*	*			trans	-100.9	70.8	163.2	51.3	0	0	0	0	110	P41 V42 P46	P41-S44 PolarHBondContact O-N 3.05Å; P41-S44 PolarHBondContact O-OG 3.45Å; P41-S44 VanDerWaalsContact O-OG 3.08Å; V42-S44 VanDerWaalsContact C-N 3.28Å; V42-S44 PolarHBondContact O-N 2.96Å; S44-P46 WeakPolarHBondContact O-CD 3.14Å
45	T	50.7	Low	54.2	Low	114 Å²	114	129 Å²	129	70%	0.699	76%	0.755	S	S	*	*			trans	-69.8	114.1	151.9	44.7	0	0	0	0	106.5	N47	T45-N47 PolarHBondContact O-N 2.84Å; T45-N47 VanDerWaalsContact O-N 3.13Å
46	P	51.2	Low	54	Low	106 Å²	106	130.8 Å²	130.8	69%	0.688	76%	0.759	S	S	*	*			trans	-60.5	123.8	166.9	24.4	-29.9	0	0	0	106.3	S44 S48	S44-P46 WeakPolarHBondContact O-CD 3.14Å; P46-S48 PolarHBondContact O-N 2.71Å
47	N	46.8	Very low	53.8	Low	165 Å²	165	128 Å²	128	88%	0.882	76%	0.758	S	S	*	*			trans	-57.2	85.8	158.5	-87.6	-24.4	0	0	0	107	T45 G49	T45-N47 PolarHBondContact O-N 2.84Å; T45-N47 VanDerWaalsContact O-N 3.13Å; N47-G49 PolarHBondContact O-N 3.13Å
48	S	49.3	Very low	53.4	Low	111 Å²	111	122.8 Å²	122.8	78%	0.776	75%	0.754	S	S	*	*			trans	-69.1	78.1	158.5	-59	0	0	0	0	105.5	P46	P46-S48 PolarHBondContact O-N 2.71Å
49	G	42.3	Very low	52.7	Low	50 Å²	50	120.6 Å²	120.6	52%	0.515	76%	0.755	S	S	.	*			trans	-54.2	150.4	166.9	0	0	0	0	0	109.1	N47 S51	N47-G49 PolarHBondContact O-N 3.13Å; G49-S51 PolarHBondContact O-N 3.06Å
50	P	49.1	Very low	51.9	Low	125 Å²	125	122.9 Å²	122.9	81%	0.812	77%	0.765	S	S	*	*			trans	-64.1	116.3	-178	26.9	-32.2	0	0	0	108.7	S52	P50-S52 PolarHBondContact O-N 3.02Å
51	S	50.1	Low	51.2	Low	119 Å²	119	124.1 Å²	124.1	83%	0.832	78%	0.779	S	S	*	*			trans	-55.4	114.1	161.6	-70.7	0	0	0	0	107.2	G49 L53	G49-S51 PolarHBondContact O-N 3.06Å; S51-L53 PolarHBondContact O-N 3.17Å
52	S	51.1	Low	50.4	Low	108 Å²	108	126.2 Å²	126.2	76%	0.755	79%	0.791	S	S	*	*			trans	-55.5	132.8	-178.9	-72.7	0	0	0	0	110.7	P50 L54	P50-S52 PolarHBondContact O-N 3.02Å; S52-L54 PolarHBondContact O-N 3.44Å; S52-L54 VanDerWaalsContact O-N 3.17Å
53	L	48.1	Very low	49.7	Very low	179 Å²	179	127.3 Å²	127.3	94%	0.937	80%	0.8	S	S	*	*			trans	-70.5	96	163.3	-71.3	164.8	0	0	0	108.2	S51	S51-L53 PolarHBondContact O-N 3.17Å
54	L	59	Low	49.7	Very low	239 Å²	239	127.7 Å²	127.7	100%	1.251	80%	0.797	S	S	*	*			trans	-143.8	0	157.9	-82.8	175.2	0	0	0	109.1	S52	S52-L54 PolarHBondContact O-N 3.44Å; S52-L54 VanDerWaalsContact O-N 3.17Å

Retrieved 54 of 54 residues in 39.7 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).