A0A077ZN44_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZN44, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 104 aa.

						>A0A077ZN44_TRITR|A0A077ZN44
MALHVWHLFLWWDDRLSLRSLKRRWSHDLCLIALQIEDMNRASFSSPASAEERATPSASTGVWSVIKDDKKFQSTLDVTLQAGTLEITTKDDRLIIHVKHEENK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	37.3	Very low	44.2	Very low	244 Å²	244	171 Å²	171	100%	1.202	84%	0.835	S	S	*	*				0	124.3	0	-82.3	-177.4	163.5	0	0	108.3
2	A	51.7	Low	43.9	Very low	107 Å²	107	173.8 Å²	173.8	88%	0.884	83%	0.83	S	S	*	*			trans	34.5	96	161.3	0	0	0	0	0	118.4
3	L	41.8	Very low	44.3	Very low	165 Å²	165	168.8 Å²	168.8	86%	0.864	81%	0.811	S	S	*	*			trans	-102.7	139.6	160.4	-91.4	161.5	0	0	0	109.7
4	H	47.1	Very low	45.1	Very low	172 Å²	172	162.9 Å²	162.9	80%	0.796	79%	0.786	S	S	*	*			trans	-54.2	134.9	171.3	-67.1	-91.1	0	0	0	112.1
5	V	50.3	Low	45.6	Very low	129 Å²	129	165.7 Å²	165.7	78%	0.782	79%	0.785	S	S	*	*			trans	-114.5	105.8	169.7	-178.8	0	0	0	0	108.1	H7	V5-H7 PolarHBondContact O-N 3.03Å
6	W	37.5	Very low	45.9	Very low	223 Å²	223	162.8 Å²	162.8	85%	0.845	78%	0.775	S	S	*	*			trans	-71	115.4	172.4	-77.6	71.5	0	0	0	109.4
7	H	44.4	Very low	46.4	Very low	155 Å²	155	156.1 Å²	156.1	72%	0.718	75%	0.75	S	S	*	*			trans	-89.1	102.7	157.7	-107.9	-83.9	0	0	0	108.4	V5 F9	V5-H7 PolarHBondContact O-N 3.03Å; H7-F9 AromaticContact ND1-CD2 3.47Å; H7-F9 WeakPolarHBondContact ND1-CD2 3.16Å; H7-F9 AromaticContact ND1-CE2 3.72Å; H7-F9 PolarHBondContact O-N 3.05Å
8	L	46.5	Very low	46.7	Very low	143 Å²	143	153.6 Å²	153.6	75%	0.749	74%	0.74	S	S	*	*			trans	-57.5	90.6	151.8	-97.4	92.4	0	0	0	108
9	F	43.2	Very low	47.1	Very low	164 Å²	164	155.2 Å²	155.2	72%	0.719	74%	0.738	S	S	*	*			trans	-131.4	75.1	154	-94	-89.3	0	0	0	106.7	H7	H7-F9 AromaticContact ND1-CD2 3.47Å; H7-F9 WeakPolarHBondContact ND1-CD2 3.16Å; H7-F9 AromaticContact ND1-CE2 3.72Å; H7-F9 PolarHBondContact O-N 3.05Å
10	L	42.7	Very low	47.6	Very low	131 Å²	131	150.5 Å²	150.5	69%	0.686	72%	0.722	S	S	*	*				82.7	72.6	95.6	-80.6	153.6	0	0	0	110	W12	L10-W12 PolarHBondContact O-N 2.85Å
11	W	44.2	Very low	48	Very low	248 Å²	248	146.9 Å²	146.9	94%	0.939	71%	0.706	S	S	*	*			trans	-67	59.1	169.9	-169.3	53.1	0	0	0	112.3
12	W	40.3	Very low	48.9	Very low	205 Å²	205	143.1 Å²	143.1	78%	0.777	68%	0.683	S	S	*	*			trans	-142.6	83.1	163.4	-85.3	-20.8	0	0	0	110.1	L10 D14	L10-W12 PolarHBondContact O-N 2.85Å; W12-D14 PolarHBondContact O-N 3.43Å
13	D	48.9	Very low	49.3	Very low	109 Å²	109	146.9 Å²	146.9	58%	0.583	68%	0.675	S	S	*	*			trans	-71.1	84	152.7	-169.1	-5.5	0	0	0	107.7	R15 L16	D13-R15 PolarHBondContact O-N 2.73Å; D13-R15 PolarHBondContact OD1-N 2.76Å; D13-L16 PolarHBondContact O-N 2.85Å
14	D	55.4	Low	50.4	Low	85 Å²	85	147.5 Å²	147.5	46%	0.455	67%	0.665	S	S	.	*	H	α-helix	trans	-58	-13.2	-179.3	-84.8	-29.7	0	0	0	113.4	W12 S17 L18	W12-D14 PolarHBondContact O-N 3.43Å; D14-S17 WeakPolarHBondContact CA-OG 3.5Å; D14-S17 PolarHBondContact O-N 3.22Å; D14-S17 PolarHBondContact O-OG 2.88Å; D14-L18 WeakPolarHBondContact O-CB 3.33Å; D14-L18 WeakPolarHBondContact O-CD1 3.27Å; D14-L18 PolarHBondContact O-N 2.81Å
15	R	53.1	Low	51.2	Low	205 Å²	205	146.8 Å²	146.8	77%	0.774	66%	0.656	S	S	*	*	H	α-helix	trans	-75.1	-32.1	179.4	-63.2	-176.6	175.4	-163.9	-0.1	112.3	D13 R19	D13-R15 PolarHBondContact O-N 2.73Å; D13-R15 PolarHBondContact OD1-N 2.76Å; R15-R19 PolarHBondContact O-N 2.83Å
16	L	50.3	Low	52.1	Low	119 Å²	119	144 Å²	144	62%	0.623	64%	0.642	S	S	*	*	H	α-helix	trans	-74.4	-34.7	170.6	-71	176.7	0	0	0	111.1	D13 L18 R19 S20	D13-L16 PolarHBondContact O-N 2.85Å; L16-L18 VanDerWaalsContact C-N 3.33Å; L16-R19 PolarHBondContact O-N 2.8Å; L16-S20 WeakPolarHBondContact O-CB 3.4Å; L16-S20 PolarHBondContact O-N 3.15Å; L16-S20 PolarHBondContact O-OG 3.47Å
17	S	54.2	Low	53.8	Low	50 Å²	50	138.8 Å²	138.8	35%	0.35	63%	0.627	S	S	.	*	H	α-helix	trans	-62.8	-39.5	172.5	90.3	0	0	0	0	111	D14 S20 L21	D14-S17 WeakPolarHBondContact CA-OG 3.5Å; D14-S17 PolarHBondContact O-N 3.22Å; D14-S17 PolarHBondContact O-OG 2.88Å; S17-S20 WeakPolarHBondContact CA-OG 3.31Å; S17-S20 PolarHBondContact O-N 3.4Å; S17-S20 PolarHBondContact O-OG 3.34Å; S17-L21 WeakPolarHBondContact O-CA 3.38Å; S17-L21 WeakPolarHBondContact O-CB 3.45Å; S17-L21 PolarHBondContact O-N 3.38Å
18	L	51.7	Low	55.2	Low	110 Å²	110	135.3 Å²	135.3	58%	0.576	61%	0.614	S	S	*	*	H	α-helix	trans	-64	-41.1	174.4	-92.3	149.1	0	0	0	113	D14 L16 K22	D14-L18 WeakPolarHBondContact O-CB 3.33Å; D14-L18 WeakPolarHBondContact O-CD1 3.27Å; D14-L18 PolarHBondContact O-N 2.81Å; L16-L18 VanDerWaalsContact C-N 3.33Å; L18-K22 WeakPolarHBondContact O-CB 3.22Å; L18-K22 PolarHBondContact O-N 2.76Å
19	R	53.8	Low	56.6	Low	184 Å²	184	134 Å²	134	69%	0.694	61%	0.607	S	S	*	*	H	α-helix	trans	-68.5	-38.2	175	-97.2	-173.2	179.5	-174.9	1.1	112.3	R15 L16 R23	R15-R19 PolarHBondContact O-N 2.83Å; L16-R19 PolarHBondContact O-N 2.8Å; R19-R23 PolarHBondContact O-N 2.87Å; R19-R23 VanDerWaalsContact O-N 3.08Å
20	S	57.2	Low	58.2	Low	61 Å²	61	129.4 Å²	129.4	43%	0.427	60%	0.595	S	S	.	*	H	α-helix	trans	-73.6	-38.8	177.7	67.4	0	0	0	0	111.6	L16 S17 R23 R24	L16-S20 WeakPolarHBondContact O-CB 3.4Å; L16-S20 PolarHBondContact O-N 3.15Å; L16-S20 PolarHBondContact O-OG 3.47Å; S17-S20 WeakPolarHBondContact CA-OG 3.31Å; S17-S20 PolarHBondContact O-N 3.4Å; S17-S20 PolarHBondContact O-OG 3.34Å; S20-R23 PolarHBondContact O-N 2.94Å; S20-R24 WeakPolarHBondContact O-CB 3.44Å; S20-R24 WeakPolarHBondContact O-CG 3.35Å; S20-R24 PolarHBondContact O-N 3.25Å
21	L	56	Low	59.9	Low	75 Å²	75	127.2 Å²	127.2	39%	0.393	58%	0.583	S	S	.	*	H	α-helix	trans	-63.4	-44.5	172.8	-168.8	75	0	0	0	110.6	S17 R23 R24 W25	S17-L21 WeakPolarHBondContact O-CA 3.38Å; S17-L21 WeakPolarHBondContact O-CB 3.45Å; S17-L21 PolarHBondContact O-N 3.38Å; L21-R23 VanDerWaalsContact C-N 3.33Å; L21-R23 PolarHBondContact O-N 3.28Å; L21-R24 WeakPolarHBondContact O-CB 3.31Å; L21-R24 PolarHBondContact O-N 3.18Å; L21-R24 VanDerWaalsContact O-N 3.17Å; L21-W25 HydrophobicContact CD2-CZ2 3.97Å; L21-W25 HydrophobicContact CG-CZ2 4.32Å; L21-W25 WeakPolarHBondContact O-CB 2.98Å; L21-W25 VanDerWaalsContact O-CD1 3.31Å; L21-W25 PolarHBondContact O-N 2.96Å
22	K	57.4	Low	61.5	Low	166 Å²	166	119.4 Å²	119.4	72%	0.722	56%	0.559	S	S	*	*	H	α-helix	trans	-61.2	-40.5	175	-169.3	174.3	-175.1	177.7	0	111.8	L18 S26	L18-K22 WeakPolarHBondContact O-CB 3.22Å; L18-K22 PolarHBondContact O-N 2.76Å; K22-S26 PolarHBondContact O-N 3.01Å; K22-S26 PolarHBondContact O-OG 3.1Å
23	R	58.7	Low	63.3	Low	186 Å²	186	112.4 Å²	112.4	70%	0.702	55%	0.545	S	S	*	.	H	α-helix	trans	-66	-42.2	172.8	-83.3	-165.4	-121	166.8	-1.3	112.4	R19 S20 L21 S26 H27	R19-R23 PolarHBondContact O-N 2.87Å; R19-R23 VanDerWaalsContact O-N 3.08Å; S20-R23 PolarHBondContact O-N 2.94Å; L21-R23 VanDerWaalsContact C-N 3.33Å; L21-R23 PolarHBondContact O-N 3.28Å; R23-S26 WeakPolarHBondContact CA-OG 3.49Å; R23-S26 PolarHBondContact O-N 2.77Å; R23-S26 PolarHBondContact O-OG 3.19Å; R23-H27 PolarHBondContact O-N 2.84Å
24	R	65.9	Low	64.7	Low	177 Å²	177	112 Å²	112	67%	0.668	54%	0.542	S	S	*	.	H	α-helix	trans	-59.3	-50.8	175.4	-81.6	-175.1	169.5	-160.8	-3	110.9	S20 L21 S26 H27 D28	S20-R24 WeakPolarHBondContact O-CB 3.44Å; S20-R24 WeakPolarHBondContact O-CG 3.35Å; S20-R24 PolarHBondContact O-N 3.25Å; L21-R24 WeakPolarHBondContact O-CB 3.31Å; L21-R24 PolarHBondContact O-N 3.18Å; L21-R24 VanDerWaalsContact O-N 3.17Å; R24-S26 VanDerWaalsContact C-N 3.33Å; R24-S26 PolarHBondContact O-N 2.95Å; R24-H27 CarbonylContact O-C 3.6Å; R24-H27 WeakPolarHBondContact O-CA 3.48Å; R24-H27 WeakPolarHBondContact O-CB 3.35Å; R24-H27 PolarHBondContact O-N 2.92Å; R24-D28 VanDerWaalsContact O-CG 3.23Å; R24-D28 PolarHBondContact O-N 2.95Å
25	W	63.7	Low	65.7	Low	157 Å²	157	114.1 Å²	114.1	60%	0.595	55%	0.549	S	S	*	.	H	α-helix	trans	-61	-40.8	178.5	-70.2	11.7	0	0	0	112.2	L21 H27 D28 L29	L21-W25 HydrophobicContact CD2-CZ2 3.97Å; L21-W25 HydrophobicContact CG-CZ2 4.32Å; L21-W25 WeakPolarHBondContact O-CB 2.98Å; L21-W25 VanDerWaalsContact O-CD1 3.31Å; L21-W25 PolarHBondContact O-N 2.96Å; W25-H27 VanDerWaalsContact C-N 3.27Å; W25-H27 PolarHBondContact O-N 3.24Å; W25-D28 PolarHBondContact O-N 3.13Å; W25-L29 VanDerWaalsContact O-CB 3.29Å; W25-L29 WeakPolarHBondContact O-CB 3.28Å; W25-L29 WeakPolarHBondContact O-CG 3.35Å; W25-L29 PolarHBondContact O-N 3.41Å
26	S	69.6	Low	66.8	Low	71 Å²	71	108.7 Å²	108.7	50%	0.497	53%	0.534	S	S	.	.	H	α-helix	trans	-64.6	-32.7	175.1	59.4	0	0	0	0	112.8	K22 R23 R24 C30	K22-S26 PolarHBondContact O-N 3.01Å; K22-S26 PolarHBondContact O-OG 3.1Å; R23-S26 WeakPolarHBondContact CA-OG 3.49Å; R23-S26 PolarHBondContact O-N 2.77Å; R23-S26 PolarHBondContact O-OG 3.19Å; R24-S26 VanDerWaalsContact C-N 3.33Å; R24-S26 PolarHBondContact O-N 2.95Å; S26-C30 VanDerWaalsContact O-CB 3.28Å; S26-C30 WeakPolarHBondContact O-CB 3.32Å; S26-C30 PolarHBondContact O-N 3.04Å; S26-C30 VanDerWaalsContact O-N 3.13Å
27	H	72.4	Confident	68	Low	114 Å²	114	109.2 Å²	109.2	53%	0.528	53%	0.534	S	S	.	.	H	α-helix	trans	-73.5	-45.2	176.2	-165.2	60.5	0	0	0	111.3	R23 R24 W25 L29 C30 L31	R23-H27 PolarHBondContact O-N 2.84Å; R24-H27 CarbonylContact O-C 3.6Å; R24-H27 WeakPolarHBondContact O-CA 3.48Å; R24-H27 WeakPolarHBondContact O-CB 3.35Å; R24-H27 PolarHBondContact O-N 2.92Å; W25-H27 VanDerWaalsContact C-N 3.27Å; W25-H27 PolarHBondContact O-N 3.24Å; H27-L29 PolarHBondContact O-N 2.7Å; H27-C30 WeakPolarHBondContact O-CB 3.29Å; H27-C30 PolarHBondContact O-N 2.69Å; H27-C30 VanDerWaalsContact O-N 3.15Å; H27-L31 WeakPolarHBondContact O-CG 3.38Å; H27-L31 PolarHBondContact O-N 2.88Å
28	D	73.2	Confident	69	Low	81 Å²	81	112 Å²	112	43%	0.433	55%	0.545	S	S	.	.	H	α-helix	trans	-62.4	-43.4	178	-61.3	-23.4	0	0	0	111.1	R24 W25 C30 L31 I32	R24-D28 VanDerWaalsContact O-CG 3.23Å; R24-D28 PolarHBondContact O-N 2.95Å; W25-D28 PolarHBondContact O-N 3.13Å; D28-C30 VanDerWaalsContact C-N 3.32Å; D28-C30 PolarHBondContact O-N 2.85Å; D28-L31 PolarHBondContact O-N 3.32Å; D28-I32 VanDerWaalsContact O-CG1 3.24Å; D28-I32 WeakPolarHBondContact O-CG1 3.24Å; D28-I32 PolarHBondContact O-N 2.73Å
29	L	76.5	Confident	69.8	Low	115 Å²	115	112.9 Å²	112.9	60%	0.602	55%	0.548	S	S	*	.	H	α-helix	trans	-64.6	-35.5	174.8	-71.1	172.4	0	0	0	112.3	W25 H27 I32 A33	W25-L29 VanDerWaalsContact O-CB 3.29Å; W25-L29 WeakPolarHBondContact O-CB 3.28Å; W25-L29 WeakPolarHBondContact O-CG 3.35Å; W25-L29 PolarHBondContact O-N 3.41Å; H27-L29 PolarHBondContact O-N 2.7Å; L29-I32 PolarHBondContact O-N 2.79Å; L29-A33 VanDerWaalsContact O-CB 3.29Å; L29-A33 WeakPolarHBondContact O-CB 3.2Å; L29-A33 PolarHBondContact O-N 3.43Å
30	C	77.9	Confident	70.6	Confident	69 Å²	69	108 Å²	108	47%	0.466	54%	0.535	S	S	.	.	H	α-helix	trans	-67	-42	175	-169.4	0	0	0	0	111.2	S26 H27 D28 A33 L34	S26-C30 VanDerWaalsContact O-CB 3.28Å; S26-C30 WeakPolarHBondContact O-CB 3.32Å; S26-C30 PolarHBondContact O-N 3.04Å; S26-C30 VanDerWaalsContact O-N 3.13Å; H27-C30 WeakPolarHBondContact O-CB 3.29Å; H27-C30 PolarHBondContact O-N 2.69Å; H27-C30 VanDerWaalsContact O-N 3.15Å; D28-C30 VanDerWaalsContact C-N 3.32Å; D28-C30 PolarHBondContact O-N 2.85Å; C30-A33 PolarHBondContact O-N 2.8Å; C30-L34 WeakPolarHBondContact O-CB 3.05Å; C30-L34 PolarHBondContact O-N 3.24Å
31	L	77	Confident	71.1	Confident	85 Å²	85	114.1 Å²	114.1	45%	0.445	55%	0.549	S	S	.	.	H	α-helix	trans	-64.7	-41	175	-68.8	174.7	0	0	0	112.1	H27 D28 L34 Q35	H27-L31 WeakPolarHBondContact O-CG 3.38Å; H27-L31 PolarHBondContact O-N 2.88Å; D28-L31 PolarHBondContact O-N 3.32Å; L31-L34 PolarHBondContact O-N 3.12Å; L31-Q35 PolarHBondContact O-N 3.45Å
32	I	78.7	Confident	71.5	Confident	83 Å²	83	113.6 Å²	113.6	43%	0.426	56%	0.555	S	S	.	*	H	α-helix	trans	-64.6	-43.3	174.6	-67.7	163.6	0	0	0	110.5	D28 L29 L34 Q35 I36	D28-I32 VanDerWaalsContact O-CG1 3.24Å; D28-I32 WeakPolarHBondContact O-CG1 3.24Å; D28-I32 PolarHBondContact O-N 2.73Å; L29-I32 PolarHBondContact O-N 2.79Å; I32-L34 PolarHBondContact O-N 3.44Å; I32-Q35 PolarHBondContact O-N 2.89Å; I32-I36 HydrophobicContact CG2-CD1 3.78Å; I32-I36 HydrophobicContact CG2-CG1 4.4Å; I32-I36 VanDerWaalsContact O-CG1 3.29Å; I32-I36 WeakPolarHBondContact O-CG1 3.47Å; I32-I36 PolarHBondContact O-N 3.41Å
33	A	77.8	Confident	71.7	Confident	58 Å²	58	110.1 Å²	110.1	48%	0.479	55%	0.552	S	S	.	*	H	α-helix	trans	-62.2	-43	177.2	0	0	0	0	0	111.7	L29 C30 I36 E37	L29-A33 VanDerWaalsContact O-CB 3.29Å; L29-A33 WeakPolarHBondContact O-CB 3.2Å; L29-A33 PolarHBondContact O-N 3.43Å; C30-A33 PolarHBondContact O-N 2.8Å; A33-I36 PolarHBondContact O-N 2.79Å; A33-E37 WeakPolarHBondContact O-CB 3.47Å; A33-E37 PolarHBondContact O-N 2.86Å
34	L	78.1	Confident	71.7	Confident	101 Å²	101	109.4 Å²	109.4	53%	0.529	55%	0.554	S	S	.	*	H	α-helix	trans	-61.1	-42.2	172.7	-97.7	145.5	0	0	0	112.2	C30 L31 I32 E37 D38	C30-L34 WeakPolarHBondContact O-CB 3.05Å; C30-L34 PolarHBondContact O-N 3.24Å; L31-L34 PolarHBondContact O-N 3.12Å; I32-L34 PolarHBondContact O-N 3.44Å; L34-E37 PolarHBondContact O-N 3.4Å; L34-D38 WeakPolarHBondContact O-CB 3.42Å; L34-D38 PolarHBondContact O-N 3.49Å
35	Q	76	Confident	70.9	Confident	130 Å²	130	104.4 Å²	104.4	61%	0.607	55%	0.547	S	S	*	.	H	α-helix	trans	-63.6	-42	175.1	-83.1	-175.1	-24.8	0	0	112.2	L31 I32 D38 M39	L31-Q35 PolarHBondContact O-N 3.45Å; I32-Q35 PolarHBondContact O-N 2.89Å; Q35-D38 PolarHBondContact O-N 3.5Å; Q35-M39 WeakPolarHBondContact O-CB 3.28Å; Q35-M39 VanDerWaalsContact O-CG 3.22Å; Q35-M39 WeakPolarHBondContact O-CG 3.42Å; Q35-M39 PolarHBondContact O-N 2.84Å
36	I	76.5	Confident	70.3	Confident	90 Å²	90	101.6 Å²	101.6	46%	0.462	55%	0.551	S	S	.	*	H	α-helix	trans	-65.8	-41.4	177	-66.8	165.9	0	0	0	110.3	I32 A33 M39 N40	I32-I36 HydrophobicContact CG2-CD1 3.78Å; I32-I36 HydrophobicContact CG2-CG1 4.4Å; I32-I36 VanDerWaalsContact O-CG1 3.29Å; I32-I36 WeakPolarHBondContact O-CG1 3.47Å; I32-I36 PolarHBondContact O-N 3.41Å; A33-I36 PolarHBondContact O-N 2.79Å; I36-M39 PolarHBondContact O-N 3.21Å; I36-N40 VanDerWaalsContact O-CB 3.28Å; I36-N40 WeakPolarHBondContact O-CB 3.29Å; I36-N40 PolarHBondContact O-N 3.23Å; I36-N40 PolarHBondContact O-ND2 2.88Å
37	E	75.1	Confident	69.6	Low	131 Å²	131	103.9 Å²	103.9	61%	0.612	56%	0.564	S	S	*	*	H	α-helix	trans	-63.6	-42	175.5	-168.9	177.3	177.5	0	0	111.7	A33 L34 N40 R41	A33-E37 WeakPolarHBondContact O-CB 3.47Å; A33-E37 PolarHBondContact O-N 2.86Å; L34-E37 PolarHBondContact O-N 3.4Å; E37-N40 PolarHBondContact O-N 2.9Å; E37-R41 VanDerWaalsContact O-CB 3.28Å; E37-R41 WeakPolarHBondContact O-CB 3.42Å; E37-R41 PolarHBondContact O-N 2.99Å
38	D	75.1	Confident	68.3	Low	109 Å²	109	102.9 Å²	102.9	58%	0.583	58%	0.575	S	S	*	*	H	α-helix	trans	-67.4	-42.6	177	-164.1	43.1	0	0	0	112	L34 Q35 N40 R41 A42	L34-D38 WeakPolarHBondContact O-CB 3.42Å; L34-D38 PolarHBondContact O-N 3.49Å; Q35-D38 PolarHBondContact O-N 3.5Å; D38-N40 PolarHBondContact O-N 3.49Å; D38-R41 PolarHBondContact O-N 2.93Å; D38-A42 WeakPolarHBondContact O-CB 3.4Å; D38-A42 PolarHBondContact O-N 2.85Å
39	M	69.8	Low	67.1	Low	128 Å²	128	104.8 Å²	104.8	63%	0.631	60%	0.595	S	S	*	*	H	α-helix	trans	-61.5	-43.4	172.7	-75	177	68.5	0	0	111.9	Q35 I36 R41 A42 S43	Q35-M39 WeakPolarHBondContact O-CB 3.28Å; Q35-M39 VanDerWaalsContact O-CG 3.22Å; Q35-M39 WeakPolarHBondContact O-CG 3.42Å; Q35-M39 PolarHBondContact O-N 2.84Å; I36-M39 PolarHBondContact O-N 3.21Å; M39-R41 VanDerWaalsContact C-N 3.35Å; M39-A42 PolarHBondContact O-N 2.89Å; M39-S43 WeakPolarHBondContact O-CB 3.28Å; M39-S43 PolarHBondContact O-N 3.32Å; M39-S43 PolarHBondContact O-OG 3.38Å
40	N	69.9	Low	65.7	Low	80 Å²	80	103.6 Å²	103.6	43%	0.428	60%	0.602	S	S	.	*	H	α-helix	trans	-63.3	-44.6	175.2	-75.9	-24.9	0	0	0	110.1	I36 E37 D38 A42 S43 F44	I36-N40 VanDerWaalsContact O-CB 3.28Å; I36-N40 WeakPolarHBondContact O-CB 3.29Å; I36-N40 PolarHBondContact O-N 3.23Å; I36-N40 PolarHBondContact O-ND2 2.88Å; E37-N40 PolarHBondContact O-N 2.9Å; D38-N40 PolarHBondContact O-N 3.49Å; N40-A42 VanDerWaalsContact C-N 3.34Å; N40-A42 PolarHBondContact O-N 2.88Å; N40-S43 CarbonylContact O-C 3.55Å; N40-S43 WeakPolarHBondContact O-CB 3.29Å; N40-S43 PolarHBondContact O-N 3.5Å; N40-S43 VanDerWaalsContact O-N 3.12Å; N40-F44 HydrophobicContact CB-CD2 4.19Å; N40-F44 HydrophobicContact CB-CE2 4.19Å; N40-F44 WeakPolarHBondContact O-CB 3.4Å; N40-F44 WeakPolarHBondContact O-CD2 3.47Å; N40-F44 WeakPolarHBondContact O-CG 3.42Å; N40-F44 PolarHBondContact O-N 3.38Å
41	R	67.6	Low	63.9	Low	191 Å²	191	109.4 Å²	109.4	72%	0.721	62%	0.622	S	S	*	*	H	α-helix	trans	-64.5	-37.4	178.2	-167.1	176.4	-179.1	-162.1	-0.3	112.3	E37 D38 M39 S43 F44 S45	E37-R41 VanDerWaalsContact O-CB 3.28Å; E37-R41 WeakPolarHBondContact O-CB 3.42Å; E37-R41 PolarHBondContact O-N 2.99Å; D38-R41 PolarHBondContact O-N 2.93Å; M39-R41 VanDerWaalsContact C-N 3.35Å; R41-S43 VanDerWaalsContact C-N 3.33Å; R41-F44 CarbonylContact O-C 3.58Å; R41-F44 PolarHBondContact O-N 2.87Å; R41-S45 WeakPolarHBondContact O-CB 3.49Å; R41-S45 PolarHBondContact O-N 2.9Å; R41-S45 PolarHBondContact O-OG 3.43Å
42	A	65.8	Low	62.2	Low	64 Å²	64	114.5 Å²	114.5	53%	0.529	64%	0.644	S	S	.	*	H	α-helix	trans	-67.3	-34.4	172.2	0	0	0	0	0	112.1	D38 M39 N40 S45	D38-A42 WeakPolarHBondContact O-CB 3.4Å; D38-A42 PolarHBondContact O-N 2.85Å; M39-A42 PolarHBondContact O-N 2.89Å; N40-A42 VanDerWaalsContact C-N 3.34Å; N40-A42 PolarHBondContact O-N 2.88Å; A42-S45 WeakPolarHBondContact CA-OG 3.37Å; A42-S45 PolarHBondContact O-OG 2.87Å
43	S	61.4	Low	60.3	Low	93 Å²	93	121.4 Å²	121.4	65%	0.65	66%	0.664	S	S	*	*	H	α-helix	trans	-74.1	-31.8	176.2	-55	0	0	0	0	112.4	M39 N40 R41	M39-S43 WeakPolarHBondContact O-CB 3.28Å; M39-S43 PolarHBondContact O-N 3.32Å; M39-S43 PolarHBondContact O-OG 3.38Å; N40-S43 CarbonylContact O-C 3.55Å; N40-S43 WeakPolarHBondContact O-CB 3.29Å; N40-S43 PolarHBondContact O-N 3.5Å; N40-S43 VanDerWaalsContact O-N 3.12Å; R41-S43 VanDerWaalsContact C-N 3.33Å
44	F	58.2	Low	58.7	Low	170 Å²	170	123 Å²	123	75%	0.746	68%	0.677	S	S	*	*	H	α-helix	trans	-94.2	-12.6	177.9	-69.3	-62.6	0	0	0	113.8	N40 R41 S46	N40-F44 HydrophobicContact CB-CD2 4.19Å; N40-F44 HydrophobicContact CB-CE2 4.19Å; N40-F44 WeakPolarHBondContact O-CB 3.4Å; N40-F44 WeakPolarHBondContact O-CD2 3.47Å; N40-F44 WeakPolarHBondContact O-CG 3.42Å; N40-F44 PolarHBondContact O-N 3.38Å; R41-F44 CarbonylContact O-C 3.58Å; R41-F44 PolarHBondContact O-N 2.87Å; F44-S46 PolarHBondContact O-N 3.34Å
45	S	47.8	Very low	56.8	Low	73 Å²	73	124.3 Å²	124.3	51%	0.51	69%	0.69	S	S	.	*	S	Bend	trans	-67.2	95.9	163	59.5	0	0	0	0	106.2	R41 A42	R41-S45 WeakPolarHBondContact O-CB 3.49Å; R41-S45 PolarHBondContact O-N 2.9Å; R41-S45 PolarHBondContact O-OG 3.43Å; A42-S45 WeakPolarHBondContact CA-OG 3.37Å; A42-S45 PolarHBondContact O-OG 2.87Å
46	S	52.9	Low	55.1	Low	98 Å²	98	123.8 Å²	123.8	69%	0.685	70%	0.697	S	S	*	*			trans	-38.6	128.2	169.1	179.8	0	0	0	0	107.8	F44 A48	F44-S46 PolarHBondContact O-N 3.34Å; S46-A48 VanDerWaalsContact C-N 3.28Å; S46-A48 PolarHBondContact O-N 2.9Å
47	P	53.3	Low	53.4	Low	119 Å²	119	125.4 Å²	125.4	77%	0.773	72%	0.717	S	S	*	*			trans	-58.9	97.9	-179.1	23.8	-32.5	0	0	0	107.6	S49	P47-S49 VanDerWaalsContact C-N 3.34Å; P47-S49 PolarHBondContact O-N 3.28Å
48	A	45.3	Very low	51.9	Low	92 Å²	92	123 Å²	123	76%	0.76	72%	0.719	S	S	*	*			trans	-64	109.9	159.9	0	0	0	0	0	103.4	S46 A50	S46-A48 VanDerWaalsContact C-N 3.28Å; S46-A48 PolarHBondContact O-N 2.9Å; A48-A50 PolarHBondContact O-N 3.15Å
49	S	48.4	Very low	50.4	Low	121 Å²	121	123.3 Å²	123.3	85%	0.846	73%	0.73	S	S	*	*			trans	-38.8	106.9	-178	59.2	0	0	0	0	111.4	P47	P47-S49 VanDerWaalsContact C-N 3.34Å; P47-S49 PolarHBondContact O-N 3.28Å
50	A	46.2	Very low	49.4	Very low	91 Å²	91	123.3 Å²	123.3	75%	0.752	74%	0.737	S	S	*	*			trans	-134.1	87.7	167.2	0	0	0	0	0	106.8	A48	A48-A50 PolarHBondContact O-N 3.15Å
51	E	40.3	Very low	48.3	Very low	190 Å²	190	121.1 Å²	121.1	89%	0.888	73%	0.734	S	S	*	*			trans	8.2	122.6	153.1	-149	165.5	-178.2	0	0	117.1	R53	E51-R53 PolarHBondContact O-N 3.13Å
52	E	42.3	Very low	47.8	Very low	192 Å²	192	116.9 Å²	116.9	90%	0.897	73%	0.729	S	S	*	*			trans	-45.9	91.6	175.9	-167.6	175.6	-157.2	0	0	112.7	A54	E52-A54 PolarHBondContact O-N 2.88Å
53	R	38.8	Very low	47.1	Very low	229 Å²	229	122.3 Å²	122.3	86%	0.864	74%	0.736	S	S	*	*			trans	-82.7	98.2	163.7	-148.3	-178.6	-156.9	174.4	6.4	107.7	E51 T55	E51-R53 PolarHBondContact O-N 3.13Å; R53-T55 PolarHBondContact O-N 3.44Å
54	A	43.3	Very low	47	Very low	90 Å²	90	120.6 Å²	120.6	74%	0.744	72%	0.724	S	S	*	*			trans	-53.8	94.9	171.6	0	0	0	0	0	110.8	E52	E52-A54 PolarHBondContact O-N 2.88Å
55	T	39.6	Very low	47.1	Very low	129 Å²	129	115.9 Å²	115.9	79%	0.791	71%	0.709	S	S	*	*			trans	-86.5	118.6	159	34.5	0	0	0	0	107.9	R53	R53-T55 PolarHBondContact O-N 3.44Å
56	P	38.8	Very low	47.7	Very low	119 Å²	119	116.6 Å²	116.6	77%	0.773	71%	0.706	S	S	*	*			trans	-77.8	143.4	-178.7	30.6	-31.2	0	0	0	111.1
57	S	41.1	Very low	47.6	Very low	125 Å²	125	119.5 Å²	119.5	87%	0.874	71%	0.706	S	S	*	*			trans	72.2	77.8	156.7	-147.9	0	0	0	0	117.8
58	A	43.1	Very low	47.8	Very low	80 Å²	80	118.8 Å²	118.8	66%	0.661	70%	0.696	S	S	*	*	S	Bend	trans	-146.9	131.5	134.8	0	0	0	0	0	106.8	T60	A58-T60 PolarHBondContact O-N 3.42Å; A58-T60 PolarHBondContact O-OG1 3.4Å
59	S	44.4	Very low	49	Very low	116 Å²	116	122.4 Å²	122.4	81%	0.811	70%	0.703	S	S	*	*			trans	-47	95.4	-179.3	53.7	0	0	0	0	111.1	G61	S59-G61 PolarHBondContact O-N 3.47Å
60	T	48.8	Very low	50	Low	127 Å²	127	126.2 Å²	126.2	78%	0.779	70%	0.704	S	S	*	*			trans	-90	83.9	178.7	-56.7	0	0	0	0	106.1	A58 V62	A58-T60 PolarHBondContact O-N 3.42Å; A58-T60 PolarHBondContact O-OG1 3.4Å; T60-V62 PolarHBondContact O-N 2.83Å
61	G	46.1	Very low	50.9	Low	34 Å²	34	129.4 Å²	129.4	35%	0.351	70%	0.701	S	S	.	*	P	Polyproline II helix	trans	-65.8	124.2	168.9	0	0	0	0	0	108.6	S59 W63 D77	S59-G61 PolarHBondContact O-N 3.47Å; G61-W63 PolarHBondContact O-N 2.99Å; G61-D77 WeakPolarHBondContact CA-O 3.49Å
62	V	57.2	Low	52.1	Low	103 Å²	103	127.8 Å²	127.8	62%	0.624	69%	0.691	S	S	*	*	P	Polyproline II helix	trans	-76.8	118.1	171.7	180	0	0	0	0	107.1	T60	T60-V62 PolarHBondContact O-N 2.83Å
63	W	52	Low	53.3	Low	178 Å²	178	124.6 Å²	124.6	67%	0.674	68%	0.676	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-102.3	121.9	173.7	-175	31.9	0	0	0	109.4	G61 V65 S74	G61-W63 PolarHBondContact O-N 2.99Å; W63-V65 HydrophobicContact CD2-CG2 3.93Å; W63-V65 HydrophobicContact CG-CG2 4.45Å; W63-V65 HydrophobicContact CH2-CG2 4.05Å; W63-V65 HydrophobicContact CZ2-CG2 3.32Å; W63-S74 PolarHBondContact NE1-OG 3.42Å; W63-S74 VanDerWaalsContact NE1-OG 3.13Å
64	S	60	Low	54.7	Low	57 Å²	57	116.8 Å²	116.8	40%	0.399	66%	0.657	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-118.4	133.1	167.6	61.5	0	0	0	0	109.4	S74 T75	S64-S74 WeakPolarHBondContact O-CA 3.5Å; S64-T75 PolarHBondContact N-O 3.3Å; S64-T75 PolarHBondContact O-N 3.08Å; S64-T75 VanDerWaalsContact O-N 3.15Å
65	V	59	Low	56.2	Low	71 Å²	71	115.8 Å²	115.8	43%	0.43	64%	0.642	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-113.3	111.6	177.3	-177.9	0	0	0	0	107.6	W63	W63-V65 HydrophobicContact CD2-CG2 3.93Å; W63-V65 HydrophobicContact CG-CG2 4.45Å; W63-V65 HydrophobicContact CH2-CG2 4.05Å; W63-V65 HydrophobicContact CZ2-CG2 3.32Å
66	I	61.2	Low	57.9	Low	88 Å²	88	113.9 Å²	113.9	45%	0.451	63%	0.626	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-90.7	117	168.2	-57.3	175.9	0	0	0	106.7	Q73	I66-Q73 PolarHBondContact N-O 3Å; I66-Q73 PolarHBondContact O-N 3.01Å
67	K	50.9	Low	59.6	Low	159 Å²	159	113.9 Å²	113.9	69%	0.691	62%	0.619	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-99.2	92	178.5	-173.1	-177.9	-179	-173.3	0	108.8	F72	K67-F72 HydrophobicContact CD-CE1 4.45Å; K67-F72 HydrophobicContact CG-CD1 4.46Å; K67-F72 HydrophobicContact CG-CE1 3.92Å
68	D	57.5	Low	61	Low	104 Å²	104	110.8 Å²	110.8	56%	0.556	60%	0.595	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-93.3	144.3	160.9	-76.6	-22.9	0	0	0	108.6	K70 K71	D68-K70 PolarHBondContact O-N 3.38Å; D68-K71 PolarHBondContact N-O 2.8Å; D68-K71 CarbonylContact O-C 3.46Å; D68-K71 PolarHBondContact O-N 3.34Å; D68-K71 VanDerWaalsContact O-O 3.06Å
69	D	71	Confident	62.5	Low	168 Å²	168	113.5 Å²	113.5	90%	0.898	60%	0.604	S	S	*	*	T	Hydrogen-bonded Turn	trans	-53.4	-14.6	-172.6	-69.5	-32.2	0	0	0	115.4
70	K	69.6	Low	63.7	Low	200 Å²	200	111.1 Å²	111.1	87%	0.87	58%	0.581	S	S	*	*	T	Hydrogen-bonded Turn	trans	-125.5	-4.7	179.2	-64.5	-175.6	-180	179.7	0	114.7	D68	D68-K70 PolarHBondContact O-N 3.38Å
71	K	63.9	Low	64.8	Low	158 Å²	158	113.7 Å²	113.7	69%	0.687	59%	0.585	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-147.4	122.1	-174	-65.3	-173.8	-179.9	-179	0	110.2	D68	D68-K71 PolarHBondContact N-O 2.8Å; D68-K71 CarbonylContact O-C 3.46Å; D68-K71 PolarHBondContact O-N 3.34Å; D68-K71 VanDerWaalsContact O-O 3.06Å
72	F	65.7	Low	65.9	Low	157 Å²	157	116 Å²	116	69%	0.689	60%	0.6	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-93.3	110.7	165.2	-64	-84	0	0	0	107.4	K67	K67-F72 HydrophobicContact CD-CE1 4.45Å; K67-F72 HydrophobicContact CG-CD1 4.46Å; K67-F72 HydrophobicContact CG-CE1 3.92Å
73	Q	68.2	Low	66.6	Low	124 Å²	124	113 Å²	113	58%	0.579	59%	0.59	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-101.6	117.6	168.1	-172.6	172.4	-1.3	0	0	107.6	I66	I66-Q73 PolarHBondContact N-O 3Å; I66-Q73 PolarHBondContact O-N 3.01Å
74	S	67.2	Low	67.8	Low	66 Å²	66	109.2 Å²	109.2	46%	0.462	59%	0.587	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-110.3	121.5	171.1	-74	0	0	0	0	108.4	W63 S64	W63-S74 PolarHBondContact NE1-OG 3.42Å; W63-S74 VanDerWaalsContact NE1-OG 3.13Å; S64-S74 WeakPolarHBondContact O-CA 3.5Å
75	T	74.7	Confident	68.7	Low	69 Å²	69	110 Å²	110	42%	0.423	59%	0.586	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-99.4	126.7	172.1	-54.7	0	0	0	0	107.6	S64	S64-T75 PolarHBondContact N-O 3.3Å; S64-T75 PolarHBondContact O-N 3.08Å; S64-T75 VanDerWaalsContact O-N 3.15Å
76	L	74.9	Confident	69.8	Low	88 Å²	88	110.3 Å²	110.3	46%	0.461	58%	0.583	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-120.2	114	172.6	-178.1	73.1	0	0	0	107.6	V78 I96	L76-V78 HydrophobicContact CD1-CG2 4.34Å; L76-V78 HydrophobicContact CD2-CG2 3.57Å; L76-V78 HydrophobicContact CG-CG2 3.56Å; L76-I96 HydrophobicContact CD2-CD1 3.54Å
77	D	74.8	Confident	70.9	Confident	119 Å²	119	111 Å²	111	64%	0.636	59%	0.586	S	S	*	*			trans	-94.3	120.7	173.9	-153.7	-7	0	0	0	109	G61	G61-D77 WeakPolarHBondContact CA-O 3.49Å
78	V	71.2	Confident	72.6	Confident	60 Å²	60	105.8 Å²	105.8	36%	0.364	57%	0.568	S	S	.	*			trans	-131.5	116.9	-177.1	-168.8	0	0	0	0	109.9	L76 L80	L76-V78 HydrophobicContact CD1-CG2 4.34Å; L76-V78 HydrophobicContact CD2-CG2 3.57Å; L76-V78 HydrophobicContact CG-CG2 3.56Å; V78-L80 HydrophobicContact CG1-CD2 3.62Å; V78-L80 HydrophobicContact CG1-CG 3.96Å
79	T	73.8	Confident	73.9	Confident	137 Å²	137	106.3 Å²	106.3	84%	0.84	58%	0.575	S	S	*	*			trans	-86.2	110	170	-38.9	0	0	0	0	109.1
80	L	70.6	Confident	74.7	Confident	66 Å²	66	104.5 Å²	104.5	35%	0.346	56%	0.559	S	S	.	*			trans	-100	134.1	176.3	-63	176.2	0	0	0	110.7	V78 A82 L85 V98	V78-L80 HydrophobicContact CG1-CD2 3.62Å; V78-L80 HydrophobicContact CG1-CG 3.96Å; L80-A82 PolarHBondContact O-N 3.2Å; L80-L85 HydrophobicContact CD1-CB 4.04Å; L80-L85 HydrophobicContact CD1-CD1 3.53Å; L80-L85 HydrophobicContact CD1-CG 4.39Å; L80-V98 HydrophobicContact CD1-CB 4.49Å; L80-V98 HydrophobicContact CD1-CG1 3.94Å; L80-V98 HydrophobicContact CD1-CG2 3.74Å; L80-V98 HydrophobicContact CD2-CG1 4.17Å; L80-V98 HydrophobicContact CD2-CG2 3.89Å; L80-V98 HydrophobicContact CG-CG2 4.5Å
81	Q	70.7	Confident	75.6	Confident	182 Å²	182	100.9 Å²	100.9	85%	0.85	55%	0.55	S	S	*	.	S	Bend	trans	-75.5	105.8	164.9	-73.2	-171.9	-0.7	0	0	108	H100	Q81-H100 PolarHBondContact O-ND1 3.17Å
82	A	69.1	Low	76.4	Confident	81 Å²	81	102 Å²	102	67%	0.669	56%	0.563	S	S	*	*	S	Bend	trans	33.5	99.5	172.9	0	0	0	0	0	115.4	L80 H100	L80-A82 PolarHBondContact O-N 3.2Å; A82-H100 PolarHBondContact O-CE1 2.77Å; A82-H100 PolarHBondContact O-ND1 2.81Å
83	G	72.4	Confident	77.2	Confident	40 Å²	40	103.6 Å²	103.6	41%	0.412	56%	0.564	S	S	.	*			trans	-170.9	165.5	174.3	0	0	0	0	0	111.5	K99	G83-K99 CarbonylContact C-O 3.57Å; G83-K99 WeakPolarHBondContact CA-O 3.18Å
84	T	76.8	Confident	77.9	Confident	99 Å²	99	103.1 Å²	103.1	61%	0.607	57%	0.565	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-88.1	124.1	170.6	-55.5	0	0	0	0	108.5	K99	T84-K99 PolarHBondContact N-O 2.85Å; T84-K99 PolarHBondContact O-N 2.72Å
85	L	79.9	Confident	78.7	Confident	73 Å²	73	102.7 Å²	102.7	38%	0.382	56%	0.557	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-94.1	125.9	173.9	-179.7	132.4	0	0	0	109.3	L80 I87 I96 H97 V98	L80-L85 HydrophobicContact CD1-CB 4.04Å; L80-L85 HydrophobicContact CD1-CD1 3.53Å; L80-L85 HydrophobicContact CD1-CG 4.39Å; L85-I87 HydrophobicContact CD2-CD1 3.6Å; L85-I87 HydrophobicContact CD2-CG1 3.33Å; L85-I87 HydrophobicContact CG-CG1 4.36Å; L85-I96 HydrophobicContact CD1-CG2 3.53Å; L85-I96 HydrophobicContact CG-CG2 3.98Å; L85-H97 WeakPolarHBondContact CA-O 3.47Å; L85-V98 HydrophobicContact CD1-CG2 4.34Å
86	E	80.7	Confident	79	Confident	78 Å²	78	102.7 Å²	102.7	36%	0.364	55%	0.554	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-114.9	118.7	176.6	178.7	175.6	-176.7	0	0	108.4	T88 H97 K99	E86-T88 HydrophobicContact CG-CG2 4.16Å; E86-H97 HydrophobicContact CB-CB 4.2Å; E86-H97 PolarHBondContact N-O 3.34Å; E86-H97 PolarHBondContact O-N 2.94Å; E86-K99 VanDerWaalsContact OE2-CE 3.31Å; E86-K99 WeakPolarHBondContact OE2-CE 3.46Å; E86-K99 IonicContact OE2-NZ 2.76Å; E86-K99 PolarHBondContact OE2-NZ 3.32Å
87	I	84.8	Confident	79.3	Confident	102 Å²	102	103 Å²	103	52%	0.523	55%	0.553	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-104.5	124.9	177.3	-53.1	178.3	0	0	0	107.7	L85 L94	L85-I87 HydrophobicContact CD2-CD1 3.6Å; L85-I87 HydrophobicContact CD2-CG1 3.33Å; L85-I87 HydrophobicContact CG-CG1 4.36Å; I87-L94 HydrophobicContact CG2-CD1 3.48Å; I87-L94 VanDerWaalsContact CG2-CD1 3.48Å; I87-L94 HydrophobicContact CG2-CG 4.24Å
88	T	86.9	Confident	79.5	Confident	50 Å²	50	100.8 Å²	100.8	31%	0.307	54%	0.544	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-128.2	155.1	173.3	61.6	0	0	0	0	110.3	E86 I95	E86-T88 HydrophobicContact CG-CG2 4.16Å; T88-I95 PolarHBondContact N-O 3.25Å; T88-I95 PolarHBondContact O-N 3.2Å
89	T	85.2	Confident	79.8	Confident	115 Å²	115	103.6 Å²	103.6	71%	0.706	55%	0.551	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-120.5	126.2	174.9	54	0	0	0	0	109.1	R93 L94	T89-R93 WeakPolarHBondContact CA-O 3.5Å; T89-L94 HydrophobicContact CG2-CD1 3.76Å
90	K	87.6	Confident	79.9	Confident	131 Å²	131	101.9 Å²	101.9	57%	0.57	53%	0.533	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-145.5	136	177.9	-169.8	-174	173.3	-176.3	0	110.2	D92 R93 I95	K90-D92 VanDerWaalsContact C-N 3.3Å; K90-D92 PolarHBondContact O-N 2.87Å; K90-R93 PolarHBondContact N-O 3.22Å; K90-R93 WeakPolarHBondContact O-CA 3.44Å; K90-R93 VanDerWaalsContact O-CB 3.31Å; K90-R93 WeakPolarHBondContact O-CB 3.47Å; K90-R93 PolarHBondContact O-N 2.98Å; K90-I95 HydrophobicContact CB-CD1 4.1Å
91	D	88.3	Confident	79.7	Confident	124 Å²	124	106.5 Å²	106.5	66%	0.663	55%	0.553	S	S	*	*	T	Hydrogen-bonded Turn	trans	50.8	46.9	175.9	-51.6	-38	0	0	0	112.9	R93	D91-R93 PolarHBondContact O-N 3.39Å; D91-R93 VanDerWaalsContact O-N 3.1Å
92	D	81.2	Confident	79.6	Confident	182 Å²	182	105.6 Å²	105.6	97%	0.973	55%	0.549	S	S	*	.	T	Hydrogen-bonded Turn	trans	59.2	16.2	-175.2	-55.9	-38.2	0	0	0	115.3	K90	K90-D92 VanDerWaalsContact C-N 3.3Å; K90-D92 PolarHBondContact O-N 2.87Å
93	R	82.9	Confident	79.4	Confident	189 Å²	189	109.2 Å²	109.2	71%	0.713	56%	0.557	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-109.2	136.2	175.7	-59.9	174.8	-179.3	-163.9	-1.6	110.7	T89 K90 D91	T89-R93 WeakPolarHBondContact CA-O 3.5Å; K90-R93 PolarHBondContact N-O 3.22Å; K90-R93 WeakPolarHBondContact O-CA 3.44Å; K90-R93 VanDerWaalsContact O-CB 3.31Å; K90-R93 WeakPolarHBondContact O-CB 3.47Å; K90-R93 PolarHBondContact O-N 2.98Å; D91-R93 PolarHBondContact O-N 3.39Å; D91-R93 VanDerWaalsContact O-N 3.1Å
94	L	81.9	Confident	78.4	Confident	114 Å²	114	120.3 Å²	120.3	60%	0.597	59%	0.594	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-84	124.1	166.3	-170.5	71.7	0	0	0	108.5	I87 T89 I96	I87-L94 HydrophobicContact CG2-CD1 3.48Å; I87-L94 VanDerWaalsContact CG2-CD1 3.48Å; I87-L94 HydrophobicContact CG2-CG 4.24Å; T89-L94 HydrophobicContact CG2-CD1 3.76Å; L94-I96 HydrophobicContact CD2-CD1 4.45Å; L94-I96 HydrophobicContact CG-CG1 4.49Å
95	I	83.7	Confident	78.5	Confident	58 Å²	58	121.4 Å²	121.4	30%	0.297	59%	0.593	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-117.4	122.1	179.8	-53.3	173.8	0	0	0	107.9	T88 K90 H97	T88-I95 PolarHBondContact N-O 3.25Å; T88-I95 PolarHBondContact O-N 3.2Å; K90-I95 HydrophobicContact CB-CD1 4.1Å; I95-H97 VanDerWaalsContact CG2-NE2 3.27Å; I95-H97 WeakPolarHBondContact CG2-NE2 3.43Å
96	I	82.8	Confident	78.4	Confident	69 Å²	69	123.9 Å²	123.9	35%	0.354	60%	0.604	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-109.8	114.2	179.5	-55.5	172.9	0	0	0	107.7	L76 L85 L94	L76-I96 HydrophobicContact CD2-CD1 3.54Å; L85-I96 HydrophobicContact CD1-CG2 3.53Å; L85-I96 HydrophobicContact CG-CG2 3.98Å; L94-I96 HydrophobicContact CD2-CD1 4.45Å; L94-I96 HydrophobicContact CG-CG1 4.49Å
97	H	80.2	Confident	78.3	Confident	94 Å²	94	126.5 Å²	126.5	44%	0.435	62%	0.618	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-101.2	134.1	172.7	-68.7	-81.5	0	0	0	109.6	L85 E86 I95	L85-H97 WeakPolarHBondContact CA-O 3.47Å; E86-H97 HydrophobicContact CB-CB 4.2Å; E86-H97 PolarHBondContact N-O 3.34Å; E86-H97 PolarHBondContact O-N 2.94Å; I95-H97 VanDerWaalsContact CG2-NE2 3.27Å; I95-H97 WeakPolarHBondContact CG2-NE2 3.43Å
98	V	78.5	Confident	77.9	Confident	73 Å²	73	127.9 Å²	127.9	44%	0.442	62%	0.623	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-113.1	114.6	172.8	-179.7	0	0	0	0	107.7	L80 L85	L80-V98 HydrophobicContact CD1-CB 4.49Å; L80-V98 HydrophobicContact CD1-CG1 3.94Å; L80-V98 HydrophobicContact CD1-CG2 3.74Å; L80-V98 HydrophobicContact CD2-CG1 4.17Å; L80-V98 HydrophobicContact CD2-CG2 3.89Å; L80-V98 HydrophobicContact CG-CG2 4.5Å; L85-V98 HydrophobicContact CD1-CG2 4.34Å
99	K	77.6	Confident	77.4	Confident	119 Å²	119	132.8 Å²	132.8	52%	0.517	64%	0.643	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-93.6	106.5	170.5	-67.3	179.8	-171.7	158.9	0	107.8	G83 T84 E86	G83-K99 CarbonylContact C-O 3.57Å; G83-K99 WeakPolarHBondContact CA-O 3.18Å; T84-K99 PolarHBondContact N-O 2.85Å; T84-K99 PolarHBondContact O-N 2.72Å; E86-K99 VanDerWaalsContact OE2-CE 3.31Å; E86-K99 WeakPolarHBondContact OE2-CE 3.46Å; E86-K99 IonicContact OE2-NZ 2.76Å; E86-K99 PolarHBondContact OE2-NZ 3.32Å
100	H	75.3	Confident	76.8	Confident	101 Å²	101	134 Å²	134	47%	0.468	64%	0.639	S	S	.	*			trans	-92.7	116.7	171	-174.6	65.1	0	0	0	108.2	Q81 A82 E102	Q81-H100 PolarHBondContact O-ND1 3.17Å; A82-H100 PolarHBondContact O-CE1 2.77Å; A82-H100 PolarHBondContact O-ND1 2.81Å; H100-E102 PolarHBondContact O-N 3.42Å
101	E	68.4	Low	76.1	Confident	162 Å²	162	134.2 Å²	134.2	76%	0.757	64%	0.644	S	S	*	*			trans	-85	104.7	166.7	-77	-171.9	159.8	0	0	107.6	N103	E101-N103 PolarHBondContact O-N 3Å
102	E	68.6	Low	75.1	Confident	164 Å²	164	135 Å²	135	77%	0.766	64%	0.642	S	S	*	*			trans	-67.6	100.6	166.5	-70.4	-175.7	167	0	0	107.9	H100 K104	H100-E102 PolarHBondContact O-N 3.42Å; E102-K104 PolarHBondContact O-N 2.98Å
103	N	63.3	Low	74.6	Confident	157 Å²	157	131.1 Å²	131.1	84%	0.84	61%	0.614	S	S	*	*			trans	-66.6	106.3	163.9	-84.7	-31.5	0	0	0	107.6	E101	E101-N103 PolarHBondContact O-N 3Å
104	K	52.5	Low	73.9	Confident	273 Å²	273	125.8 Å²	125.8	100%	1.187	61%	0.606	S	S	*	*			trans	-71.9	0	176.8	-158.7	-178.4	-173.3	-177.7	0	112.1	E102	E102-K104 PolarHBondContact O-N 2.98Å

Retrieved 104 of 104 residues in 48.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).