A0A077ZNC1_TRITR Loading...

Pkinase domain containing protein

AlphaFold DB , UniProt , Accession A0A077ZNC1, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 118 aa.

						>A0A077ZNC1_TRITR|A0A077ZNC1
MPPTAPGKPTEGEWSKDQACEFYNNYDCKEVLGKGMSSTVRRCIRFSTGEEFAVKIIDLSSEKATAEQVRELRDSTLREIKILQMFSGHKNISVQFVLQQLMRANAAVTCFSLSPRLL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	48.2	Very low	55	Low	234 Å²	234	141.1 Å²	141.1	100%	1.153	84%	0.841	S	S	*	*				0	122.7	0	-63	-173.5	-174.8	0	0	107.1
2	P	66.1	Low	53.7	Low	124 Å²	124	134.3 Å²	134.3	81%	0.805	82%	0.822	S	S	*	*			trans	-73.9	136	-179.9	30	-30.9	0	0	0	109.3	T4	P2-T4 PolarHBondContact O-N 2.8Å
3	P	62.2	Low	52.3	Low	127 Å²	127	138.5 Å²	138.5	83%	0.825	83%	0.827	S	S	*	*			trans	-67.3	131.8	173.2	25.7	-29.7	0	0	0	110.5
4	T	62.4	Low	51.7	Low	139 Å²	139	142.8 Å²	142.8	85%	0.853	82%	0.822	S	S	*	*			trans	-45.2	134.5	178.2	-46	0	0	0	0	113.4	P2	P2-T4 PolarHBondContact O-N 2.8Å
5	A	59.6	Low	50.9	Low	85 Å²	85	139.7 Å²	139.7	70%	0.702	81%	0.812	S	S	*	*	P	Polyproline II helix	trans	-55.5	142.2	177.4	0	0	0	0	0	112.7	G7	A5-G7 PolarHBondContact O-N 3.09Å
6	P	66.1	Low	50.6	Low	131 Å²	131	138.6 Å²	138.6	85%	0.851	79%	0.794	S	S	*	*	P	Polyproline II helix	trans	-71.9	129.5	173.8	28.6	-29.9	0	0	0	110.4
7	G	50.3	Low	50.4	Low	73 Å²	73	137.9 Å²	137.9	75%	0.753	79%	0.787	S	S	*	*	P	Polyproline II helix	trans	-64.2	156.9	-175.2	0	0	0	0	0	115.3	A5	A5-G7 PolarHBondContact O-N 3.09Å
8	K	46.3	Very low	50.4	Low	201 Å²	201	133.6 Å²	133.6	87%	0.874	76%	0.759	S	S	*	*	P	Polyproline II helix	trans	-53.5	142.9	-179.9	-77.3	-173.2	179.1	-175.3	0	113.1	T10	K8-T10 PolarHBondContact O-N 2.86Å
9	P	51.6	Low	50.5	Low	107 Å²	107	128.1 Å²	128.1	70%	0.695	73%	0.732	S	S	*	*	P	Polyproline II helix	trans	-72.8	119.7	160.3	-7.1	24.3	0	0	0	109.9
10	T	52.6	Low	50.6	Low	133 Å²	133	123.8 Å²	123.8	82%	0.816	71%	0.71	S	S	*	*	P	Polyproline II helix	trans	-71.4	164.3	165.2	44.6	0	0	0	0	111.7	K8	K8-T10 PolarHBondContact O-N 2.86Å
11	E	39.2	Very low	51.1	Low	198 Å²	198	122.6 Å²	122.6	93%	0.925	70%	0.698	S	S	*	*	S	Bend	trans	-58	146.5	-156	-59.7	171.4	110.3	0	0	116.7
12	G	39.4	Very low	51.9	Low	60 Å²	60	112 Å²	112	62%	0.619	65%	0.646	S	S	*	*			trans	153.9	65.8	-170.8	0	0	0	0	0	107.2	W14	G12-W14 VanDerWaalsContact C-N 3.26Å; G12-W14 PolarHBondContact O-N 2.99Å
13	E	36.3	Very low	51.9	Low	188 Å²	188	111.5 Å²	111.5	88%	0.879	63%	0.628	S	S	*	*			trans	-71	67.2	-159.6	-156.2	159	89.7	0	0	113.3
14	W	43.4	Very low	52.4	Low	199 Å²	199	110.5 Å²	110.5	75%	0.754	62%	0.616	S	S	*	*			trans	-97.9	115.6	151.2	-106.4	-93.2	0	0	0	106.4	G12 K16	G12-W14 VanDerWaalsContact C-N 3.26Å; G12-W14 PolarHBondContact O-N 2.99Å; W14-K16 VanDerWaalsContact C-N 3.29Å; W14-K16 PolarHBondContact O-N 3.14Å
15	S	40.6	Very low	53	Low	96 Å²	96	107.5 Å²	107.5	67%	0.671	60%	0.595	S	S	*	*			trans	-58.7	98.5	168.9	-63.4	0	0	0	0	108.5	D17	S15-D17 PolarHBondContact O-N 2.88Å; S15-D17 VanDerWaalsContact O-N 3.1Å
16	K	44.8	Very low	53.8	Low	123 Å²	123	104.1 Å²	104.1	54%	0.535	56%	0.564	S	S	.	*	H	α-helix	trans	-58.7	-21.9	-173.7	-78.4	174.8	-178.1	173.1	0	111.8	W14 Q18 C20	W14-K16 VanDerWaalsContact C-N 3.29Å; W14-K16 PolarHBondContact O-N 3.14Å; K16-Q18 PolarHBondContact O-N 3.12Å; K16-C20 WeakPolarHBondContact O-CA 3.04Å; K16-C20 WeakPolarHBondContact O-CB 3.47Å; K16-C20 PolarHBondContact O-N 3.01Å; K16-C20 PolarHBondContact O-SG 3.08Å
17	D	48.2	Very low	54.5	Low	127 Å²	127	100.5 Å²	100.5	68%	0.679	54%	0.538	S	S	*	.	H	α-helix	trans	-60.4	-39.1	-163.8	-59.9	-80.2	0	0	0	116.5	S15 E21	S15-D17 PolarHBondContact O-N 2.88Å; S15-D17 VanDerWaalsContact O-N 3.1Å; D17-E21 PolarHBondContact O-N 3.2Å
18	Q	49.5	Very low	55.9	Low	59 Å²	59	98.2 Å²	98.2	28%	0.276	51%	0.51	S	S	.	.	H	α-helix	trans	-91.9	-33.6	-177.8	-88	151.4	104.3	0	0	114.5	K16 C20 E21 F22 L101	K16-Q18 PolarHBondContact O-N 3.12Å; Q18-C20 VanDerWaalsContact C-N 3.31Å; Q18-E21 PolarHBondContact O-N 2.8Å; Q18-F22 PolarHBondContact O-N 3.29Å; Q18-L101 HydrophobicContact CB-CD1 4.14Å
19	A	53.1	Low	57.7	Low	30 Å²	30	92.5 Å²	92.5	25%	0.248	49%	0.485	C	S	.	.	H	α-helix	trans	-64.8	-44.3	167.8	0	0	0	0	0	108.9	E21 F22 Y23	A19-E21 VanDerWaalsContact C-N 3.31Å; A19-E21 PolarHBondContact O-N 3.32Å; A19-F22 PolarHBondContact O-N 3.16Å; A19-F22 VanDerWaalsContact O-N 3.17Å; A19-Y23 HydrophobicContact CB-CD2 4.15Å; A19-Y23 HydrophobicContact CB-CE2 4.16Å; A19-Y23 WeakPolarHBondContact O-CD2 3.45Å; A19-Y23 PolarHBondContact O-N 2.86Å
20	C	51.8	Low	59.3	Low	42 Å²	42	92.9 Å²	92.9	28%	0.284	48%	0.477	S	S	.	.	H	α-helix	trans	-56.4	-43.1	171.6	-76.8	0	0	0	0	111	K16 Q18 F22 Y23 N24	K16-C20 WeakPolarHBondContact O-CA 3.04Å; K16-C20 WeakPolarHBondContact O-CB 3.47Å; K16-C20 PolarHBondContact O-N 3.01Å; K16-C20 PolarHBondContact O-SG 3.08Å; Q18-C20 VanDerWaalsContact C-N 3.31Å; C20-F22 VanDerWaalsContact C-N 3.26Å; C20-F22 PolarHBondContact O-N 2.64Å; C20-Y23 CarbonylContact O-C 3.2Å; C20-Y23 PolarHBondContact O-N 3.09Å; C20-Y23 VanDerWaalsContact O-N 3.16Å; C20-N24 WeakPolarHBondContact O-CA 3.2Å; C20-N24 WeakPolarHBondContact O-CB 3.45Å; C20-N24 PolarHBondContact O-N 2.71Å; C20-N24 PolarHBondContact O-ND2 2.87Å; C20-N24 PolarHBondContact O-OD1 2.71Å
21	E	61.2	Low	60.9	Low	98 Å²	98	89.5 Å²	89.5	46%	0.458	46%	0.456	S	S	.	.	H	α-helix	trans	-57	-40.4	178.4	-167	179.9	-167.9	0	0	112.9	D17 Q18 A19 N25	D17-E21 PolarHBondContact O-N 3.2Å; Q18-E21 PolarHBondContact O-N 2.8Å; A19-E21 VanDerWaalsContact C-N 3.31Å; A19-E21 PolarHBondContact O-N 3.32Å; E21-N25 WeakPolarHBondContact O-CB 3.45Å; E21-N25 PolarHBondContact O-N 3.36Å; E21-N25 PolarHBondContact O-ND2 2.84Å
22	F	65.8	Low	63.1	Low	13 Å²	13	83.9 Å²	83.9	6%	0.057	43%	0.432	C	S	.	.	H	α-helix	trans	-68.7	-50.6	172.5	178.1	-98.6	0	0	0	111.9	Q18 A19 C20 N24 N25 Y26 C28 C43 V54	Q18-F22 PolarHBondContact O-N 3.29Å; A19-F22 PolarHBondContact O-N 3.16Å; A19-F22 VanDerWaalsContact O-N 3.17Å; C20-F22 VanDerWaalsContact C-N 3.26Å; C20-F22 PolarHBondContact O-N 2.64Å; F22-N24 PolarHBondContact O-N 3.3Å; F22-N25 PolarHBondContact O-N 2.75Å; F22-Y26 AromaticContact CD2-CD2 3.51Å; F22-Y26 HydrophobicContact CD2-CD2 3.51Å; F22-Y26 AromaticContact CD2-CE2 4Å; F22-Y26 HydrophobicContact CD2-CE2 4Å; F22-Y26 HydrophobicContact CD2-CG 4.16Å; F22-Y26 HydrophobicContact CE2-CD1 4.4Å; F22-Y26 AromaticContact CE2-CD2 3.55Å; F22-Y26 HydrophobicContact CE2-CD2 3.55Å; F22-Y26 HydrophobicContact CE2-CE2 4.1Å; F22-Y26 AromaticContact CE2-CG 3.73Å; F22-Y26 HydrophobicContact CE2-CG 3.73Å; F22-Y26 HydrophobicContact CG-CD2 4.3Å; F22-Y26 HydrophobicContact CZ-CD2 4.35Å; F22-Y26 HydrophobicContact CZ-CG 4.18Å; F22-Y26 WeakPolarHBondContact O-CB 3.47Å; F22-Y26 WeakPolarHBondContact O-CD2 3.44Å; F22-Y26 PolarHBondContact O-N 2.75Å; F22-C28 VanDerWaalsContact CE1-SG 3.59Å; F22-C43 HydrophobicContact CZ-CB 4.2Å; F22-V54 HydrophobicContact CE1-CG1 4.37Å; F22-V54 HydrophobicContact CE2-CG1 4.29Å; F22-V54 HydrophobicContact CE2-CG2 4.16Å; F22-V54 HydrophobicContact CZ-CB 4.18Å; F22-V54 HydrophobicContact CZ-CG1 3.76Å; F22-V54 HydrophobicContact CZ-CG2 3.78Å
23	Y	66	Low	65.2	Low	112 Å²	112	82.4 Å²	82.4	44%	0.439	42%	0.417	S	S	.	.	H	α-helix	trans	-68.3	-15.9	178.6	-68.6	-70.3	0	0	0	114.2	A19 C20 C28	A19-Y23 HydrophobicContact CB-CD2 4.15Å; A19-Y23 HydrophobicContact CB-CE2 4.16Å; A19-Y23 WeakPolarHBondContact O-CD2 3.45Å; A19-Y23 PolarHBondContact O-N 2.86Å; C20-Y23 CarbonylContact O-C 3.2Å; C20-Y23 PolarHBondContact O-N 3.09Å; C20-Y23 VanDerWaalsContact O-N 3.16Å; Y23-C28 HydrophobicContact CD1-CB 4.47Å; Y23-C28 HydrophobicContact CE1-CB 4.17Å; Y23-C28 WeakPolarHBondContact CE1-SG 3.17Å
24	N	72	Confident	67.5	Low	107 Å²	107	81.5 Å²	81.5	57%	0.572	41%	0.41	S	S	*	.	H	α-helix	trans	-86.1	-27.6	176.9	-74.1	-5.7	0	0	0	110.7	C20 F22 F46	C20-N24 WeakPolarHBondContact O-CA 3.2Å; C20-N24 WeakPolarHBondContact O-CB 3.45Å; C20-N24 PolarHBondContact O-N 2.71Å; C20-N24 PolarHBondContact O-ND2 2.87Å; C20-N24 PolarHBondContact O-OD1 2.71Å; F22-N24 PolarHBondContact O-N 3.3Å; N24-F46 WeakPolarHBondContact O-CD2 3.38Å
25	N	75.2	Confident	69.1	Low	76 Å²	76	74.1 Å²	74.1	41%	0.406	40%	0.396	S	S	.	.	H	α-helix	trans	-101.4	-18.8	179.6	-70	-26.1	0	0	0	112.7	E21 F22 R45 F46	E21-N25 WeakPolarHBondContact O-CB 3.45Å; E21-N25 PolarHBondContact O-N 3.36Å; E21-N25 PolarHBondContact O-ND2 2.84Å; F22-N25 PolarHBondContact O-N 2.75Å; N25-R45 CarbonylContact O-C 3.42Å; N25-R45 WeakPolarHBondContact O-CA 3.41Å; N25-F46 WeakPolarHBondContact O-CD2 3.24Å; N25-F46 PolarHBondContact O-N 2.76Å
26	Y	76.3	Confident	70.6	Confident	14 Å²	14	79.4 Å²	79.4	6%	0.055	41%	0.412	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-134.9	130.2	-175.9	-59.4	-93.4	0	0	0	112.7	F22 C28 I44 R45 F52	F22-Y26 AromaticContact CD2-CD2 3.51Å; F22-Y26 HydrophobicContact CD2-CD2 3.51Å; F22-Y26 AromaticContact CD2-CE2 4Å; F22-Y26 HydrophobicContact CD2-CE2 4Å; F22-Y26 HydrophobicContact CD2-CG 4.16Å; F22-Y26 HydrophobicContact CE2-CD1 4.4Å; F22-Y26 AromaticContact CE2-CD2 3.55Å; F22-Y26 HydrophobicContact CE2-CD2 3.55Å; F22-Y26 HydrophobicContact CE2-CE2 4.1Å; F22-Y26 AromaticContact CE2-CG 3.73Å; F22-Y26 HydrophobicContact CE2-CG 3.73Å; F22-Y26 HydrophobicContact CG-CD2 4.3Å; F22-Y26 HydrophobicContact CZ-CD2 4.35Å; F22-Y26 HydrophobicContact CZ-CG 4.18Å; F22-Y26 WeakPolarHBondContact O-CB 3.47Å; F22-Y26 WeakPolarHBondContact O-CD2 3.44Å; F22-Y26 PolarHBondContact O-N 2.75Å; Y26-C28 PolarHBondContact O-N 2.71Å; Y26-I44 CarbonylContact C-O 3.45Å; Y26-I44 VanDerWaalsContact CA-O 3.31Å; Y26-I44 WeakPolarHBondContact CA-O 3.46Å; Y26-R45 HydrophobicContact CD1-CB 3.72Å; Y26-R45 HydrophobicContact CD1-CG 4.14Å; Y26-R45 HydrophobicContact CE1-CB 3.6Å; Y26-R45 HydrophobicContact CE1-CG 3.78Å; Y26-F52 HydrophobicContact CD1-CD2 4.26Å; Y26-F52 AromaticContact CE1-CD2 3.93Å; Y26-F52 HydrophobicContact CE1-CD2 3.93Å; Y26-F52 HydrophobicContact CE1-CE2 4.09Å
27	D	81.9	Confident	71.9	Confident	55 Å²	55	76.3 Å²	76.3	29%	0.294	41%	0.406	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.4	106.1	173.1	-170.1	6.9	0	0	0	111	K29 C43 I44 F46	D27-K29 PolarHBondContact O-N 2.74Å; D27-K29 WeakPolarHBondContact OD2-CE 3.35Å; D27-K29 IonicContact OD2-NZ 2.64Å; D27-K29 PolarHBondContact OD2-NZ 3.35Å; D27-C43 CarbonylContact O-C 3.52Å; D27-C43 WeakPolarHBondContact O-CA 3.2Å; D27-I44 HydrophobicContact CB-CB 4.38Å; D27-I44 PolarHBondContact N-O 2.81Å; D27-I44 PolarHBondContact O-N 3.44Å; D27-F46 HydrophobicContact CB-CD1 4.38Å; D27-F46 HydrophobicContact CB-CE1 3.56Å; D27-F46 HydrophobicContact CB-CE2 4.38Å; D27-F46 HydrophobicContact CB-CZ 3.55Å
28	C	79.1	Confident	73.2	Confident	25 Å²	25	71.1 Å²	71.1	17%	0.169	38%	0.379	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-76	109.8	176.8	-65.2	0	0	0	0	111.7	F22 Y23 Y26 R42 C43	F22-C28 VanDerWaalsContact CE1-SG 3.59Å; Y23-C28 HydrophobicContact CD1-CB 4.47Å; Y23-C28 HydrophobicContact CE1-CB 4.17Å; Y23-C28 WeakPolarHBondContact CE1-SG 3.17Å; Y26-C28 PolarHBondContact O-N 2.71Å; C28-R42 CarbonylContact C-O 3.35Å; C28-C43 PolarHBondContact SG-SG 2.71Å
29	K	84.1	Confident	74.7	Confident	81 Å²	81	70.4 Å²	70.4	35%	0.352	38%	0.379	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.8	-142.8	173.9	-56.4	-61.4	-165.5	-169.1	0	111.1	D27 R41 R42 I44	D27-K29 PolarHBondContact O-N 2.74Å; D27-K29 WeakPolarHBondContact OD2-CE 3.35Å; D27-K29 IonicContact OD2-NZ 2.64Å; D27-K29 PolarHBondContact OD2-NZ 3.35Å; K29-R41 PolarHBondContact O-NH2 2.89Å; K29-R41 VanDerWaalsContact O-NH2 3.09Å; K29-R42 WeakPolarHBondContact CA-O 3.39Å; K29-R42 HydrophobicContact CB-CB 4.2Å; K29-R42 WeakPolarHBondContact CB-O 3.31Å; K29-R42 PolarHBondContact N-O 3.18Å; K29-I44 HydrophobicContact CD-CD1 4.41Å; K29-I44 VanDerWaalsContact CE-CD1 3.49Å; K29-I44 HydrophobicContact CG-CD1 4.01Å; K29-I44 HydrophobicContact CG-CG1 4.1Å
30	E	85.9	Confident	76.2	Confident	114 Å²	114	70.7 Å²	70.7	53%	0.533	38%	0.378	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-66.1	160.4	-178.3	70.8	-153.3	116.5	0	0	113.5	L32 R41 R42	E30-L32 HydrophobicContact CG-CD2 4.28Å; E30-R41 WeakPolarHBondContact O-CA 3.3Å; E30-R42 HydrophobicContact CG-CB 4.4Å; E30-R42 PolarHBondContact O-N 3.33Å; E30-R42 IonicContact OE1-CZ 3.53Å; E30-R42 IonicContact OE1-NE 3.01Å; E30-R42 PolarHBondContact OE1-NE 2.83Å; E30-R42 IonicContact OE1-NH2 3.14Å; E30-R42 PolarHBondContact OE1-NH2 3.13Å; E30-R42 VanDerWaalsContact OE1-NH2 3.14Å
31	V	86.2	Confident	77.7	Confident	62 Å²	62	72.3 Å²	72.3	38%	0.376	38%	0.378	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.4	118.2	171.9	177.5	0	0	0	0	107.9	K34 T39 V40 R41	V31-K34 HydrophobicContact CG1-CG 3.79Å; V31-T39 HydrophobicContact CG1-CG2 3.57Å; V31-T39 HydrophobicContact CG2-CG2 4.18Å; V31-V40 CarbonylContact C-O 3.5Å; V31-V40 WeakPolarHBondContact CG1-O 3.48Å; V31-R41 HydrophobicContact CG2-CG 4.17Å
32	L	85.2	Confident	78.8	Confident	81 Å²	81	69.9 Å²	69.9	42%	0.424	37%	0.365	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-78.3	-29.5	176.5	-62.9	176.3	0	0	0	111.9	E30 V40 R42 A53 L113	E30-L32 HydrophobicContact CG-CD2 4.28Å; L32-V40 HydrophobicContact CB-CB 4.44Å; L32-V40 HydrophobicContact CB-CG1 4.13Å; L32-V40 HydrophobicContact CD1-CG1 4.28Å; L32-V40 PolarHBondContact N-O 3.41Å; L32-R42 HydrophobicContact CD1-CB 3.9Å; L32-R42 HydrophobicContact CD1-CG 4.43Å; L32-R42 HydrophobicContact CD2-CB 4.02Å; L32-R42 HydrophobicContact CG-CB 3.88Å; L32-A53 HydrophobicContact CD1-CB 3.74Å; L32-L113 HydrophobicContact CD1-CD1 4.01Å; L32-L113 HydrophobicContact CD1-CD2 4.33Å
33	G	83.4	Confident	79.6	Confident	28 Å²	28	69.2 Å²	69.2	29%	0.289	36%	0.362	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-170	148	178.4	0	0	0	0	0	113.1	T39 V40	G33-T39 CarbonylContact O-C 3.58Å; G33-V40 PolarHBondContact N-O 2.81Å; G33-V40 PolarHBondContact O-N 2.66Å
34	K	83.7	Confident	80.5	Confident	170 Å²	170	65.5 Å²	65.5	74%	0.739	35%	0.349	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-114.4	117.6	172.1	-64.6	-178.2	-179.8	179.3	0	108.4	V31 T39	V31-K34 HydrophobicContact CG1-CG 3.79Å; K34-T39 HydrophobicContact CG-CG2 4.16Å
35	G	76.5	Confident	80.9	Confident	44 Å²	44	63.4 Å²	63.4	45%	0.454	33%	0.333	S	S	.	.			trans	-90.2	178.9	167.5	0	0	0	0	0	111.6	S37 S38	G35-S37 VanDerWaalsContact C-N 3.3Å; G35-S37 PolarHBondContact O-N 3.45Å; G35-S38 CarbonylContact C-O 3.53Å; G35-S38 WeakPolarHBondContact CA-O 3.4Å; G35-S38 PolarHBondContact N-O 2.79Å
36	M	73	Confident	81.2	Confident	207 Å²	207	65.7 Å²	65.7	100%	1.02	34%	0.34	S	S	*	.	S	Bend	trans	-62.7	-34.1	-178.6	-74.3	-171.5	169.8	0	0	113.8
37	S	71.3	Confident	81.4	Confident	57 Å²	57	69.8 Å²	69.8	40%	0.399	37%	0.37	S	S	.	.	S	Bend	trans	-135.7	15.3	-178.6	56.1	0	0	0	0	112.4	G35 I57 D58	G35-S37 VanDerWaalsContact C-N 3.3Å; G35-S37 PolarHBondContact O-N 3.45Å; S37-I57 WeakPolarHBondContact O-CA 3.41Å; S37-D58 PolarHBondContact O-N 3.3Å
38	S	76.8	Confident	81.5	Confident	18 Å²	18	70.6 Å²	70.6	13%	0.126	38%	0.377	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-148.5	153.6	-179.6	62.8	0	0	0	0	112	G35 K55 I56	G35-S38 CarbonylContact C-O 3.53Å; G35-S38 WeakPolarHBondContact CA-O 3.4Å; G35-S38 PolarHBondContact N-O 2.79Å; S38-K55 WeakPolarHBondContact OG-CE 3.49Å; S38-I56 CarbonylContact C-O 3.56Å; S38-I56 WeakPolarHBondContact CA-O 3.19Å
39	T	80.4	Confident	81.6	Confident	45 Å²	45	71.8 Å²	71.8	28%	0.276	39%	0.394	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.9	124.7	176.2	-62.3	0	0	0	0	108.9	V31 G33 K34 R41 K55 I56	V31-T39 HydrophobicContact CG1-CG2 3.57Å; V31-T39 HydrophobicContact CG2-CG2 4.18Å; G33-T39 CarbonylContact O-C 3.58Å; K34-T39 HydrophobicContact CG-CG2 4.16Å; T39-R41 HydrophobicContact CG2-CG 4.07Å; T39-K55 CarbonylContact O-C 3.59Å; T39-K55 WeakPolarHBondContact O-CA 3.43Å; T39-I56 PolarHBondContact N-O 2.75Å; T39-I56 PolarHBondContact O-N 2.7Å
40	V	84.3	Confident	81.3	Confident	36 Å²	36	72 Å²	72	22%	0.218	40%	0.396	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.8	123.3	174.7	-172.5	0	0	0	0	108.8	V31 L32 G33 A53 V54 K55	V31-V40 CarbonylContact C-O 3.5Å; V31-V40 WeakPolarHBondContact CG1-O 3.48Å; L32-V40 HydrophobicContact CB-CB 4.44Å; L32-V40 HydrophobicContact CB-CG1 4.13Å; L32-V40 HydrophobicContact CD1-CG1 4.28Å; L32-V40 PolarHBondContact N-O 3.41Å; G33-V40 PolarHBondContact N-O 2.81Å; G33-V40 PolarHBondContact O-N 2.66Å; V40-A53 HydrophobicContact CG1-CB 3.81Å; V40-V54 CarbonylContact C-O 3.48Å; V40-V54 VanDerWaalsContact CA-O 3.3Å; V40-V54 WeakPolarHBondContact CA-O 3.31Å; V40-K55 HydrophobicContact CG2-CB 4.03Å; V40-K55 HydrophobicContact CG2-CD 4.48Å; V40-K55 HydrophobicContact CG2-CG 3.94Å
41	R	84.2	Confident	81	Confident	75 Å²	75	70.6 Å²	70.6	28%	0.283	39%	0.39	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.6	144.6	177.8	-59.6	-168.3	65.8	164.9	-3	110.4	K29 E30 V31 T39 A53 V54 I56	K29-R41 PolarHBondContact O-NH2 2.89Å; K29-R41 VanDerWaalsContact O-NH2 3.09Å; E30-R41 WeakPolarHBondContact O-CA 3.3Å; V31-R41 HydrophobicContact CG2-CG 4.17Å; T39-R41 HydrophobicContact CG2-CG 4.07Å; R41-A53 CarbonylContact O-C 3.56Å; R41-A53 WeakPolarHBondContact O-CA 3.21Å; R41-V54 PolarHBondContact N-O 2.69Å; R41-V54 PolarHBondContact O-N 2.62Å; R41-I56 HydrophobicContact CG-CD1 4.27Å
42	R	84.4	Confident	80.6	Confident	47 Å²	47	67.9 Å²	67.9	18%	0.177	37%	0.373	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-78	130.3	170	-167.2	167.8	68.9	88	0.7	108.5	C28 K29 E30 L32 E51 F52 L113	C28-R42 CarbonylContact C-O 3.35Å; K29-R42 WeakPolarHBondContact CA-O 3.39Å; K29-R42 HydrophobicContact CB-CB 4.2Å; K29-R42 WeakPolarHBondContact CB-O 3.31Å; K29-R42 PolarHBondContact N-O 3.18Å; E30-R42 HydrophobicContact CG-CB 4.4Å; E30-R42 PolarHBondContact O-N 3.33Å; E30-R42 IonicContact OE1-CZ 3.53Å; E30-R42 IonicContact OE1-NE 3.01Å; E30-R42 PolarHBondContact OE1-NE 2.83Å; E30-R42 IonicContact OE1-NH2 3.14Å; E30-R42 PolarHBondContact OE1-NH2 3.13Å; E30-R42 VanDerWaalsContact OE1-NH2 3.14Å; L32-R42 HydrophobicContact CD1-CB 3.9Å; L32-R42 HydrophobicContact CD1-CG 4.43Å; L32-R42 HydrophobicContact CD2-CB 4.02Å; L32-R42 HydrophobicContact CG-CB 3.88Å; R42-E51 WeakPolarHBondContact CD-OE2 3.31Å; R42-E51 IonicContact CZ-OE2 3.82Å; R42-E51 IonicContact NH1-OE1 3.12Å; R42-E51 PolarHBondContact NH1-OE1 2.87Å; R42-E51 VanDerWaalsContact NH1-OE1 3.12Å; R42-E51 IonicContact NH1-OE2 2.88Å; R42-E51 PolarHBondContact NH1-OE2 3.24Å; R42-F52 CarbonylContact C-O 3.4Å; R42-F52 WeakPolarHBondContact CA-O 3.37Å; R42-L113 HydrophobicContact CG-CD1 3.81Å
43	C	82.3	Confident	80.4	Confident	0 Å²	0	64.4 Å²	64.4	0%	0	36%	0.356	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-131.5	133.9	-177.9	-65.5	0	0	0	0	108.8	F22 D27 C28 F52 V54	F22-C43 HydrophobicContact CZ-CB 4.2Å; D27-C43 CarbonylContact O-C 3.52Å; D27-C43 WeakPolarHBondContact O-CA 3.2Å; C28-C43 PolarHBondContact SG-SG 2.71Å; C43-F52 PolarHBondContact N-O 3.42Å; C43-F52 WeakPolarHBondContact O-CA 3.47Å; C43-F52 PolarHBondContact O-N 3.25Å; C43-V54 HydrophobicContact CB-CB 4.4Å; C43-V54 HydrophobicContact CB-CG2 3.64Å; C43-V54 VanDerWaalsContact SG-CG2 3.53Å
44	I	83.5	Confident	80.1	Confident	34 Å²	34	63.1 Å²	63.1	17%	0.174	34%	0.342	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.8	123.2	-179.9	-50.9	-177.7	0	0	0	108.6	Y26 D27 K29 F46 E50 E51	Y26-I44 CarbonylContact C-O 3.45Å; Y26-I44 VanDerWaalsContact CA-O 3.31Å; Y26-I44 WeakPolarHBondContact CA-O 3.46Å; D27-I44 HydrophobicContact CB-CB 4.38Å; D27-I44 PolarHBondContact N-O 2.81Å; D27-I44 PolarHBondContact O-N 3.44Å; K29-I44 HydrophobicContact CD-CD1 4.41Å; K29-I44 VanDerWaalsContact CE-CD1 3.49Å; K29-I44 HydrophobicContact CG-CD1 4.01Å; K29-I44 HydrophobicContact CG-CG1 4.1Å; I44-F46 PolarHBondContact O-N 3.41Å; I44-E50 WeakPolarHBondContact CA-O 3.45Å; I44-E51 HydrophobicContact CG1-CG 4.23Å
45	R	81.3	Confident	79.8	Confident	63 Å²	63	56.9 Å²	56.9	24%	0.238	32%	0.315	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-70.2	123.3	178.6	-173.1	165.1	68.3	177.6	2	110.2	N25 Y26 S47 T48 G49 E50 F52	N25-R45 CarbonylContact O-C 3.42Å; N25-R45 WeakPolarHBondContact O-CA 3.41Å; Y26-R45 HydrophobicContact CD1-CB 3.72Å; Y26-R45 HydrophobicContact CD1-CG 4.14Å; Y26-R45 HydrophobicContact CE1-CB 3.6Å; Y26-R45 HydrophobicContact CE1-CG 3.78Å; R45-S47 VanDerWaalsContact C-N 3.28Å; R45-S47 WeakPolarHBondContact CD-OG 3.48Å; R45-S47 WeakPolarHBondContact CG-OG 3.36Å; R45-S47 PolarHBondContact O-N 2.91Å; R45-T48 PolarHBondContact NE-OG1 2.87Å; R45-T48 PolarHBondContact NH2-OG1 3.12Å; R45-T48 PolarHBondContact O-N 3.28Å; R45-G49 VanDerWaalsContact O-CA 3.31Å; R45-G49 WeakPolarHBondContact O-CA 3.31Å; R45-G49 PolarHBondContact O-N 3.41Å; R45-E50 IonicContact CZ-OE2 3.45Å; R45-E50 PolarHBondContact N-O 3.08Å; R45-E50 IonicContact NE-OE2 3.76Å; R45-E50 IonicContact NH2-OE2 2.62Å; R45-E50 PolarHBondContact NH2-OE2 3.09Å; R45-F52 HydrophobicContact CB-CD2 4.25Å; R45-F52 HydrophobicContact CB-CE2 3.75Å
46	F	82.4	Confident	79.7	Confident	123 Å²	123	56.6 Å²	56.6	54%	0.539	30%	0.303	S	S	.	.	T	Hydrogen-bonded Turn	trans	-62.2	-35.3	-178.5	-67.4	-63.8	0	0	0	112.9	N24 N25 D27 I44	N24-F46 WeakPolarHBondContact O-CD2 3.38Å; N25-F46 WeakPolarHBondContact O-CD2 3.24Å; N25-F46 PolarHBondContact O-N 2.76Å; D27-F46 HydrophobicContact CB-CD1 4.38Å; D27-F46 HydrophobicContact CB-CE1 3.56Å; D27-F46 HydrophobicContact CB-CE2 4.38Å; D27-F46 HydrophobicContact CB-CZ 3.55Å; I44-F46 PolarHBondContact O-N 3.41Å
47	S	80.6	Confident	79.8	Confident	100 Å²	100	47.1 Å²	47.1	70%	0.699	26%	0.256	S	S	*	.	T	Hydrogen-bonded Turn	trans	-72	-31.3	-175.4	58.9	0	0	0	0	114.3	R45	R45-S47 VanDerWaalsContact C-N 3.28Å; R45-S47 WeakPolarHBondContact CD-OG 3.48Å; R45-S47 WeakPolarHBondContact CG-OG 3.36Å; R45-S47 PolarHBondContact O-N 2.91Å
48	T	82.3	Confident	79.8	Confident	72 Å²	72	48.3 Å²	48.3	44%	0.442	26%	0.259	S	S	.	.	T	Hydrogen-bonded Turn	trans	-121.4	-12.6	-175.8	61.8	0	0	0	0	114.6	R45 E50	R45-T48 PolarHBondContact NE-OG1 2.87Å; R45-T48 PolarHBondContact NH2-OG1 3.12Å; R45-T48 PolarHBondContact O-N 3.28Å; T48-E50 VanDerWaalsContact CB-OE2 3.31Å; T48-E50 WeakPolarHBondContact CB-OE2 3.26Å; T48-E50 PolarHBondContact O-N 3.29Å; T48-E50 WeakPolarHBondContact OG1-CB 3.46Å; T48-E50 WeakPolarHBondContact OG1-CG 3.38Å; T48-E50 PolarHBondContact OG1-N 3.49Å; T48-E50 PolarHBondContact OG1-OE2 3.39Å
49	G	81.7	Confident	79.4	Confident	50 Å²	50	48 Å²	48	52%	0.515	26%	0.256	S	S	.	.			trans	71	9	-172.4	0	0	0	0	0	113.8	R45	R45-G49 VanDerWaalsContact O-CA 3.31Å; R45-G49 WeakPolarHBondContact O-CA 3.31Å; R45-G49 PolarHBondContact O-N 3.41Å
50	E	77.2	Confident	78.6	Confident	86 Å²	86	48.7 Å²	48.7	40%	0.402	26%	0.262	S	S	.	.			trans	-74.3	138.3	179.8	-74.8	170.6	111.8	0	0	111.4	I44 R45 T48 F52	I44-E50 WeakPolarHBondContact CA-O 3.45Å; R45-E50 IonicContact CZ-OE2 3.45Å; R45-E50 PolarHBondContact N-O 3.08Å; R45-E50 IonicContact NE-OE2 3.76Å; R45-E50 IonicContact NH2-OE2 2.62Å; R45-E50 PolarHBondContact NH2-OE2 3.09Å; T48-E50 VanDerWaalsContact CB-OE2 3.31Å; T48-E50 WeakPolarHBondContact CB-OE2 3.26Å; T48-E50 PolarHBondContact O-N 3.29Å; T48-E50 WeakPolarHBondContact OG1-CB 3.46Å; T48-E50 WeakPolarHBondContact OG1-CG 3.38Å; T48-E50 PolarHBondContact OG1-N 3.49Å; T48-E50 PolarHBondContact OG1-OE2 3.39Å; E50-F52 HydrophobicContact CB-CD2 4.35Å; E50-F52 HydrophobicContact CB-CE2 3.45Å; E50-F52 VanDerWaalsContact CB-CE2 3.45Å; E50-F52 HydrophobicContact CB-CZ 3.78Å; E50-F52 WeakPolarHBondContact O-CD2 3.21Å; E50-F52 VanDerWaalsContact O-CE2 3.31Å; E50-F52 WeakPolarHBondContact O-CE2 3.46Å
51	E	80.6	Confident	77.4	Confident	85 Å²	85	50.3 Å²	50.3	40%	0.397	28%	0.275	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-89.8	135.9	178	-55.7	-158.8	178.4	0	0	111.7	R42 I44 L113	R42-E51 WeakPolarHBondContact CD-OE2 3.31Å; R42-E51 IonicContact CZ-OE2 3.82Å; R42-E51 IonicContact NH1-OE1 3.12Å; R42-E51 PolarHBondContact NH1-OE1 2.87Å; R42-E51 VanDerWaalsContact NH1-OE1 3.12Å; R42-E51 IonicContact NH1-OE2 2.88Å; R42-E51 PolarHBondContact NH1-OE2 3.24Å; I44-E51 HydrophobicContact CG1-CG 4.23Å; E51-L113 HydrophobicContact CB-CB 4.37Å; E51-L113 HydrophobicContact CB-CD1 4.31Å; E51-L113 PolarHBondContact O-N 3.1Å; E51-L113 VanDerWaalsContact O-N 3.08Å
52	F	78.5	Confident	76.1	Confident	4 Å²	4	56.4 Å²	56.4	2%	0.018	31%	0.307	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.8	146.1	-179.9	-61.1	-90.4	0	0	0	110.5	Y26 R42 C43 R45 E50 V54 C110 F111	Y26-F52 HydrophobicContact CD1-CD2 4.26Å; Y26-F52 AromaticContact CE1-CD2 3.93Å; Y26-F52 HydrophobicContact CE1-CD2 3.93Å; Y26-F52 HydrophobicContact CE1-CE2 4.09Å; R42-F52 CarbonylContact C-O 3.4Å; R42-F52 WeakPolarHBondContact CA-O 3.37Å; C43-F52 PolarHBondContact N-O 3.42Å; C43-F52 WeakPolarHBondContact O-CA 3.47Å; C43-F52 PolarHBondContact O-N 3.25Å; R45-F52 HydrophobicContact CB-CD2 4.25Å; R45-F52 HydrophobicContact CB-CE2 3.75Å; E50-F52 HydrophobicContact CB-CD2 4.35Å; E50-F52 HydrophobicContact CB-CE2 3.45Å; E50-F52 VanDerWaalsContact CB-CE2 3.45Å; E50-F52 HydrophobicContact CB-CZ 3.78Å; E50-F52 WeakPolarHBondContact O-CD2 3.21Å; E50-F52 VanDerWaalsContact O-CE2 3.31Å; E50-F52 WeakPolarHBondContact O-CE2 3.46Å; F52-V54 HydrophobicContact CB-CG2 4.39Å; F52-C110 WeakPolarHBondContact CB-SG 3.3Å; F52-C110 WeakPolarHBondContact CD1-SG 3.24Å; F52-C110 VanDerWaalsContact CG-SG 3.54Å; F52-F111 CarbonylContact C-O 3.59Å; F52-F111 VanDerWaalsContact CA-O 3.24Å; F52-F111 WeakPolarHBondContact CA-O 3.47Å
53	A	80.5	Confident	74.8	Confident	9 Å²	9	63.1 Å²	63.1	7%	0.074	34%	0.337	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.6	119	166.6	0	0	0	0	0	108.8	L32 V40 R41 F111 L113	L32-A53 HydrophobicContact CD1-CB 3.74Å; V40-A53 HydrophobicContact CG1-CB 3.81Å; R41-A53 CarbonylContact O-C 3.56Å; R41-A53 WeakPolarHBondContact O-CA 3.21Å; A53-F111 HydrophobicContact CB-CB 4.28Å; A53-F111 PolarHBondContact N-O 2.8Å; A53-F111 WeakPolarHBondContact O-CB 3.38Å; A53-F111 WeakPolarHBondContact O-CD2 3.48Å; A53-F111 PolarHBondContact O-N 2.97Å; A53-L113 HydrophobicContact CB-CD1 4.04Å; A53-L113 HydrophobicContact CB-CD2 3.95Å; A53-L113 HydrophobicContact CB-CG 3.81Å
54	V	76.9	Confident	73.9	Confident	0 Å²	0	64.5 Å²	64.5	0%	0	35%	0.348	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-109.8	108.4	-174.7	177.8	0	0	0	0	109.1	F22 V40 R41 C43 F52 I56 V108 T109 C110	F22-V54 HydrophobicContact CE1-CG1 4.37Å; F22-V54 HydrophobicContact CE2-CG1 4.29Å; F22-V54 HydrophobicContact CE2-CG2 4.16Å; F22-V54 HydrophobicContact CZ-CB 4.18Å; F22-V54 HydrophobicContact CZ-CG1 3.76Å; F22-V54 HydrophobicContact CZ-CG2 3.78Å; V40-V54 CarbonylContact C-O 3.48Å; V40-V54 VanDerWaalsContact CA-O 3.3Å; V40-V54 WeakPolarHBondContact CA-O 3.31Å; R41-V54 PolarHBondContact N-O 2.69Å; R41-V54 PolarHBondContact O-N 2.62Å; C43-V54 HydrophobicContact CB-CB 4.4Å; C43-V54 HydrophobicContact CB-CG2 3.64Å; C43-V54 VanDerWaalsContact SG-CG2 3.53Å; F52-V54 HydrophobicContact CB-CG2 4.39Å; V54-I56 HydrophobicContact CG1-CG1 4.16Å; V54-I56 PolarHBondContact O-N 3.13Å; V54-V108 HydrophobicContact CG1-CG1 3.2Å; V54-T109 CarbonylContact C-O 3.51Å; V54-T109 WeakPolarHBondContact CA-O 3.38Å; V54-C110 HydrophobicContact CG2-CB 4.03Å
55	K	77.1	Confident	73.2	Confident	39 Å²	39	66.2 Å²	66.2	17%	0.17	36%	0.36	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.3	103.3	176.3	-170.9	176.9	176.1	-173.1	0	108.6	S38 T39 V40 I57 E79 V108 T109 F111	S38-K55 WeakPolarHBondContact OG-CE 3.49Å; T39-K55 CarbonylContact O-C 3.59Å; T39-K55 WeakPolarHBondContact O-CA 3.43Å; V40-K55 HydrophobicContact CG2-CB 4.03Å; V40-K55 HydrophobicContact CG2-CD 4.48Å; V40-K55 HydrophobicContact CG2-CG 3.94Å; K55-I57 HydrophobicContact CG-CG1 4.17Å; K55-E79 IonicContact NZ-OE1 2.87Å; K55-E79 PolarHBondContact NZ-OE1 3.49Å; K55-E79 IonicContact NZ-OE2 3.73Å; K55-V108 WeakPolarHBondContact O-CA 3.45Å; K55-T109 PolarHBondContact N-O 3.37Å; K55-T109 PolarHBondContact O-N 3.49Å; K55-F111 HydrophobicContact CB-CD2 4.28Å; K55-F111 HydrophobicContact CB-CE2 3.69Å; K55-F111 HydrophobicContact CD-CE2 4.09Å; K55-F111 HydrophobicContact CD-CZ 4.41Å
56	I	75.2	Confident	72.8	Confident	39 Å²	39	66.6 Å²	66.6	20%	0.2	38%	0.377	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.7	108.1	174.1	-54.4	170.5	0	0	0	106.7	S38 T39 R41 V54 V108	S38-I56 CarbonylContact C-O 3.56Å; S38-I56 WeakPolarHBondContact CA-O 3.19Å; T39-I56 PolarHBondContact N-O 2.75Å; T39-I56 PolarHBondContact O-N 2.7Å; R41-I56 HydrophobicContact CG-CD1 4.27Å; V54-I56 HydrophobicContact CG1-CG1 4.16Å; V54-I56 PolarHBondContact O-N 3.13Å; I56-V108 HydrophobicContact CG1-CG2 4.45Å; I56-V108 HydrophobicContact CG2-CG2 4.49Å
57	I	75.2	Confident	72.5	Confident	7 Å²	7	66.6 Å²	66.6	4%	0.036	38%	0.379	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.7	118.3	176.8	-56.9	167.5	0	0	0	106.8	S37 K55 L59 T76 A106 A107	S37-I57 WeakPolarHBondContact O-CA 3.41Å; K55-I57 HydrophobicContact CG-CG1 4.17Å; I57-L59 HydrophobicContact CG2-CD2 3.88Å; I57-L59 PolarHBondContact O-N 2.86Å; I57-T76 HydrophobicContact CD1-CG2 3.54Å; I57-A106 CarbonylContact O-C 3.58Å; I57-A106 WeakPolarHBondContact O-CA 3.38Å; I57-A107 HydrophobicContact CB-CB 4.26Å; I57-A107 WeakPolarHBondContact CB-O 3.15Å; I57-A107 HydrophobicContact CD1-CB 4.46Å; I57-A107 PolarHBondContact N-O 2.76Å; I57-A107 PolarHBondContact O-N 2.83Å
58	D	71	Confident	72.1	Confident	83 Å²	83	65.9 Å²	65.9	44%	0.444	36%	0.364	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.6	107.9	178.1	-167.3	-9	0	0	0	108.6	S37 S60	S37-D58 PolarHBondContact O-N 3.3Å; D58-S60 VanDerWaalsContact C-N 3.31Å; D58-S60 VanDerWaalsContact OD1-CA 3.29Å; D58-S60 WeakPolarHBondContact OD1-CA 3.36Å; D58-S60 WeakPolarHBondContact OD1-CB 3.4Å; D58-S60 PolarHBondContact OD1-N 2.82Å
59	L	67.5	Low	71.5	Confident	12 Å²	12	63.6 Å²	63.6	6%	0.063	35%	0.35	C	S	.	.			trans	-91.8	-0.1	171.9	-41.6	169.1	0	0	0	110.7	I57 V69 L72 N105 A107	I57-L59 HydrophobicContact CG2-CD2 3.88Å; I57-L59 PolarHBondContact O-N 2.86Å; L59-V69 HydrophobicContact CB-CG1 4.17Å; L59-V69 WeakPolarHBondContact O-CG2 3.19Å; L59-L72 HydrophobicContact CD2-CB 3.54Å; L59-L72 HydrophobicContact CD2-CD1 4.21Å; L59-L72 HydrophobicContact CD2-CG 4.47Å; L59-N105 CarbonylContact C-O 3.49Å; L59-N105 WeakPolarHBondContact CA-O 3.49Å; L59-N105 HydrophobicContact CB-CB 4.07Å; L59-N105 WeakPolarHBondContact CB-O 3.49Å; L59-N105 PolarHBondContact N-O 2.92Å; L59-A107 HydrophobicContact CD1-CB 4.28Å
60	S	63.4	Low	71.2	Confident	59 Å²	59	67.9 Å²	67.9	41%	0.413	35%	0.351	S	S	.	.			trans	-95.4	14.1	-176.3	-165.7	0	0	0	0	112.9	D58 E62 N105	D58-S60 VanDerWaalsContact C-N 3.31Å; D58-S60 VanDerWaalsContact OD1-CA 3.29Å; D58-S60 WeakPolarHBondContact OD1-CA 3.36Å; D58-S60 WeakPolarHBondContact OD1-CB 3.4Å; D58-S60 PolarHBondContact OD1-N 2.82Å; S60-E62 PolarHBondContact O-N 3.17Å; S60-N105 PolarHBondContact N-O 2.75Å
61	S	60	Low	71.3	Confident	69 Å²	69	70.1 Å²	70.1	48%	0.483	36%	0.361	S	S	.	.			trans	-46.8	118	173.7	-176.5	0	0	0	0	108.4	K63 A64	S61-K63 PolarHBondContact O-N 2.7Å; S61-A64 VanDerWaalsContact O-CB 3.32Å; S61-A64 WeakPolarHBondContact O-CB 3.47Å; S61-A64 PolarHBondContact O-N 2.89Å
62	E	56	Low	70.9	Confident	204 Å²	204	68.6 Å²	68.6	95%	0.953	36%	0.356	S	S	*	.	T	Hydrogen-bonded Turn	trans	-56	-5.5	-173	-75.2	174.1	84.5	0	0	113.8	S60	S60-E62 PolarHBondContact O-N 3.17Å
63	K	57.1	Low	70.8	Confident	188 Å²	188	73.8 Å²	73.8	82%	0.817	38%	0.375	S	S	*	.	T	Hydrogen-bonded Turn	trans	-108.7	-1.7	178.4	-57.7	-175.1	-179.7	-177.1	0	113.8	S61 Q68	S61-K63 PolarHBondContact O-N 2.7Å; K63-Q68 PolarHBondContact O-OE1 3.4Å
64	A	62.8	Low	70.7	Confident	28 Å²	28	78 Å²	78	23%	0.231	40%	0.396	C	S	.	.			trans	-83.7	116.7	-176	0	0	0	0	0	110.9	S61 Q68 V69	S61-A64 VanDerWaalsContact O-CB 3.32Å; S61-A64 WeakPolarHBondContact O-CB 3.47Å; S61-A64 PolarHBondContact O-N 2.89Å; A64-Q68 HydrophobicContact CB-CB 4.17Å; A64-V69 HydrophobicContact CB-CG2 4Å
65	T	70	Confident	70.6	Confident	70 Å²	70	81.2 Å²	81.2	43%	0.429	42%	0.419	S	S	.	.			trans	-65.8	158.9	169.5	62.9	0	0	0	0	110.2	E67 Q68 V69	T65-E67 PolarHBondContact O-N 3.49Å; T65-Q68 PolarHBondContact O-N 3.17Å; T65-Q68 WeakPolarHBondContact OG1-CG 3.45Å; T65-Q68 PolarHBondContact OG1-N 3.15Å; T65-Q68 PolarHBondContact OG1-OE1 2.85Å; T65-V69 PolarHBondContact O-N 2.85Å
66	A	72.5	Confident	70.4	Confident	72 Å²	72	79.8 Å²	79.8	60%	0.595	41%	0.414	S	S	*	.	H	α-helix	trans	-54.3	-26.7	174.7	0	0	0	0	0	112.8	R70	A66-R70 VanDerWaalsContact O-CG 3.3Å; A66-R70 WeakPolarHBondContact O-CG 3.41Å; A66-R70 PolarHBondContact O-N 3.2Å; A66-R70 VanDerWaalsContact O-N 3.13Å; A66-R70 PolarHBondContact O-NE 3.3Å
67	E	76.5	Confident	70.4	Confident	122 Å²	122	81 Å²	81	57%	0.57	42%	0.42	S	S	*	.	H	α-helix	trans	-69.1	-48.5	172.2	-69.1	160.9	179.8	0	0	111.9	T65 V69 R70 E71	T65-E67 PolarHBondContact O-N 3.49Å; E67-V69 VanDerWaalsContact C-N 3.31Å; E67-V69 PolarHBondContact O-N 2.77Å; E67-R70 VanDerWaalsContact CG-NH2 3.26Å; E67-R70 CarbonylContact O-C 3.59Å; E67-R70 WeakPolarHBondContact O-CA 3.1Å; E67-R70 WeakPolarHBondContact O-CB 3.44Å; E67-R70 PolarHBondContact O-N 3.45Å; E67-R70 VanDerWaalsContact O-N 3.07Å; E67-E71 WeakPolarHBondContact O-CG 3.34Å; E67-E71 PolarHBondContact O-N 2.81Å
68	Q	71.6	Confident	70.6	Confident	86 Å²	86	89 Å²	89	40%	0.402	45%	0.45	S	S	.	.	H	α-helix	trans	-62.5	-38.2	176.5	-70.3	172	-49	0	0	112.1	K63 A64 T65 R70 E71 L72	K63-Q68 PolarHBondContact O-OE1 3.4Å; A64-Q68 HydrophobicContact CB-CB 4.17Å; T65-Q68 PolarHBondContact O-N 3.17Å; T65-Q68 WeakPolarHBondContact OG1-CG 3.45Å; T65-Q68 PolarHBondContact OG1-N 3.15Å; T65-Q68 PolarHBondContact OG1-OE1 2.85Å; Q68-R70 VanDerWaalsContact C-N 3.32Å; Q68-R70 PolarHBondContact O-N 2.84Å; Q68-E71 PolarHBondContact O-N 3.31Å; Q68-L72 WeakPolarHBondContact O-CB 3.25Å; Q68-L72 VanDerWaalsContact O-CG 3.24Å; Q68-L72 WeakPolarHBondContact O-CG 3.23Å; Q68-L72 PolarHBondContact O-N 3.24Å
69	V	71.1	Confident	70.6	Confident	24 Å²	24	88.5 Å²	88.5	15%	0.145	45%	0.445	C	S	.	.	H	α-helix	trans	-61.9	-41.6	173.2	176.9	0	0	0	0	111	L59 A64 T65 E67 R73	L59-V69 HydrophobicContact CB-CG1 4.17Å; L59-V69 WeakPolarHBondContact O-CG2 3.19Å; A64-V69 HydrophobicContact CB-CG2 4Å; T65-V69 PolarHBondContact O-N 2.85Å; E67-V69 VanDerWaalsContact C-N 3.31Å; E67-V69 PolarHBondContact O-N 2.77Å; V69-R73 VanDerWaalsContact O-CB 3.24Å; V69-R73 WeakPolarHBondContact O-CB 3.36Å; V69-R73 PolarHBondContact O-N 2.85Å
70	R	75.3	Confident	70.7	Confident	140 Å²	140	88.2 Å²	88.2	53%	0.528	44%	0.443	S	S	.	.	H	α-helix	trans	-64	-47.2	174.7	-78.1	-177.2	-68.9	-144.4	4.2	111.7	A66 E67 Q68 L72 R73 D74	A66-R70 VanDerWaalsContact O-CG 3.3Å; A66-R70 WeakPolarHBondContact O-CG 3.41Å; A66-R70 PolarHBondContact O-N 3.2Å; A66-R70 VanDerWaalsContact O-N 3.13Å; A66-R70 PolarHBondContact O-NE 3.3Å; E67-R70 VanDerWaalsContact CG-NH2 3.26Å; E67-R70 CarbonylContact O-C 3.59Å; E67-R70 WeakPolarHBondContact O-CA 3.1Å; E67-R70 WeakPolarHBondContact O-CB 3.44Å; E67-R70 PolarHBondContact O-N 3.45Å; E67-R70 VanDerWaalsContact O-N 3.07Å; Q68-R70 VanDerWaalsContact C-N 3.32Å; Q68-R70 PolarHBondContact O-N 2.84Å; R70-L72 PolarHBondContact O-N 2.6Å; R70-R73 WeakPolarHBondContact O-CB 3.13Å; R70-R73 PolarHBondContact O-N 3.16Å; R70-D74 WeakPolarHBondContact O-CB 3.31Å; R70-D74 PolarHBondContact O-N 3.17Å
71	E	78.3	Confident	71.3	Confident	133 Å²	133	91.9 Å²	91.9	62%	0.621	45%	0.452	S	S	*	.	H	α-helix	trans	-61	-43.7	177.3	-72.7	-179.7	-179.2	0	0	112.2	E67 Q68 D74 S75	E67-E71 WeakPolarHBondContact O-CG 3.34Å; E67-E71 PolarHBondContact O-N 2.81Å; Q68-E71 PolarHBondContact O-N 3.31Å; E71-D74 PolarHBondContact O-N 3.38Å; E71-S75 WeakPolarHBondContact O-CB 3.38Å; E71-S75 PolarHBondContact O-N 3.4Å
72	L	73.2	Confident	72	Confident	53 Å²	53	92.2 Å²	92.2	28%	0.277	45%	0.447	S	S	.	.	H	α-helix	trans	-64.1	-41.5	175.8	-74.6	170.2	0	0	0	111.4	L59 Q68 R70 S75 T76	L59-L72 HydrophobicContact CD2-CB 3.54Å; L59-L72 HydrophobicContact CD2-CD1 4.21Å; L59-L72 HydrophobicContact CD2-CG 4.47Å; Q68-L72 WeakPolarHBondContact O-CB 3.25Å; Q68-L72 VanDerWaalsContact O-CG 3.24Å; Q68-L72 WeakPolarHBondContact O-CG 3.23Å; Q68-L72 PolarHBondContact O-N 3.24Å; R70-L72 PolarHBondContact O-N 2.6Å; L72-S75 PolarHBondContact O-N 3.24Å; L72-T76 VanDerWaalsContact O-CB 3.25Å; L72-T76 WeakPolarHBondContact O-CB 2.95Å; L72-T76 PolarHBondContact O-N 2.77Å; L72-T76 PolarHBondContact O-OG1 2.73Å
73	R	74.6	Confident	72.5	Confident	113 Å²	113	84.6 Å²	84.6	43%	0.426	41%	0.413	S	S	.	.	H	α-helix	trans	-62.2	-47.2	174.8	-178.8	-178.8	174.2	-156.4	-9	111	V69 R70 T76 L77	V69-R73 VanDerWaalsContact O-CB 3.24Å; V69-R73 WeakPolarHBondContact O-CB 3.36Å; V69-R73 PolarHBondContact O-N 2.85Å; R70-R73 WeakPolarHBondContact O-CB 3.13Å; R70-R73 PolarHBondContact O-N 3.16Å; R73-T76 PolarHBondContact O-N 3.02Å; R73-L77 HydrophobicContact CG-CD1 4.15Å; R73-L77 HydrophobicContact CG-CG 4.5Å; R73-L77 WeakPolarHBondContact O-CB 3.41Å; R73-L77 VanDerWaalsContact O-CG 3.27Å; R73-L77 WeakPolarHBondContact O-CG 3.09Å; R73-L77 PolarHBondContact O-N 3.38Å
74	D	78.6	Confident	73	Confident	96 Å²	96	80 Å²	80	51%	0.513	39%	0.394	S	S	.	.	H	α-helix	trans	-66.5	-39	179.5	-74	-14	0	0	0	111.8	R70 E71 L77 R78	R70-D74 WeakPolarHBondContact O-CB 3.31Å; R70-D74 PolarHBondContact O-N 3.17Å; E71-D74 PolarHBondContact O-N 3.38Å; D74-L77 PolarHBondContact O-N 3.22Å; D74-R78 VanDerWaalsContact O-CB 3.27Å; D74-R78 WeakPolarHBondContact O-CB 3.29Å; D74-R78 PolarHBondContact O-N 2.83Å
75	S	75.9	Confident	73.5	Confident	69 Å²	69	85.1 Å²	85.1	48%	0.483	42%	0.415	S	S	.	.	H	α-helix	trans	-61.7	-47.4	172.7	-175.1	0	0	0	0	110.8	E71 L72 L77 R78 E79	E71-S75 WeakPolarHBondContact O-CB 3.38Å; E71-S75 PolarHBondContact O-N 3.4Å; L72-S75 PolarHBondContact O-N 3.24Å; S75-L77 PolarHBondContact O-N 3.18Å; S75-R78 WeakPolarHBondContact O-CB 2.99Å; S75-R78 PolarHBondContact O-N 3.23Å; S75-R78 VanDerWaalsContact O-N 3.17Å; S75-E79 WeakPolarHBondContact O-CB 3.17Å; S75-E79 PolarHBondContact O-N 3.21Å
76	T	72.5	Confident	73.3	Confident	9 Å²	9	86.8 Å²	86.8	6%	0.055	42%	0.416	C	S	.	.	H	α-helix	trans	-61.4	-46	176.8	-58.9	0	0	0	0	110.9	I57 L72 R73 R78 E79 I80 A107	I57-T76 HydrophobicContact CD1-CG2 3.54Å; L72-T76 VanDerWaalsContact O-CB 3.25Å; L72-T76 WeakPolarHBondContact O-CB 2.95Å; L72-T76 PolarHBondContact O-N 2.77Å; L72-T76 PolarHBondContact O-OG1 2.73Å; R73-T76 PolarHBondContact O-N 3.02Å; T76-R78 VanDerWaalsContact C-N 3.29Å; T76-R78 PolarHBondContact O-N 2.84Å; T76-E79 PolarHBondContact O-N 3.48Å; T76-I80 HydrophobicContact CG2-CD1 3.66Å; T76-I80 HydrophobicContact CG2-CG1 4.37Å; T76-I80 VanDerWaalsContact O-CB 3.31Å; T76-I80 WeakPolarHBondContact O-CB 3.32Å; T76-I80 WeakPolarHBondContact O-CD1 3.29Å; T76-I80 WeakPolarHBondContact O-CG1 3.16Å; T76-I80 PolarHBondContact O-N 2.83Å; T76-A107 HydrophobicContact CG2-CB 3.86Å
77	L	74.7	Confident	72.8	Confident	63 Å²	63	86.2 Å²	86.2	33%	0.33	41%	0.408	S	S	.	.	H	α-helix	trans	-62.1	-36.9	175.8	-74	173.8	0	0	0	112	R73 D74 S75 K81	R73-L77 HydrophobicContact CG-CD1 4.15Å; R73-L77 HydrophobicContact CG-CG 4.5Å; R73-L77 WeakPolarHBondContact O-CB 3.41Å; R73-L77 VanDerWaalsContact O-CG 3.27Å; R73-L77 WeakPolarHBondContact O-CG 3.09Å; R73-L77 PolarHBondContact O-N 3.38Å; D74-L77 PolarHBondContact O-N 3.22Å; S75-L77 PolarHBondContact O-N 3.18Å; L77-K81 VanDerWaalsContact O-CB 3.23Å; L77-K81 WeakPolarHBondContact O-CB 3.1Å; L77-K81 PolarHBondContact O-N 2.91Å
78	R	79.6	Confident	72	Confident	176 Å²	176	84.2 Å²	84.2	66%	0.664	42%	0.42	S	S	*	.	H	α-helix	trans	-68.4	-45.7	175.7	-171.6	-177.3	-61.1	-166.3	1.6	111.4	D74 S75 T76 I80 K81 I82	D74-R78 VanDerWaalsContact O-CB 3.27Å; D74-R78 WeakPolarHBondContact O-CB 3.29Å; D74-R78 PolarHBondContact O-N 2.83Å; S75-R78 WeakPolarHBondContact O-CB 2.99Å; S75-R78 PolarHBondContact O-N 3.23Å; S75-R78 VanDerWaalsContact O-N 3.17Å; T76-R78 VanDerWaalsContact C-N 3.29Å; T76-R78 PolarHBondContact O-N 2.84Å; R78-I80 VanDerWaalsContact C-N 3.35Å; R78-K81 PolarHBondContact O-N 3.47Å; R78-I82 HydrophobicContact CG-CD1 4.14Å; R78-I82 VanDerWaalsContact O-CG1 3.26Å; R78-I82 WeakPolarHBondContact O-CG1 3.27Å; R78-I82 PolarHBondContact O-N 3.36Å
79	E	71.1	Confident	71.4	Confident	72 Å²	72	85.9 Å²	85.9	34%	0.336	43%	0.428	S	S	.	.	H	α-helix	trans	-57.8	-50.1	175	-175.5	178.5	162.7	0	0	109.8	K55 S75 T76 K81 I82 L83	K55-E79 IonicContact NZ-OE1 2.87Å; K55-E79 PolarHBondContact NZ-OE1 3.49Å; K55-E79 IonicContact NZ-OE2 3.73Å; S75-E79 WeakPolarHBondContact O-CB 3.17Å; S75-E79 PolarHBondContact O-N 3.21Å; T76-E79 PolarHBondContact O-N 3.48Å; E79-K81 PolarHBondContact O-N 3.36Å; E79-I82 PolarHBondContact O-N 2.9Å; E79-L83 HydrophobicContact CG-CD1 3.79Å; E79-L83 WeakPolarHBondContact O-CD1 3.41Å; E79-L83 WeakPolarHBondContact O-CG 3.49Å; E79-L83 PolarHBondContact O-N 3.23Å
80	I	69.3	Low	70.8	Confident	6 Å²	6	94.2 Å²	94.2	3%	0.031	46%	0.462	C	S	.	.	H	α-helix	trans	-55.7	-48.7	174.5	-72	164.4	0	0	0	111.3	T76 R78 I82 L83 Q84 L98 T109	T76-I80 HydrophobicContact CG2-CD1 3.66Å; T76-I80 HydrophobicContact CG2-CG1 4.37Å; T76-I80 VanDerWaalsContact O-CB 3.31Å; T76-I80 WeakPolarHBondContact O-CB 3.32Å; T76-I80 WeakPolarHBondContact O-CD1 3.29Å; T76-I80 WeakPolarHBondContact O-CG1 3.16Å; T76-I80 PolarHBondContact O-N 2.83Å; R78-I80 VanDerWaalsContact C-N 3.35Å; I80-I82 VanDerWaalsContact C-N 3.33Å; I80-I82 PolarHBondContact O-N 3.39Å; I80-L83 PolarHBondContact O-N 2.78Å; I80-Q84 HydrophobicContact CG2-CG 4.23Å; I80-Q84 WeakPolarHBondContact O-CB 3.24Å; I80-Q84 VanDerWaalsContact O-CG 3.29Å; I80-Q84 WeakPolarHBondContact O-CG 3.32Å; I80-Q84 PolarHBondContact O-N 3.45Å; I80-L98 HydrophobicContact CB-CD2 4.35Å; I80-L98 HydrophobicContact CD1-CD2 3.45Å; I80-L98 VanDerWaalsContact CD1-CD2 3.45Å; I80-L98 HydrophobicContact CG1-CD2 3.74Å; I80-L98 HydrophobicContact CG2-CD1 3.38Å; I80-L98 HydrophobicContact CG2-CD2 3.66Å; I80-L98 HydrophobicContact CG2-CG 4.03Å; I80-T109 HydrophobicContact CG1-CG2 4.48Å
81	K	76	Confident	69.9	Low	137 Å²	137	94.4 Å²	94.4	60%	0.596	47%	0.474	S	S	*	.	H	α-helix	trans	-62	-42.2	-179.5	-177.3	175.8	-177.6	177	0	111.5	L77 R78 E79 L83 Q84 M85	L77-K81 VanDerWaalsContact O-CB 3.23Å; L77-K81 WeakPolarHBondContact O-CB 3.1Å; L77-K81 PolarHBondContact O-N 2.91Å; R78-K81 PolarHBondContact O-N 3.47Å; E79-K81 PolarHBondContact O-N 3.36Å; K81-L83 VanDerWaalsContact C-N 3.34Å; K81-Q84 PolarHBondContact O-N 2.81Å; K81-M85 WeakPolarHBondContact O-CG 3.27Å; K81-M85 PolarHBondContact O-N 2.74Å; K81-M85 VanDerWaalsContact O-N 3.09Å
82	I	75.6	Confident	68.9	Low	76 Å²	76	90.6 Å²	90.6	39%	0.39	46%	0.457	S	S	.	.	H	α-helix	trans	-59	-50.7	174.5	-69.4	165.2	0	0	0	109.4	R78 E79 I80 Q84 M85 F86	R78-I82 HydrophobicContact CG-CD1 4.14Å; R78-I82 VanDerWaalsContact O-CG1 3.26Å; R78-I82 WeakPolarHBondContact O-CG1 3.27Å; R78-I82 PolarHBondContact O-N 3.36Å; E79-I82 PolarHBondContact O-N 2.9Å; I80-I82 VanDerWaalsContact C-N 3.33Å; I80-I82 PolarHBondContact O-N 3.39Å; I82-Q84 VanDerWaalsContact C-N 3.32Å; I82-Q84 PolarHBondContact O-N 3.11Å; I82-M85 HydrophobicContact CB-CE 4.36Å; I82-M85 HydrophobicContact CG1-CE 4.11Å; I82-M85 WeakPolarHBondContact O-CB 3.43Å; I82-M85 PolarHBondContact O-N 3.24Å; I82-M85 VanDerWaalsContact O-N 3.08Å; I82-F86 HydrophobicContact CG2-CD2 4.2Å; I82-F86 HydrophobicContact CG2-CE2 3.97Å; I82-F86 WeakPolarHBondContact O-CD2 2.94Å; I82-F86 PolarHBondContact O-N 3.34Å
83	L	66.2	Low	67.9	Low	44 Å²	44	91 Å²	91	23%	0.23	46%	0.464	C	S	.	.	H	α-helix	trans	-69.1	-30.8	-176.8	-61.2	160.8	0	0	0	112.9	E79 I80 K81 M85 F86 S87 F96 F111	E79-L83 HydrophobicContact CG-CD1 3.79Å; E79-L83 WeakPolarHBondContact O-CD1 3.41Å; E79-L83 WeakPolarHBondContact O-CG 3.49Å; E79-L83 PolarHBondContact O-N 3.23Å; I80-L83 PolarHBondContact O-N 2.78Å; K81-L83 VanDerWaalsContact C-N 3.34Å; L83-M85 VanDerWaalsContact C-N 3.31Å; L83-M85 PolarHBondContact O-N 3.16Å; L83-F86 CarbonylContact O-C 3.49Å; L83-F86 PolarHBondContact O-N 2.74Å; L83-F86 VanDerWaalsContact O-N 3.12Å; L83-S87 PolarHBondContact O-N 2.81Å; L83-F96 HydrophobicContact CB-CD2 4.29Å; L83-F96 HydrophobicContact CB-CE1 3.83Å; L83-F96 HydrophobicContact CB-CE2 3.32Å; L83-F96 HydrophobicContact CB-CZ 3.08Å; L83-F96 HydrophobicContact CD1-CE1 3.73Å; L83-F96 HydrophobicContact CD1-CZ 3.5Å; L83-F96 VanDerWaalsContact CD1-CZ 3.5Å; L83-F96 HydrophobicContact CD2-CZ 4.11Å; L83-F96 HydrophobicContact CG-CE1 4.36Å; L83-F96 HydrophobicContact CG-CE2 4.37Å; L83-F96 HydrophobicContact CG-CZ 3.72Å; L83-F111 HydrophobicContact CD1-CE1 4.16Å; L83-F111 HydrophobicContact CD1-CZ 4.42Å
84	Q	68.5	Low	67	Low	90 Å²	90	87.2 Å²	87.2	42%	0.421	45%	0.453	S	S	.	.	H	α-helix	trans	-62.4	-36.8	170	-79.4	-180	-29.5	0	0	111.9	I80 K81 I82 F86 S87 L98	I80-Q84 HydrophobicContact CG2-CG 4.23Å; I80-Q84 WeakPolarHBondContact O-CB 3.24Å; I80-Q84 VanDerWaalsContact O-CG 3.29Å; I80-Q84 WeakPolarHBondContact O-CG 3.32Å; I80-Q84 PolarHBondContact O-N 3.45Å; K81-Q84 PolarHBondContact O-N 2.81Å; I82-Q84 VanDerWaalsContact C-N 3.32Å; I82-Q84 PolarHBondContact O-N 3.11Å; Q84-F86 PolarHBondContact O-N 2.96Å; Q84-S87 WeakPolarHBondContact O-CB 3.37Å; Q84-S87 PolarHBondContact O-N 2.77Å; Q84-S87 VanDerWaalsContact O-N 3.13Å; Q84-S87 PolarHBondContact O-OG 3.37Å; Q84-L98 VanDerWaalsContact NE2-CD1 3.32Å
85	M	71.9	Confident	65.7	Low	136 Å²	136	89.2 Å²	89.2	67%	0.67	46%	0.46	S	S	*	.	H	α-helix	trans	-64	-26.4	174.3	-67.8	-174.2	-69.2	0	0	112.5	K81 I82 L83	K81-M85 WeakPolarHBondContact O-CG 3.27Å; K81-M85 PolarHBondContact O-N 2.74Å; K81-M85 VanDerWaalsContact O-N 3.09Å; I82-M85 HydrophobicContact CB-CE 4.36Å; I82-M85 HydrophobicContact CG1-CE 4.11Å; I82-M85 WeakPolarHBondContact O-CB 3.43Å; I82-M85 PolarHBondContact O-N 3.24Å; I82-M85 VanDerWaalsContact O-N 3.08Å; L83-M85 VanDerWaalsContact C-N 3.31Å; L83-M85 PolarHBondContact O-N 3.16Å
86	F	65.6	Low	64.7	Low	105 Å²	105	87.4 Å²	87.4	46%	0.461	44%	0.443	S	S	.	.	H	α-helix	trans	-93	-9.6	175.3	-70.1	-78.2	0	0	0	113.8	I82 L83 Q84 G88 H89 I92	I82-F86 HydrophobicContact CG2-CD2 4.2Å; I82-F86 HydrophobicContact CG2-CE2 3.97Å; I82-F86 WeakPolarHBondContact O-CD2 2.94Å; I82-F86 PolarHBondContact O-N 3.34Å; L83-F86 CarbonylContact O-C 3.49Å; L83-F86 PolarHBondContact O-N 2.74Å; L83-F86 VanDerWaalsContact O-N 3.12Å; Q84-F86 PolarHBondContact O-N 2.96Å; F86-G88 PolarHBondContact O-N 3.34Å; F86-G88 VanDerWaalsContact O-N 3.16Å; F86-H89 PolarHBondContact O-N 3Å; F86-I92 HydrophobicContact CB-CD1 3.79Å; F86-I92 HydrophobicContact CB-CG2 4.13Å; F86-I92 HydrophobicContact CD1-CD1 3.46Å; F86-I92 VanDerWaalsContact CD1-CD1 3.46Å; F86-I92 HydrophobicContact CE1-CD1 4.36Å; F86-I92 HydrophobicContact CG-CD1 3.92Å
87	S	61.9	Low	63.7	Low	60 Å²	60	88.9 Å²	88.9	42%	0.42	45%	0.452	S	S	.	.	T	Hydrogen-bonded Turn	trans	-66.5	114.2	178.2	70.7	0	0	0	0	109.7	L83 Q84	L83-S87 PolarHBondContact O-N 2.81Å; Q84-S87 WeakPolarHBondContact O-CB 3.37Å; Q84-S87 PolarHBondContact O-N 2.77Å; Q84-S87 VanDerWaalsContact O-N 3.13Å; Q84-S87 PolarHBondContact O-OG 3.37Å
88	G	59.8	Low	62.4	Low	80 Å²	80	88.3 Å²	88.3	83%	0.825	45%	0.449	S	S	*	.	T	Hydrogen-bonded Turn	trans	122.2	-7.3	-175.6	0	0	0	0	0	115.1	F86	F86-G88 PolarHBondContact O-N 3.34Å; F86-G88 VanDerWaalsContact O-N 3.16Å
89	H	60	Low	61.2	Low	121 Å²	121	82.2 Å²	82.2	56%	0.56	43%	0.428	S	S	*	.			trans	-79.9	131.3	173.4	-142.1	-112.4	0	0	0	110.9	F86 N91 I92	F86-H89 PolarHBondContact O-N 3Å; H89-N91 PolarHBondContact O-N 3.24Å; H89-I92 HydrophobicContact CB-CB 4.05Å; H89-I92 HydrophobicContact CB-CD1 4.12Å; H89-I92 HydrophobicContact CB-CG1 4.13Å; H89-I92 CarbonylContact O-C 3.52Å; H89-I92 PolarHBondContact O-N 3.48Å; H89-I92 VanDerWaalsContact O-O 3.14Å
90	K	58.5	Low	60.1	Low	199 Å²	199	82.7 Å²	82.7	87%	0.865	43%	0.43	S	S	*	.	T	Hydrogen-bonded Turn	trans	-58.6	-18.1	-179.8	-74.5	-178	178	178.1	0	114.6
91	N	57.1	Low	59.2	Low	144 Å²	144	84 Å²	84	77%	0.77	44%	0.438	S	S	*	.	T	Hydrogen-bonded Turn	trans	-101.4	-3.2	176.2	-66.7	-6.9	0	0	0	113.4	H89	H89-N91 PolarHBondContact O-N 3.24Å
92	I	56	Low	58	Low	54 Å²	54	82.4 Å²	82.4	28%	0.277	43%	0.433	S	S	.	.			trans	-123.7	78.2	178.9	-55.7	173.4	0	0	0	106	F86 H89 V94	F86-I92 HydrophobicContact CB-CD1 3.79Å; F86-I92 HydrophobicContact CB-CG2 4.13Å; F86-I92 HydrophobicContact CD1-CD1 3.46Å; F86-I92 VanDerWaalsContact CD1-CD1 3.46Å; F86-I92 HydrophobicContact CE1-CD1 4.36Å; F86-I92 HydrophobicContact CG-CD1 3.92Å; H89-I92 HydrophobicContact CB-CB 4.05Å; H89-I92 HydrophobicContact CB-CD1 4.12Å; H89-I92 HydrophobicContact CB-CG1 4.13Å; H89-I92 CarbonylContact O-C 3.52Å; H89-I92 PolarHBondContact O-N 3.48Å; H89-I92 VanDerWaalsContact O-O 3.14Å; I92-V94 HydrophobicContact CG2-CB 4.31Å; I92-V94 HydrophobicContact CG2-CG2 3.6Å; I92-V94 PolarHBondContact O-N 2.87Å
93	S	53.2	Low	56.9	Low	61 Å²	61	87.8 Å²	87.8	43%	0.427	45%	0.449	S	S	.	.			trans	-78.3	61.4	-179.9	-55.9	0	0	0	0	111.4	S114	S93-S114 WeakPolarHBondContact CB-OG 3.32Å
94	V	55	Low	56.2	Low	33 Å²	33	87.5 Å²	87.5	20%	0.2	45%	0.453	C	S	.	.			trans	-112.9	88.5	178.6	-158.5	0	0	0	0	108.1	I92 F96 F111	I92-V94 HydrophobicContact CG2-CB 4.31Å; I92-V94 HydrophobicContact CG2-CG2 3.6Å; I92-V94 PolarHBondContact O-N 2.87Å; V94-F96 HydrophobicContact CB-CD2 4.28Å; V94-F96 HydrophobicContact CB-CE2 3.56Å; V94-F96 HydrophobicContact CB-CZ 4.04Å; V94-F96 HydrophobicContact CG1-CD2 3.91Å; V94-F96 HydrophobicContact CG1-CE1 4.03Å; V94-F96 HydrophobicContact CG1-CE2 3.17Å; V94-F96 HydrophobicContact CG1-CZ 3.19Å; V94-F96 WeakPolarHBondContact O-CD2 3.38Å; V94-F96 PolarHBondContact O-N 2.84Å; V94-F111 HydrophobicContact CG1-CB 4.41Å; V94-F111 HydrophobicContact CG1-CD1 3.4Å; V94-F111 HydrophobicContact CG1-CE1 4.07Å; V94-F111 HydrophobicContact CG1-CG 4.32Å
95	Q	51.6	Low	55.7	Low	138 Å²	138	87 Å²	87	65%	0.645	45%	0.453	S	S	*	.			trans	-73.5	109.9	165.8	-166.4	103.1	34.2	0	0	106.8	S112	Q95-S112 PolarHBondContact O-N 2.77Å
96	F	54.9	Low	55.2	Low	32 Å²	32	81.4 Å²	81.4	14%	0.14	43%	0.428	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.3	117.6	173.7	-77.2	-84.5	0	0	0	109.6	L83 V94 T109 F111	L83-F96 HydrophobicContact CB-CD2 4.29Å; L83-F96 HydrophobicContact CB-CE1 3.83Å; L83-F96 HydrophobicContact CB-CE2 3.32Å; L83-F96 HydrophobicContact CB-CZ 3.08Å; L83-F96 HydrophobicContact CD1-CE1 3.73Å; L83-F96 HydrophobicContact CD1-CZ 3.5Å; L83-F96 VanDerWaalsContact CD1-CZ 3.5Å; L83-F96 HydrophobicContact CD2-CZ 4.11Å; L83-F96 HydrophobicContact CG-CE1 4.36Å; L83-F96 HydrophobicContact CG-CE2 4.37Å; L83-F96 HydrophobicContact CG-CZ 3.72Å; V94-F96 HydrophobicContact CB-CD2 4.28Å; V94-F96 HydrophobicContact CB-CE2 3.56Å; V94-F96 HydrophobicContact CB-CZ 4.04Å; V94-F96 HydrophobicContact CG1-CD2 3.91Å; V94-F96 HydrophobicContact CG1-CE1 4.03Å; V94-F96 HydrophobicContact CG1-CE2 3.17Å; V94-F96 HydrophobicContact CG1-CZ 3.19Å; V94-F96 WeakPolarHBondContact O-CD2 3.38Å; V94-F96 PolarHBondContact O-N 2.84Å; F96-T109 HydrophobicContact CD1-CG2 3.71Å; F96-T109 HydrophobicContact CE1-CG2 3.7Å; F96-F111 AromaticContact CE1-CD1 3.91Å; F96-F111 HydrophobicContact CE1-CD1 3.91Å; F96-F111 AromaticContact CE1-CE1 3.44Å; F96-F111 HydrophobicContact CE1-CE1 3.44Å; F96-F111 VanDerWaalsContact CE1-CE1 3.44Å; F96-F111 AromaticContact CE1-CZ 3.89Å; F96-F111 HydrophobicContact CE1-CZ 3.89Å; F96-F111 AromaticContact CZ-CD1 3.99Å; F96-F111 HydrophobicContact CZ-CD1 3.99Å; F96-F111 AromaticContact CZ-CE1 3.61Å; F96-F111 HydrophobicContact CZ-CE1 3.61Å; F96-F111 HydrophobicContact CZ-CZ 4.45Å
97	V	50.9	Low	55.1	Low	39 Å²	39	76.9 Å²	76.9	24%	0.236	41%	0.41	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.1	101	158.9	-177	0	0	0	0	106.6	Q99 C110	V97-Q99 PolarHBondContact O-N 3.31Å; V97-Q99 VanDerWaalsContact O-N 3.15Å; V97-C110 HydrophobicContact CB-CB 3.85Å; V97-C110 PolarHBondContact N-O 3.33Å; V97-C110 VanDerWaalsContact N-O 3.13Å; V97-C110 WeakPolarHBondContact O-CB 3.47Å; V97-C110 PolarHBondContact O-N 3.02Å
98	L	48.6	Very low	55.2	Low	52 Å²	52	74.5 Å²	74.5	27%	0.272	39%	0.393	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.3	97.1	172.4	-71.6	172.8	0	0	0	108.7	I80 Q84 Q100 T109	I80-L98 HydrophobicContact CB-CD2 4.35Å; I80-L98 HydrophobicContact CD1-CD2 3.45Å; I80-L98 VanDerWaalsContact CD1-CD2 3.45Å; I80-L98 HydrophobicContact CG1-CD2 3.74Å; I80-L98 HydrophobicContact CG2-CD1 3.38Å; I80-L98 HydrophobicContact CG2-CD2 3.66Å; I80-L98 HydrophobicContact CG2-CG 4.03Å; Q84-L98 VanDerWaalsContact NE2-CD1 3.32Å; L98-Q100 PolarHBondContact O-N 3.07Å; L98-T109 HydrophobicContact CD2-CG2 4.36Å
99	Q	52.8	Low	55.6	Low	48 Å²	48	71 Å²	71	22%	0.224	36%	0.355	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.6	93.9	161.1	-157.2	100.2	39.9	0	0	106.6	V97 L101	V97-Q99 PolarHBondContact O-N 3.31Å; V97-Q99 VanDerWaalsContact O-N 3.15Å; Q99-L101 VanDerWaalsContact C-N 3.28Å; Q99-L101 PolarHBondContact O-N 3.13Å
100	Q	48.8	Very low	55.8	Low	81 Å²	81	65.3 Å²	65.3	38%	0.379	33%	0.329	S	S	.	.			trans	-67.2	88.7	175	-67.5	-71.8	22	0	0	109	L98 M102	L98-Q100 PolarHBondContact O-N 3.07Å; Q100-M102 HydrophobicContact CB-CG 3.77Å; Q100-M102 PolarHBondContact O-N 3.39Å
101	L	51.3	Low	56.2	Low	35 Å²	35	57.8 Å²	57.8	18%	0.183	30%	0.297	C	S	.	.			trans	-75.5	61.4	171.5	-165.3	77	0	0	0	110.1	Q18 Q99 R103 V108	Q18-L101 HydrophobicContact CB-CD1 4.14Å; Q99-L101 VanDerWaalsContact C-N 3.28Å; Q99-L101 PolarHBondContact O-N 3.13Å; L101-R103 PolarHBondContact O-N 2.96Å; L101-V108 HydrophobicContact CB-CG2 3.9Å; L101-V108 HydrophobicContact CD2-CG2 4.23Å
102	M	49.6	Very low	56.7	Low	103 Å²	103	52.2 Å²	52.2	51%	0.507	27%	0.269	S	S	.	.	T	Hydrogen-bonded Turn	trans	-76.9	32.7	-170.8	-78.5	-85.2	-72.4	0	0	114.3	Q100	Q100-M102 HydrophobicContact CB-CG 3.77Å; Q100-M102 PolarHBondContact O-N 3.39Å
103	R	51.7	Low	57	Low	189 Å²	189	52.9 Å²	52.9	71%	0.713	27%	0.273	S	S	*	.	T	Hydrogen-bonded Turn	trans	-127.6	-7.4	-170.3	-101.3	169.4	162.8	130.9	-3.4	117	L101	L101-R103 PolarHBondContact O-N 2.96Å
104	A	52.4	Low	57.2	Low	38 Å²	38	52 Å²	52	31%	0.314	27%	0.266	S	S	.	.	T	Hydrogen-bonded Turn	trans	-142.8	33.7	-176.5	0	0	0	0	0	114	A106	A104-A106 VanDerWaalsContact C-N 3.31Å; A104-A106 PolarHBondContact O-N 2.92Å
105	N	58.7	Low	57.1	Low	80 Å²	80	56.3 Å²	56.3	43%	0.428	30%	0.295	S	S	.	.	T	Hydrogen-bonded Turn	trans	53.7	46.7	-173.8	-74.3	-11	0	0	0	111.9	L59 S60	L59-N105 CarbonylContact C-O 3.49Å; L59-N105 WeakPolarHBondContact CA-O 3.49Å; L59-N105 HydrophobicContact CB-CB 4.07Å; L59-N105 WeakPolarHBondContact CB-O 3.49Å; L59-N105 PolarHBondContact N-O 2.92Å; S60-N105 PolarHBondContact N-O 2.75Å
106	A	60.1	Low	57.1	Low	17 Å²	17	60.6 Å²	60.6	14%	0.14	31%	0.306	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-142	138.4	171.6	0	0	0	0	0	110.1	I57 A104	I57-A106 CarbonylContact O-C 3.58Å; I57-A106 WeakPolarHBondContact O-CA 3.38Å; A104-A106 VanDerWaalsContact C-N 3.31Å; A104-A106 PolarHBondContact O-N 2.92Å
107	A	65.1	Low	56.6	Low	10 Å²	10	67.2 Å²	67.2	8%	0.083	34%	0.342	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.5	131.4	173	0	0	0	0	0	109.1	I57 L59 T76	I57-A107 HydrophobicContact CB-CB 4.26Å; I57-A107 WeakPolarHBondContact CB-O 3.15Å; I57-A107 HydrophobicContact CD1-CB 4.46Å; I57-A107 PolarHBondContact N-O 2.76Å; I57-A107 PolarHBondContact O-N 2.83Å; L59-A107 HydrophobicContact CD1-CB 4.28Å; T76-A107 HydrophobicContact CG2-CB 3.86Å
108	V	63.7	Low	56.1	Low	11 Å²	11	76.7 Å²	76.7	7%	0.067	39%	0.39	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.9	120.4	-178.4	-177.4	0	0	0	0	108.8	V54 K55 I56 L101	V54-V108 HydrophobicContact CG1-CG1 3.2Å; K55-V108 WeakPolarHBondContact O-CA 3.45Å; I56-V108 HydrophobicContact CG1-CG2 4.45Å; I56-V108 HydrophobicContact CG2-CG2 4.49Å; L101-V108 HydrophobicContact CB-CG2 3.9Å; L101-V108 HydrophobicContact CD2-CG2 4.23Å
109	T	67.5	Low	56.4	Low	5 Å²	5	77.9 Å²	77.9	3%	0.031	40%	0.395	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.5	118.2	174.4	-52.3	0	0	0	0	108.8	V54 K55 I80 F96 L98 F111	V54-T109 CarbonylContact C-O 3.51Å; V54-T109 WeakPolarHBondContact CA-O 3.38Å; K55-T109 PolarHBondContact N-O 3.37Å; K55-T109 PolarHBondContact O-N 3.49Å; I80-T109 HydrophobicContact CG1-CG2 4.48Å; F96-T109 HydrophobicContact CD1-CG2 3.71Å; F96-T109 HydrophobicContact CE1-CG2 3.7Å; L98-T109 HydrophobicContact CD2-CG2 4.36Å; T109-F111 HydrophobicContact CG2-CD2 4.11Å; T109-F111 HydrophobicContact CG2-CE1 4.36Å; T109-F111 HydrophobicContact CG2-CE2 3.41Å; T109-F111 VanDerWaalsContact CG2-CE2 3.41Å; T109-F111 HydrophobicContact CG2-CZ 3.54Å; T109-F111 WeakPolarHBondContact O-CD2 3.49Å
110	C	64.2	Low	56.6	Low	2 Å²	2	79.5 Å²	79.5	1%	0.014	40%	0.404	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-95.5	127.1	177	-174.2	0	0	0	0	109.5	F52 V54 V97	F52-C110 WeakPolarHBondContact CB-SG 3.3Å; F52-C110 WeakPolarHBondContact CD1-SG 3.24Å; F52-C110 VanDerWaalsContact CG-SG 3.54Å; V54-C110 HydrophobicContact CG2-CB 4.03Å; V97-C110 HydrophobicContact CB-CB 3.85Å; V97-C110 PolarHBondContact N-O 3.33Å; V97-C110 VanDerWaalsContact N-O 3.13Å; V97-C110 WeakPolarHBondContact O-CB 3.47Å; V97-C110 PolarHBondContact O-N 3.02Å
111	F	68	Low	57.1	Low	42 Å²	42	79.4 Å²	79.4	18%	0.184	41%	0.406	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.7	125.4	178.2	-61.6	-101	0	0	0	107.5	F52 A53 K55 L83 V94 F96 T109 L113	F52-F111 CarbonylContact C-O 3.59Å; F52-F111 VanDerWaalsContact CA-O 3.24Å; F52-F111 WeakPolarHBondContact CA-O 3.47Å; A53-F111 HydrophobicContact CB-CB 4.28Å; A53-F111 PolarHBondContact N-O 2.8Å; A53-F111 WeakPolarHBondContact O-CB 3.38Å; A53-F111 WeakPolarHBondContact O-CD2 3.48Å; A53-F111 PolarHBondContact O-N 2.97Å; K55-F111 HydrophobicContact CB-CD2 4.28Å; K55-F111 HydrophobicContact CB-CE2 3.69Å; K55-F111 HydrophobicContact CD-CE2 4.09Å; K55-F111 HydrophobicContact CD-CZ 4.41Å; L83-F111 HydrophobicContact CD1-CE1 4.16Å; L83-F111 HydrophobicContact CD1-CZ 4.42Å; V94-F111 HydrophobicContact CG1-CB 4.41Å; V94-F111 HydrophobicContact CG1-CD1 3.4Å; V94-F111 HydrophobicContact CG1-CE1 4.07Å; V94-F111 HydrophobicContact CG1-CG 4.32Å; F96-F111 AromaticContact CE1-CD1 3.91Å; F96-F111 HydrophobicContact CE1-CD1 3.91Å; F96-F111 AromaticContact CE1-CE1 3.44Å; F96-F111 HydrophobicContact CE1-CE1 3.44Å; F96-F111 VanDerWaalsContact CE1-CE1 3.44Å; F96-F111 AromaticContact CE1-CZ 3.89Å; F96-F111 HydrophobicContact CE1-CZ 3.89Å; F96-F111 AromaticContact CZ-CD1 3.99Å; F96-F111 HydrophobicContact CZ-CD1 3.99Å; F96-F111 AromaticContact CZ-CE1 3.61Å; F96-F111 HydrophobicContact CZ-CE1 3.61Å; F96-F111 HydrophobicContact CZ-CZ 4.45Å; T109-F111 HydrophobicContact CG2-CD2 4.11Å; T109-F111 HydrophobicContact CG2-CE1 4.36Å; T109-F111 HydrophobicContact CG2-CE2 3.41Å; T109-F111 VanDerWaalsContact CG2-CE2 3.41Å; T109-F111 HydrophobicContact CG2-CZ 3.54Å; T109-F111 WeakPolarHBondContact O-CD2 3.49Å; F111-L113 PolarHBondContact O-N 3.48Å
112	S	66	Low	57.4	Low	26 Å²	26	82 Å²	82	18%	0.182	42%	0.419	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-65.4	126.6	170.4	174.1	0	0	0	0	110.4	Q95 S114	Q95-S112 PolarHBondContact O-N 2.77Å; S112-S114 VanDerWaalsContact C-N 3.34Å; S112-S114 PolarHBondContact O-N 3.45Å; S112-S114 VanDerWaalsContact O-N 3.09Å
113	L	62.4	Low	57.9	Low	68 Å²	68	80.7 Å²	80.7	36%	0.356	41%	0.413	S	S	.	.			trans	-78.7	90.4	169.7	-75.7	159.1	0	0	0	106.9	L32 R42 E51 A53 F111	L32-L113 HydrophobicContact CD1-CD1 4.01Å; L32-L113 HydrophobicContact CD1-CD2 4.33Å; R42-L113 HydrophobicContact CG-CD1 3.81Å; E51-L113 HydrophobicContact CB-CB 4.37Å; E51-L113 HydrophobicContact CB-CD1 4.31Å; E51-L113 PolarHBondContact O-N 3.1Å; E51-L113 VanDerWaalsContact O-N 3.08Å; A53-L113 HydrophobicContact CB-CD1 4.04Å; A53-L113 HydrophobicContact CB-CD2 3.95Å; A53-L113 HydrophobicContact CB-CG 3.81Å; F111-L113 PolarHBondContact O-N 3.48Å
114	S	58	Low	58.3	Low	42 Å²	42	73.5 Å²	73.5	29%	0.294	39%	0.393	S	S	.	.			trans	-65	132.6	170.7	-78.4	0	0	0	0	109.7	S93 S112 R116	S93-S114 WeakPolarHBondContact CB-OG 3.32Å; S112-S114 VanDerWaalsContact C-N 3.34Å; S112-S114 PolarHBondContact O-N 3.45Å; S112-S114 VanDerWaalsContact O-N 3.09Å; S114-R116 PolarHBondContact O-N 3.41Å
115	P	53.3	Low	58.7	Low	125 Å²	125	76 Å²	76	81%	0.812	40%	0.399	S	S	*	.	T	Hydrogen-bonded Turn	trans	-69.8	20.4	-178.2	26.7	-34	0	0	0	114.3
116	R	50.3	Low	58.7	Low	227 Å²	227	75.7 Å²	75.7	86%	0.857	40%	0.397	S	S	*	.	T	Hydrogen-bonded Turn	trans	-105.4	5.7	-178.2	-78.7	-165.6	172.3	-173.2	-1.9	114.6	S114	S114-R116 PolarHBondContact O-N 3.41Å
117	L	45.7	Very low	58.6	Low	172 Å²	172	80.6 Å²	80.6	90%	0.901	42%	0.418	S	S	*	.			trans	-120.7	18.4	178.4	-113.5	105.9	0	0	0	114.5
118	L	39.4	Very low	58	Low	237 Å²	237	87 Å²	87	100%	1.241	45%	0.449	S	S	*	.			trans	-111.1	0	164.4	-90.9	155.9	0	0	0	109.5

Retrieved 118 of 118 residues in 181.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).