A0A077ZND9_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZND9, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 110 aa.

						>A0A077ZND9_TRITR|A0A077ZND9
MRQLRPTPPRRSRHSVFCSEALKDCSHIFVREPGFSIALAPPYAGPYRVLQRTDKTFTVDAGRVPMTVAIDRTKPAFRLNDVEDTPLPSSRQVTFQWPPGALVASREGVM
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	63	Low	85.2	Confident	241 Å²	241	177.8 Å²	177.8	100%	1.187	85%	0.846	S	S	*	*				0	127.2	0	-65.9	-136.7	-74.4	0	0	109.1	Q3	M1-Q3 PolarHBondContact O-N 3.21Å
2	R	79.4	Confident	85.3	Confident	236 Å²	236	169.9 Å²	169.9	89%	0.891	82%	0.824	S	S	*	*			trans	-76.2	120.8	176.3	-154	177.7	-170.6	-148.3	3.4	107.8	L4	R2-L4 PolarHBondContact O-N 2.89Å
3	Q	80.5	Confident	85.6	Confident	175 Å²	175	174.3 Å²	174.3	82%	0.818	83%	0.826	S	S	*	*			trans	-67.6	100	177.2	-71.7	-177.6	-2.1	0	0	109.1	M1 R5	M1-Q3 PolarHBondContact O-N 3.21Å; Q3-R5 PolarHBondContact O-N 3.37Å
4	L	86.9	Confident	85.6	Confident	155 Å²	155	173.1 Å²	173.1	81%	0.812	82%	0.82	S	S	*	*	P	Polyproline II helix	trans	-72.6	123.4	169.9	-64.1	177.2	0	0	0	108.2	R2	R2-L4 PolarHBondContact O-N 2.89Å
5	R	88.1	Confident	85.6	Confident	215 Å²	215	169.2 Å²	169.2	81%	0.811	82%	0.818	S	S	*	*	P	Polyproline II helix	trans	-91.7	130	170.4	-65	-176.5	-179.4	-175.7	-0.1	108.2	Q3 T7	Q3-R5 PolarHBondContact O-N 3.37Å; R5-T7 PolarHBondContact O-N 3.21Å
6	P	91	Very high	85.7	Confident	126 Å²	126	166.6 Å²	166.6	82%	0.818	82%	0.815	S	S	*	*	P	Polyproline II helix	trans	-64.8	131.1	175.1	25	-30.9	0	0	0	110.2
7	T	90.6	Very high	85.9	Confident	128 Å²	128	167.5 Å²	167.5	79%	0.785	81%	0.814	S	S	*	*	P	Polyproline II helix	trans	-78.9	129	169.9	-54.7	0	0	0	0	108.5	R5	R5-T7 PolarHBondContact O-N 3.21Å
8	P	90.5	Very high	86.1	Confident	106 Å²	106	162.5 Å²	162.5	69%	0.688	80%	0.798	S	S	*	*	P	Polyproline II helix	trans	-62	143.8	177.9	26.2	-34.1	0	0	0	110.6
9	P	90.2	Very high	86.4	Confident	121 Å²	121	155.8 Å²	155.8	79%	0.786	77%	0.769	S	S	*	*	P	Polyproline II helix	trans	-62.4	149.6	176.2	27.3	-34	0	0	0	110.4	R11	P9-R11 PolarHBondContact O-N 3.31Å
10	R	90.3	Very high	86.7	Confident	236 Å²	236	155.7 Å²	155.7	89%	0.891	77%	0.766	S	S	*	*	P	Polyproline II helix	trans	-58.8	124.9	172.5	178.2	-179.1	-76.5	-137.7	-0.5	108.8	S12	R10-S12 PolarHBondContact O-N 2.91Å
11	R	86.2	Confident	86.9	Confident	217 Å²	217	149.7 Å²	149.7	82%	0.819	74%	0.742	S	S	*	*	P	Polyproline II helix	trans	-60.8	128.1	174.3	-162.2	179.7	84.8	-165.6	6.4	109.7	P9 R13	P9-R11 PolarHBondContact O-N 3.31Å; R11-R13 PolarHBondContact O-N 2.9Å
12	S	87	Confident	88.4	Confident	83 Å²	83	138.9 Å²	138.9	58%	0.58	69%	0.689	S	S	*	*	P	Polyproline II helix	trans	-60.3	134.3	167.5	-179.4	0	0	0	0	109.1	R10 H14	R10-S12 PolarHBondContact O-N 2.91Å; S12-H14 VanDerWaalsContact C-N 3.35Å; S12-H14 PolarHBondContact OG-N 2.83Å; S12-H14 PolarHBondContact OG-O 2.73Å
13	R	88.6	Confident	88.9	Confident	227 Å²	227	134.4 Å²	134.4	86%	0.857	68%	0.676	S	S	*	*	S	Bend	trans	-85.5	-13.4	172.5	-65.9	-175.5	178.4	-174.9	-1.3	112.3	R11	R11-R13 PolarHBondContact O-N 2.9Å
14	H	86	Confident	89.4	Confident	158 Å²	158	132.9 Å²	132.9	73%	0.731	67%	0.673	S	S	*	*	S	Bend	trans	-97	138.2	-176.6	-59.4	-76.6	0	0	0	110.5	S12	S12-H14 VanDerWaalsContact C-N 3.35Å; S12-H14 PolarHBondContact OG-N 2.83Å; S12-H14 PolarHBondContact OG-O 2.73Å
15	S	86.4	Confident	89.6	Confident	114 Å²	114	126.2 Å²	126.2	80%	0.797	64%	0.639	S	S	*	*	P	Polyproline II helix	trans	-63.7	149.5	166	52.8	0	0	0	0	110.1	F17	S15-F17 PolarHBondContact O-N 3.15Å
16	V	86.2	Confident	89.9	Confident	128 Å²	128	117.8 Å²	117.8	78%	0.776	61%	0.613	S	S	*	*	P	Polyproline II helix	trans	-64.6	128.2	173.7	-179	0	0	0	0	108.2	C18	V16-C18 PolarHBondContact O-N 3.42Å
17	F	88.8	Confident	90.1	Very high	182 Å²	182	113.3 Å²	113.3	80%	0.798	58%	0.582	S	S	*	*	P	Polyproline II helix	trans	-73.6	126.5	173.3	174.6	-100	0	0	0	109.5	S15	S15-F17 PolarHBondContact O-N 3.15Å
18	C	90.6	Very high	90.4	Very high	77 Å²	77	107.2 Å²	107.2	52%	0.52	54%	0.544	S	S	.	.			trans	-130.1	129.2	168.4	-80.8	0	0	0	0	107.9	V16 E20	V16-C18 PolarHBondContact O-N 3.42Å; C18-E20 PolarHBondContact O-N 3.19Å
19	S	91.4	Very high	90.6	Very high	35 Å²	35	105.6 Å²	105.6	25%	0.245	53%	0.526	C	S	.	.			trans	-65.4	129.5	176.4	179.5	0	0	0	0	109.8	A21 L22	S19-A21 PolarHBondContact O-N 3.44Å; S19-A21 PolarHBondContact OG-N 3.35Å; S19-L22 WeakPolarHBondContact O-CB 3.49Å; S19-L22 PolarHBondContact O-N 3.2Å; S19-L22 VanDerWaalsContact O-N 3.09Å
20	E	92.4	Very high	90.9	Very high	153 Å²	153	99.9 Å²	99.9	72%	0.715	49%	0.489	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.9	-32	176.7	-63.6	-175	154.3	0	0	112	C18 L22 K23	C18-E20 PolarHBondContact O-N 3.19Å; E20-L22 PolarHBondContact O-N 2.68Å; E20-L22 VanDerWaalsContact O-N 3.12Å; E20-K23 VanDerWaalsContact O-CB 3.28Å; E20-K23 WeakPolarHBondContact O-CB 3.37Å; E20-K23 WeakPolarHBondContact O-CG 3.38Å; E20-K23 PolarHBondContact O-N 2.77Å
21	A	91.5	Very high	91	Very high	30 Å²	30	94.8 Å²	94.8	25%	0.248	47%	0.47	C	S	.	.	H	α-helix	trans	-60.9	-22.7	177.2	0	0	0	0	0	112.9	S19 K23 D24 C25 P75 F77	S19-A21 PolarHBondContact O-N 3.44Å; S19-A21 PolarHBondContact OG-N 3.35Å; A21-K23 PolarHBondContact O-N 3.21Å; A21-D24 PolarHBondContact O-N 2.78Å; A21-C25 WeakPolarHBondContact O-CA 3.31Å; A21-C25 WeakPolarHBondContact O-CB 3.5Å; A21-C25 PolarHBondContact O-N 3.07Å; A21-P75 HydrophobicContact CB-CB 3.95Å; A21-P75 HydrophobicContact CB-CG 4.03Å; A21-F77 HydrophobicContact CB-CE1 3.79Å; A21-F77 HydrophobicContact CB-CZ 3.74Å
22	L	92.9	Very high	91	Very high	15 Å²	15	88.6 Å²	88.6	8%	0.079	45%	0.45	C	S	.	.	H	α-helix	trans	-67.8	-19.4	176	-72.1	171.3	0	0	0	113.2	S19 E20 I28 F57 I70 P75	S19-L22 WeakPolarHBondContact O-CB 3.49Å; S19-L22 PolarHBondContact O-N 3.2Å; S19-L22 VanDerWaalsContact O-N 3.09Å; E20-L22 PolarHBondContact O-N 2.68Å; E20-L22 VanDerWaalsContact O-N 3.12Å; L22-I28 HydrophobicContact CD2-CG2 4.06Å; L22-F57 HydrophobicContact CB-CE2 4.47Å; L22-F57 HydrophobicContact CB-CZ 4.1Å; L22-F57 HydrophobicContact CD2-CE2 4.16Å; L22-F57 HydrophobicContact CD2-CZ 4.38Å; L22-F57 WeakPolarHBondContact O-CZ 3.24Å; L22-I70 HydrophobicContact CD1-CG2 4.07Å; L22-P75 HydrophobicContact CD2-CB 4.05Å; L22-P75 HydrophobicContact CD2-CG 4.36Å; L22-P75 HydrophobicContact CG-CB 4.46Å; L22-P75 HydrophobicContact CG-CG 4.45Å
23	K	91.7	Very high	90.7	Very high	142 Å²	142	89.2 Å²	89.2	62%	0.617	45%	0.452	S	S	*	.	H	α-helix	trans	-66.4	-44.2	177	-63.2	177	179.3	176.5	0	110.9	E20 A21 R52	E20-K23 VanDerWaalsContact O-CB 3.28Å; E20-K23 WeakPolarHBondContact O-CB 3.37Å; E20-K23 WeakPolarHBondContact O-CG 3.38Å; E20-K23 PolarHBondContact O-N 2.77Å; A21-K23 PolarHBondContact O-N 3.21Å; K23-R52 WeakPolarHBondContact O-CD 3.39Å; K23-R52 PolarHBondContact O-NE 2.72Å
24	D	90.6	Very high	90.3	Very high	143 Å²	143	81.4 Å²	81.4	77%	0.765	44%	0.442	S	S	*	.	H	α-helix	trans	-114.2	-3.2	-169.8	-54.3	-47.4	0	0	0	114	A21 S26	A21-D24 PolarHBondContact O-N 2.78Å; D24-S26 PolarHBondContact O-N 3.48Å
25	C	91.8	Very high	89.4	Confident	14 Å²	14	84.1 Å²	84.1	10%	0.095	45%	0.452	C	S	.	.			trans	-61.5	128.1	-175.1	59.1	0	0	0	0	113	A21 H27 I28 R52 P75	A21-C25 WeakPolarHBondContact O-CA 3.31Å; A21-C25 WeakPolarHBondContact O-CB 3.5Å; A21-C25 PolarHBondContact O-N 3.07Å; C25-H27 VanDerWaalsContact C-N 3.31Å; C25-H27 PolarHBondContact O-N 2.93Å; C25-I28 WeakPolarHBondContact SG-CG2 3.37Å; C25-R52 PolarHBondContact O-NH2 2.8Å; C25-P75 HydrophobicContact CB-CB 4.1Å
26	S	93.6	Very high	88.4	Confident	39 Å²	39	81.7 Å²	81.7	27%	0.273	44%	0.435	S	S	.	.	S	Bend	trans	-65.8	-35.7	175.7	68.2	0	0	0	0	112.4	D24 V49 D81	D24-S26 PolarHBondContact O-N 3.48Å; S26-V49 PolarHBondContact O-N 2.94Å; S26-V49 VanDerWaalsContact O-N 3.07Å; S26-D81 PolarHBondContact OG-OD2 2.78Å
27	H	95.3	Very high	87.9	Confident	32 Å²	32	82.6 Å²	82.6	15%	0.148	43%	0.434	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.4	152.7	-177.3	-62.7	72	0	0	0	111.7	C25 P46 Y47 A76 R78	C25-H27 VanDerWaalsContact C-N 3.31Å; C25-H27 PolarHBondContact O-N 2.93Å; H27-P46 HydrophobicContact CB-CB 3.88Å; H27-Y47 CarbonylContact C-O 3.51Å; H27-Y47 WeakPolarHBondContact CA-O 3.42Å; H27-Y47 WeakPolarHBondContact CB-O 3.14Å; H27-A76 HydrophobicContact CB-CB 3.93Å; H27-A76 WeakPolarHBondContact O-CB 3.38Å; H27-A76 PolarHBondContact O-N 2.83Å; H27-R78 PolarHBondContact CE1-NH1 3.34Å
28	I	96.2	Very high	87.5	Confident	0 Å²	0	78.6 Å²	78.6	0%	0	44%	0.435	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-132.9	151.5	176.5	62.9	178.1	0	0	0	111.8	L22 C25 V30 Y47 V49 F57 V59 V68 T73 K74	L22-I28 HydrophobicContact CD2-CG2 4.06Å; C25-I28 WeakPolarHBondContact SG-CG2 3.37Å; I28-V30 HydrophobicContact CD1-CG2 4.34Å; I28-V30 HydrophobicContact CG1-CG2 4.31Å; I28-Y47 PolarHBondContact N-O 2.93Å; I28-Y47 PolarHBondContact O-N 3.37Å; I28-V49 HydrophobicContact CB-CG2 4.39Å; I28-V49 HydrophobicContact CD1-CG2 4.17Å; I28-V49 HydrophobicContact CG1-CG2 3.99Å; I28-V49 HydrophobicContact CG2-CG2 3.75Å; I28-F57 HydrophobicContact CD1-CB 3.69Å; I28-F57 HydrophobicContact CD1-CD2 3.81Å; I28-F57 HydrophobicContact CD1-CG 3.78Å; I28-V59 HydrophobicContact CD1-CG1 3.4Å; I28-V59 VanDerWaalsContact CD1-CG1 3.4Å; I28-V59 HydrophobicContact CG1-CG1 3.65Å; I28-V68 HydrophobicContact CD1-CG2 4.15Å; I28-T73 HydrophobicContact CD1-CG2 3.72Å; I28-K74 CarbonylContact C-O 3.51Å; I28-K74 VanDerWaalsContact CA-O 3.26Å; I28-K74 WeakPolarHBondContact CA-O 3.35Å; I28-K74 WeakPolarHBondContact CB-O 3.44Å
29	F	96.1	Very high	87.1	Confident	71 Å²	71	83 Å²	83	31%	0.311	45%	0.453	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.4	138	163.8	-67.1	-77.6	0	0	0	109.4	Y43 A44 G45 P46 T73 K74 A76	F29-Y43 HydrophobicContact CB-CD1 4.27Å; F29-A44 CarbonylContact C-O 3.53Å; F29-A44 WeakPolarHBondContact CA-O 3.47Å; F29-G45 VanDerWaalsContact CE1-O 3.24Å; F29-G45 WeakPolarHBondContact CE1-O 3.41Å; F29-P46 HydrophobicContact CE1-CB 4.41Å; F29-P46 HydrophobicContact CZ-CB 4.48Å; F29-T73 CarbonylContact O-C 3.57Å; F29-T73 VanDerWaalsContact O-CA 3.24Å; F29-T73 WeakPolarHBondContact O-CA 3.38Å; F29-K74 HydrophobicContact CB-CB 4.32Å; F29-K74 PolarHBondContact N-O 3.22Å; F29-K74 PolarHBondContact O-N 2.88Å; F29-A76 HydrophobicContact CD2-CB 3.66Å; F29-A76 HydrophobicContact CE2-CB 3.4Å; F29-A76 HydrophobicContact CZ-CB 4.07Å
30	V	95.1	Very high	86.9	Confident	1 Å²	1	83.4 Å²	83.4	1%	0.006	46%	0.458	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-114	131	-179.1	177.1	0	0	0	0	109.6	I28 E32 Y43 A44 Y47 M66 V68 T73	I28-V30 HydrophobicContact CD1-CG2 4.34Å; I28-V30 HydrophobicContact CG1-CG2 4.31Å; V30-E32 PolarHBondContact O-N 2.82Å; V30-Y43 CarbonylContact O-C 3.55Å; V30-Y43 VanDerWaalsContact O-CA 3.24Å; V30-Y43 WeakPolarHBondContact O-CA 3.44Å; V30-A44 PolarHBondContact N-O 2.9Å; V30-A44 PolarHBondContact O-N 2.92Å; V30-Y47 HydrophobicContact CB-CD2 4.15Å; V30-Y47 HydrophobicContact CB-CE2 4.08Å; V30-Y47 HydrophobicContact CG2-CD2 3.75Å; V30-Y47 HydrophobicContact CG2-CE2 4.18Å; V30-M66 HydrophobicContact CB-CE 4.44Å; V30-M66 HydrophobicContact CG1-CE 3.65Å; V30-V68 HydrophobicContact CG1-CB 4.41Å; V30-V68 HydrophobicContact CG1-CG1 3.75Å; V30-V68 HydrophobicContact CG2-CG1 4.18Å; V30-V68 HydrophobicContact CG2-CG2 4.16Å; V30-T73 HydrophobicContact CG2-CG2 4.47Å
31	R	93.2	Very high	86.7	Confident	130 Å²	130	80.8 Å²	80.8	49%	0.491	45%	0.454	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-72.8	120.7	174.3	-170.8	179.1	177.6	-130.6	-5.4	110.4	P42 Y43 R72	R31-P42 WeakPolarHBondContact CA-O 3.48Å; R31-P42 WeakPolarHBondContact CG-O 3.16Å; R31-Y43 HydrophobicContact CB-CD1 3.86Å; R31-Y43 HydrophobicContact CB-CE1 3.67Å; R31-Y43 HydrophobicContact CG-CE1 4.34Å; R31-R72 HydrophobicContact CB-CB 4.28Å; R31-R72 WeakPolarHBondContact CB-O 3.28Å; R31-R72 PolarHBondContact N-O 3.39Å; R31-R72 PolarHBondContact O-NE 2.81Å; R31-R72 PolarHBondContact O-NH2 3.29Å
32	E	85.6	Confident	86.6	Confident	87 Å²	87	82.7 Å²	82.7	41%	0.407	46%	0.464	S	S	.	.			trans	-69.8	138.8	176.5	-71.2	-61.2	155.3	0	0	111.2	V30 G34 P42 A44	V30-E32 PolarHBondContact O-N 2.82Å; E32-G34 PolarHBondContact O-N 2.98Å; E32-P42 PolarHBondContact N-O 3.47Å; E32-P42 VanDerWaalsContact N-O 3.15Å; E32-A44 HydrophobicContact CG-CB 4.01Å; E32-A44 WeakPolarHBondContact OE1-CB 3.49Å
33	P	80.1	Confident	86.6	Confident	96 Å²	96	85.2 Å²	85.2	62%	0.623	47%	0.473	S	S	*	.	S	Bend	trans	-77.9	113.4	174.9	26.8	-22	0	0	0	109.4	R72	P33-R72 VanDerWaalsContact CB-NH2 3.28Å
34	G	80.9	Confident	86.7	Confident	62 Å²	62	79.6 Å²	79.6	64%	0.639	45%	0.453	S	S	*	.	S	Bend	trans	142.7	179.9	170.6	0	0	0	0	0	114.1	E32 S36	E32-G34 PolarHBondContact O-N 2.98Å; G34-S36 PolarHBondContact O-N 3.46Å
35	F	67.6	Low	86.7	Confident	215 Å²	215	74.4 Å²	74.4	94%	0.943	43%	0.433	S	S	*	.			trans	-75.9	100.9	170.8	-59.5	-82.3	0	0	0	107.6	I37	F35-I37 PolarHBondContact O-N 2.91Å
36	S	64.9	Low	86.8	Confident	63 Å²	63	77 Å²	77	44%	0.441	45%	0.45	S	S	.	.			trans	-49.4	127.1	161	49.8	0	0	0	0	107.6	G34 A40	G34-S36 PolarHBondContact O-N 3.46Å; S36-A40 WeakPolarHBondContact CB-O 3.27Å
37	I	76	Confident	86.9	Confident	147 Å²	147	77.8 Å²	77.8	75%	0.754	45%	0.447	S	S	*	.			trans	-46.8	147.9	166	-62.8	169.4	0	0	0	107.2	F35 L39 A40	F35-I37 PolarHBondContact O-N 2.91Å; I37-L39 PolarHBondContact O-N 3.38Å; I37-A40 HydrophobicContact CB-CB 4.42Å; I37-A40 PolarHBondContact O-N 2.69Å
38	A	79.5	Confident	86.9	Confident	99 Å²	99	83.5 Å²	83.5	82%	0.818	47%	0.467	S	S	*	.	T	Hydrogen-bonded Turn	trans	-38.6	-31.8	-161.7	0	0	0	0	0	117.5
39	L	83.3	Confident	86.9	Confident	170 Å²	170	84.1 Å²	84.1	89%	0.89	47%	0.471	S	S	*	.	T	Hydrogen-bonded Turn	trans	-122.7	8.9	179.7	-57.4	176.5	0	0	0	115.3	I37	I37-L39 PolarHBondContact O-N 3.38Å
40	A	85.8	Confident	86.9	Confident	42 Å²	42	84.3 Å²	84.3	35%	0.347	48%	0.475	S	S	.	.	S	Bend	trans	-72.6	138.4	176.7	0	0	0	0	0	110.5	S36 I37	S36-A40 WeakPolarHBondContact CB-O 3.27Å; I37-A40 HydrophobicContact CB-CB 4.42Å; I37-A40 PolarHBondContact O-N 2.69Å
41	P	88.1	Confident	86.9	Confident	99 Å²	99	90.5 Å²	90.5	64%	0.643	50%	0.504	S	S	*	.			trans	-63.6	134.6	179.9	26.3	-33.6	0	0	0	110.1	Y43	P41-Y43 PolarHBondContact O-N 2.8Å
42	P	90.4	Very high	87	Confident	69 Å²	69	89.7 Å²	89.7	45%	0.448	50%	0.501	S	S	.	.	S	Bend	trans	-71.5	-10.5	-179.2	24.2	-29.8	0	0	0	113.4	R31 E32	R31-P42 WeakPolarHBondContact CA-O 3.48Å; R31-P42 WeakPolarHBondContact CG-O 3.16Å; E32-P42 PolarHBondContact N-O 3.47Å; E32-P42 VanDerWaalsContact N-O 3.15Å
43	Y	93.7	Very high	87.5	Confident	69 Å²	69	89.5 Å²	89.5	27%	0.271	51%	0.506	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.1	134.8	176.9	-63.5	-100.6	0	0	0	110.2	F29 V30 R31 P41 K74	F29-Y43 HydrophobicContact CB-CD1 4.27Å; V30-Y43 CarbonylContact O-C 3.55Å; V30-Y43 VanDerWaalsContact O-CA 3.24Å; V30-Y43 WeakPolarHBondContact O-CA 3.44Å; R31-Y43 HydrophobicContact CB-CD1 3.86Å; R31-Y43 HydrophobicContact CB-CE1 3.67Å; R31-Y43 HydrophobicContact CG-CE1 4.34Å; P41-Y43 PolarHBondContact O-N 2.8Å; Y43-K74 HydrophobicContact CD1-CG 4.48Å; Y43-K74 HydrophobicContact CE1-CD 4.07Å; Y43-K74 HydrophobicContact CE1-CG 3.91Å; Y43-K74 HydrophobicContact CE2-CD 4.43Å
44	A	92.5	Very high	88	Confident	24 Å²	24	92.3 Å²	92.3	20%	0.198	52%	0.515	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.7	165.4	169.9	0	0	0	0	0	110.6	F29 V30 E32 Y47	F29-A44 CarbonylContact C-O 3.53Å; F29-A44 WeakPolarHBondContact CA-O 3.47Å; V30-A44 PolarHBondContact N-O 2.9Å; V30-A44 PolarHBondContact O-N 2.92Å; E32-A44 HydrophobicContact CG-CB 4.01Å; E32-A44 WeakPolarHBondContact OE1-CB 3.49Å; A44-Y47 VanDerWaalsContact C-CE2 3.44Å; A44-Y47 HydrophobicContact CB-CE2 3.96Å; A44-Y47 WeakPolarHBondContact CB-OH 3.24Å; A44-Y47 WeakPolarHBondContact O-CE2 3.34Å
45	G	90.6	Very high	88.7	Confident	33 Å²	33	97.3 Å²	97.3	34%	0.34	52%	0.52	S	S	.	.	E	Extended strand (participates in β ladder)	trans	109.2	-178.3	-177.2	0	0	0	0	0	112.1	F29 Y47	F29-G45 VanDerWaalsContact CE1-O 3.24Å; F29-G45 WeakPolarHBondContact CE1-O 3.41Å; G45-Y47 VanDerWaalsContact CA-CE2 3.48Å
46	P	93.9	Very high	90.1	Very high	70 Å²	70	89.1 Å²	89.1	46%	0.455	49%	0.487	S	S	.	.	E	Extended strand (participates in β ladder)	cis	-81.4	129.5	30.2	29.5	-36.1	0	0	0	114.9	H27 F29 A76	H27-P46 HydrophobicContact CB-CB 3.88Å; F29-P46 HydrophobicContact CE1-CB 4.41Å; F29-P46 HydrophobicContact CZ-CB 4.48Å; P46-A76 HydrophobicContact CB-CB 3.8Å
47	Y	95.6	Very high	91.6	Very high	55 Å²	55	86.4 Å²	86.4	22%	0.216	47%	0.467	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.1	139	173.3	-60.1	-78.5	0	0	0	111.2	H27 I28 V30 A44 G45 V49 V59 D60	H27-Y47 CarbonylContact C-O 3.51Å; H27-Y47 WeakPolarHBondContact CA-O 3.42Å; H27-Y47 WeakPolarHBondContact CB-O 3.14Å; I28-Y47 PolarHBondContact N-O 2.93Å; I28-Y47 PolarHBondContact O-N 3.37Å; V30-Y47 HydrophobicContact CB-CD2 4.15Å; V30-Y47 HydrophobicContact CB-CE2 4.08Å; V30-Y47 HydrophobicContact CG2-CD2 3.75Å; V30-Y47 HydrophobicContact CG2-CE2 4.18Å; A44-Y47 VanDerWaalsContact C-CE2 3.44Å; A44-Y47 HydrophobicContact CB-CE2 3.96Å; A44-Y47 WeakPolarHBondContact CB-OH 3.24Å; A44-Y47 WeakPolarHBondContact O-CE2 3.34Å; G45-Y47 VanDerWaalsContact CA-CE2 3.48Å; Y47-V49 PolarHBondContact O-N 2.99Å; Y47-V59 HydrophobicContact CG-CG2 4.26Å; Y47-D60 WeakPolarHBondContact CD1-O 3.41Å
48	R	95.6	Very high	92.6	Very high	152 Å²	152	80.2 Å²	80.2	57%	0.574	44%	0.436	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-69.2	129.3	175.2	-176.3	-178.9	-179.5	-163.8	1.9	109.9	V59 D60	R48-V59 CarbonylContact O-C 3.45Å; R48-V59 VanDerWaalsContact O-CA 3.27Å; R48-V59 WeakPolarHBondContact O-CA 3.24Å; R48-D60 HydrophobicContact CB-CB 4.23Å; R48-D60 PolarHBondContact O-N 3.32Å
49	V	96.4	Very high	93.4	Very high	13 Å²	13	75.5 Å²	75.5	8%	0.079	40%	0.397	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.6	123.2	174.3	-178	0	0	0	0	109.4	S26 I28 Y47 R52 F57	S26-V49 PolarHBondContact O-N 2.94Å; S26-V49 VanDerWaalsContact O-N 3.07Å; I28-V49 HydrophobicContact CB-CG2 4.39Å; I28-V49 HydrophobicContact CD1-CG2 4.17Å; I28-V49 HydrophobicContact CG1-CG2 3.99Å; I28-V49 HydrophobicContact CG2-CG2 3.75Å; Y47-V49 PolarHBondContact O-N 2.99Å; V49-R52 HydrophobicContact CG1-CG 3.75Å; V49-F57 HydrophobicContact CG1-CD1 3.78Å; V49-F57 HydrophobicContact CG1-CE1 4.39Å; V49-F57 HydrophobicContact CG2-CD1 4.46Å
50	L	96.4	Very high	94	Very high	75 Å²	75	70.7 Å²	70.7	39%	0.393	37%	0.372	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.9	-45	177.8	-61.5	177.4	0	0	0	111.7	T58 D60 P65	L50-T58 WeakPolarHBondContact CA-O 3.32Å; L50-T58 HydrophobicContact CB-CG2 4.48Å; L50-T58 WeakPolarHBondContact CB-O 3.37Å; L50-T58 PolarHBondContact N-O 3.33Å; L50-D60 HydrophobicContact CD1-CB 4.04Å; L50-D60 HydrophobicContact CD2-CB 4.16Å; L50-D60 HydrophobicContact CG-CB 4.11Å; L50-P65 HydrophobicContact CD1-CB 4.05Å; L50-P65 HydrophobicContact CD1-CG 4.17Å
51	Q	95.9	Very high	94.2	Very high	130 Å²	130	70.9 Å²	70.9	61%	0.607	37%	0.374	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-142.3	152	179.2	-63.3	179.9	-32.3	0	0	110.8	T58	Q51-T58 PolarHBondContact N-O 3.16Å; Q51-T58 PolarHBondContact O-N 2.98Å
52	R	94.8	Very high	94.3	Very high	114 Å²	114	69.4 Å²	69.4	43%	0.43	38%	0.377	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.3	140.8	179.3	-55.1	-172.3	175.8	72.8	2	109.8	K23 C25 V49 F57	K23-R52 WeakPolarHBondContact O-CD 3.39Å; K23-R52 PolarHBondContact O-NE 2.72Å; C25-R52 PolarHBondContact O-NH2 2.8Å; V49-R52 HydrophobicContact CG1-CG 3.75Å; R52-F57 HydrophobicContact CB-CD1 4.31Å; R52-F57 HydrophobicContact CB-CE1 4.2Å; R52-F57 HydrophobicContact CG-CD1 3.81Å; R52-F57 HydrophobicContact CG-CE1 3.67Å
53	T	94.9	Very high	94.1	Very high	83 Å²	83	77.7 Å²	77.7	51%	0.509	40%	0.399	S	S	.	.			trans	-137	164.2	171.6	-48.2	0	0	0	0	107.8	K55 T56	T53-K55 PolarHBondContact O-N 2.99Å; T53-T56 PolarHBondContact N-O 3.41Å; T53-T56 PolarHBondContact O-N 3.08Å
54	D	92.3	Very high	94.1	Very high	155 Å²	155	79.5 Å²	79.5	83%	0.829	42%	0.417	S	S	*	.	S	Bend	trans	-54.4	-21.6	-178.4	-59.8	-21.1	0	0	0	115.2	I70	D54-I70 WeakPolarHBondContact O-CD1 3.33Å
55	K	94.7	Very high	94.2	Very high	167 Å²	167	82 Å²	82	73%	0.726	43%	0.431	S	S	*	.	S	Bend	trans	-128.9	-10.2	-176.9	-64.7	-176.2	-180	176	0	114.5	T53 A69 I70	T53-K55 PolarHBondContact O-N 2.99Å; K55-A69 WeakPolarHBondContact O-CA 3.38Å; K55-I70 VanDerWaalsContact C-CG1 3.49Å; K55-I70 PolarHBondContact O-N 3.22Å
56	T	96.2	Very high	94.4	Very high	42 Å²	42	83.7 Å²	83.7	26%	0.258	43%	0.431	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-143.2	149.6	-171.5	55.4	0	0	0	0	112.9	T53 T67 V68	T53-T56 PolarHBondContact N-O 3.41Å; T53-T56 PolarHBondContact O-N 3.08Å; T56-T67 HydrophobicContact CG2-CG2 4.09Å; T56-V68 CarbonylContact C-O 3.51Å; T56-V68 WeakPolarHBondContact CA-O 3.22Å; T56-V68 WeakPolarHBondContact CB-O 3.37Å
57	F	96.5	Very high	94.5	Very high	7 Å²	7	84.6 Å²	84.6	3%	0.031	44%	0.436	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-110	139.9	165.6	-69.7	-71.3	0	0	0	109.8	L22 I28 V49 R52 V59 T67 V68 I70 T73	L22-F57 HydrophobicContact CB-CE2 4.47Å; L22-F57 HydrophobicContact CB-CZ 4.1Å; L22-F57 HydrophobicContact CD2-CE2 4.16Å; L22-F57 HydrophobicContact CD2-CZ 4.38Å; L22-F57 WeakPolarHBondContact O-CZ 3.24Å; I28-F57 HydrophobicContact CD1-CB 3.69Å; I28-F57 HydrophobicContact CD1-CD2 3.81Å; I28-F57 HydrophobicContact CD1-CG 3.78Å; V49-F57 HydrophobicContact CG1-CD1 3.78Å; V49-F57 HydrophobicContact CG1-CE1 4.39Å; V49-F57 HydrophobicContact CG2-CD1 4.46Å; R52-F57 HydrophobicContact CB-CD1 4.31Å; R52-F57 HydrophobicContact CB-CE1 4.2Å; R52-F57 HydrophobicContact CG-CD1 3.81Å; R52-F57 HydrophobicContact CG-CE1 3.67Å; F57-V59 HydrophobicContact CB-CG1 4.34Å; F57-T67 CarbonylContact O-C 3.57Å; F57-T67 VanDerWaalsContact O-CA 3.31Å; F57-T67 WeakPolarHBondContact O-CA 3.48Å; F57-V68 HydrophobicContact CB-CG2 3.83Å; F57-V68 PolarHBondContact N-O 3.46Å; F57-V68 WeakPolarHBondContact O-CG2 3.42Å; F57-V68 PolarHBondContact O-N 2.64Å; F57-I70 HydrophobicContact CD2-CG1 3.93Å; F57-I70 HydrophobicContact CE2-CB 4.31Å; F57-I70 HydrophobicContact CE2-CG1 3.67Å; F57-I70 HydrophobicContact CE2-CG2 4.26Å; F57-I70 HydrophobicContact CZ-CG1 4.37Å; F57-T73 HydrophobicContact CD2-CG2 4.06Å
58	T	97.2	Very high	94.5	Very high	17 Å²	17	82.5 Å²	82.5	10%	0.104	43%	0.429	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-101.1	121.7	163.9	-58	0	0	0	0	107.5	L50 Q51 P65 M66	L50-T58 WeakPolarHBondContact CA-O 3.32Å; L50-T58 HydrophobicContact CB-CG2 4.48Å; L50-T58 WeakPolarHBondContact CB-O 3.37Å; L50-T58 PolarHBondContact N-O 3.33Å; Q51-T58 PolarHBondContact N-O 3.16Å; Q51-T58 PolarHBondContact O-N 2.98Å; T58-P65 HydrophobicContact CG2-CB 3.64Å; T58-M66 CarbonylContact C-O 3.58Å; T58-M66 WeakPolarHBondContact CA-O 3.44Å
59	V	96.6	Very high	94.5	Very high	0 Å²	0	77.4 Å²	77.4	0%	0	42%	0.419	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.3	154.1	-177.6	-60	0	0	0	0	112.2	I28 Y47 R48 F57 A61 P65 M66	I28-V59 HydrophobicContact CD1-CG1 3.4Å; I28-V59 VanDerWaalsContact CD1-CG1 3.4Å; I28-V59 HydrophobicContact CG1-CG1 3.65Å; Y47-V59 HydrophobicContact CG-CG2 4.26Å; R48-V59 CarbonylContact O-C 3.45Å; R48-V59 VanDerWaalsContact O-CA 3.27Å; R48-V59 WeakPolarHBondContact O-CA 3.24Å; F57-V59 HydrophobicContact CB-CG1 4.34Å; V59-A61 PolarHBondContact O-N 3.1Å; V59-P65 WeakPolarHBondContact O-CA 3.43Å; V59-M66 HydrophobicContact CG2-CB 4.02Å; V59-M66 WeakPolarHBondContact CG2-O 3.12Å; V59-M66 PolarHBondContact N-O 3.12Å; V59-M66 PolarHBondContact O-N 3.3Å
60	D	96.1	Very high	94.4	Very high	68 Å²	68	78.4 Å²	78.4	36%	0.364	42%	0.423	S	S	.	.			trans	-77.4	105.4	172	-171.7	-4	0	0	0	110.5	Y47 R48 L50 G62	Y47-D60 WeakPolarHBondContact CD1-O 3.41Å; R48-D60 HydrophobicContact CB-CB 4.23Å; R48-D60 PolarHBondContact O-N 3.32Å; L50-D60 HydrophobicContact CD1-CB 4.04Å; L50-D60 HydrophobicContact CD2-CB 4.16Å; L50-D60 HydrophobicContact CG-CB 4.11Å; D60-G62 WeakPolarHBondContact OD1-CA 3.26Å; D60-G62 PolarHBondContact OD1-N 3.17Å
61	A	90.7	Very high	94.3	Very high	47 Å²	47	82 Å²	82	39%	0.388	44%	0.443	S	S	.	.			trans	-101	19.6	174.3	0	0	0	0	0	112.5	V59 R63 M66	V59-A61 PolarHBondContact O-N 3.1Å; A61-R63 PolarHBondContact O-N 3.4Å; A61-M66 HydrophobicContact CB-CB 3.99Å
62	G	88.9	Confident	94.2	Very high	67 Å²	67	79.9 Å²	79.9	69%	0.691	43%	0.43	S	S	*	.	S	Bend	trans	89.4	-50.4	172.9	0	0	0	0	0	115.3	D60	D60-G62 WeakPolarHBondContact OD1-CA 3.26Å; D60-G62 PolarHBondContact OD1-N 3.17Å
63	R	87	Confident	94.2	Very high	243 Å²	243	75 Å²	75	92%	0.917	41%	0.413	S	S	*	.	S	Bend	trans	-101	-51.7	179.6	-73.1	-170.4	-178.9	-170.9	1.2	113.5	A61	A61-R63 PolarHBondContact O-N 3.4Å
64	V	93.3	Very high	94.3	Very high	107 Å²	107	76.2 Å²	76.2	65%	0.648	41%	0.411	S	S	*	.	S	Bend	trans	-130.1	133.7	-178.9	-179.3	0	0	0	0	107	M66	V64-M66 PolarHBondContact O-N 3Å
65	P	95.4	Very high	94.4	Very high	77 Å²	77	69.7 Å²	69.7	50%	0.5	38%	0.377	S	S	.	.			trans	-54.7	133.2	172.3	-25.9	35	0	0	0	111.1	L50 T58 V59	L50-P65 HydrophobicContact CD1-CB 4.05Å; L50-P65 HydrophobicContact CD1-CG 4.17Å; T58-P65 HydrophobicContact CG2-CB 3.64Å; V59-P65 WeakPolarHBondContact O-CA 3.43Å
66	M	94.3	Very high	94.4	Very high	68 Å²	68	62 Å²	62	34%	0.335	34%	0.344	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.8	126	-178.8	-175.5	169.2	109.1	0	0	110.3	V30 T58 V59 A61 V64 V68	V30-M66 HydrophobicContact CB-CE 4.44Å; V30-M66 HydrophobicContact CG1-CE 3.65Å; T58-M66 CarbonylContact C-O 3.58Å; T58-M66 WeakPolarHBondContact CA-O 3.44Å; V59-M66 HydrophobicContact CG2-CB 4.02Å; V59-M66 WeakPolarHBondContact CG2-O 3.12Å; V59-M66 PolarHBondContact N-O 3.12Å; V59-M66 PolarHBondContact O-N 3.3Å; A61-M66 HydrophobicContact CB-CB 3.99Å; V64-M66 PolarHBondContact O-N 3Å; M66-V68 HydrophobicContact CE-CG1 3.23Å; M66-V68 HydrophobicContact CG-CG1 4.04Å; M66-V68 HydrophobicContact SD-CG1 4.45Å
67	T	96.1	Very high	94.2	Very high	90 Å²	90	68.1 Å²	68.1	55%	0.552	37%	0.368	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-92.5	125.9	174.2	-55.1	0	0	0	0	110.5	T56 F57	T56-T67 HydrophobicContact CG2-CG2 4.09Å; F57-T67 CarbonylContact O-C 3.57Å; F57-T67 VanDerWaalsContact O-CA 3.31Å; F57-T67 WeakPolarHBondContact O-CA 3.48Å
68	V	95.4	Very high	93.7	Very high	11 Å²	11	73.1 Å²	73.1	7%	0.067	39%	0.386	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-127.5	141.7	-177.2	-62.5	0	0	0	0	110.9	I28 V30 T56 F57 M66 T73	I28-V68 HydrophobicContact CD1-CG2 4.15Å; V30-V68 HydrophobicContact CG1-CB 4.41Å; V30-V68 HydrophobicContact CG1-CG1 3.75Å; V30-V68 HydrophobicContact CG2-CG1 4.18Å; V30-V68 HydrophobicContact CG2-CG2 4.16Å; T56-V68 CarbonylContact C-O 3.51Å; T56-V68 WeakPolarHBondContact CA-O 3.22Å; T56-V68 WeakPolarHBondContact CB-O 3.37Å; F57-V68 HydrophobicContact CB-CG2 3.83Å; F57-V68 PolarHBondContact N-O 3.46Å; F57-V68 WeakPolarHBondContact O-CG2 3.42Å; F57-V68 PolarHBondContact O-N 2.64Å; M66-V68 HydrophobicContact CE-CG1 3.23Å; M66-V68 HydrophobicContact CG-CG1 4.04Å; M66-V68 HydrophobicContact SD-CG1 4.45Å; V68-T73 HydrophobicContact CB-CG2 4.3Å; V68-T73 HydrophobicContact CG2-CG2 3.58Å
69	A	95.5	Very high	93	Very high	45 Å²	45	80.1 Å²	80.1	37%	0.372	42%	0.422	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-70.9	142.6	172.9	0	0	0	0	0	110.9	K55 D71 R72	K55-A69 WeakPolarHBondContact O-CA 3.38Å; A69-D71 PolarHBondContact O-N 3.09Å; A69-D71 VanDerWaalsContact O-N 3.16Å; A69-R72 PolarHBondContact O-N 2.91Å
70	I	95	Very high	91.9	Very high	33 Å²	33	86.4 Å²	86.4	17%	0.169	46%	0.456	C	S	.	.	G	3₁₀ helix	trans	-54.7	-37.6	-178.6	-66.2	170.5	0	0	0	112	L22 D54 K55 F57 R72 T73	L22-I70 HydrophobicContact CD1-CG2 4.07Å; D54-I70 WeakPolarHBondContact O-CD1 3.33Å; K55-I70 VanDerWaalsContact C-CG1 3.49Å; K55-I70 PolarHBondContact O-N 3.22Å; F57-I70 HydrophobicContact CD2-CG1 3.93Å; F57-I70 HydrophobicContact CE2-CB 4.31Å; F57-I70 HydrophobicContact CE2-CG1 3.67Å; F57-I70 HydrophobicContact CE2-CG2 4.26Å; F57-I70 HydrophobicContact CZ-CG1 4.37Å; I70-R72 PolarHBondContact O-N 3.21Å; I70-R72 VanDerWaalsContact O-N 3.08Å; I70-T73 PolarHBondContact O-N 3.48Å; I70-T73 PolarHBondContact O-OG1 3.49Å
71	D	93.5	Very high	90.6	Very high	152 Å²	152	87 Å²	87	81%	0.813	46%	0.459	S	S	*	.	G	3₁₀ helix	trans	-57.4	-24.5	178.7	-177.6	73	0	0	0	113.9	A69	A69-D71 PolarHBondContact O-N 3.09Å; A69-D71 VanDerWaalsContact O-N 3.16Å
72	R	94.2	Very high	89.3	Confident	84 Å²	84	89 Å²	89	32%	0.317	47%	0.467	S	S	.	.	G	3₁₀ helix	trans	-95.5	11.4	180	-63.7	-176.9	61.4	174.2	-2	113.2	R31 P33 A69 I70	R31-R72 HydrophobicContact CB-CB 4.28Å; R31-R72 WeakPolarHBondContact CB-O 3.28Å; R31-R72 PolarHBondContact N-O 3.39Å; R31-R72 PolarHBondContact O-NE 2.81Å; R31-R72 PolarHBondContact O-NH2 3.29Å; P33-R72 VanDerWaalsContact CB-NH2 3.28Å; A69-R72 PolarHBondContact O-N 2.91Å; I70-R72 PolarHBondContact O-N 3.21Å; I70-R72 VanDerWaalsContact O-N 3.08Å
73	T	95.3	Very high	88	Confident	12 Å²	12	93.3 Å²	93.3	7%	0.074	47%	0.468	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.5	153.2	-171.5	67.9	0	0	0	0	112.7	I28 F29 V30 F57 V68 I70	I28-T73 HydrophobicContact CD1-CG2 3.72Å; F29-T73 CarbonylContact O-C 3.57Å; F29-T73 VanDerWaalsContact O-CA 3.24Å; F29-T73 WeakPolarHBondContact O-CA 3.38Å; V30-T73 HydrophobicContact CG2-CG2 4.47Å; F57-T73 HydrophobicContact CD2-CG2 4.06Å; V68-T73 HydrophobicContact CB-CG2 4.3Å; V68-T73 HydrophobicContact CG2-CG2 3.58Å; I70-T73 PolarHBondContact O-N 3.48Å; I70-T73 PolarHBondContact O-OG1 3.49Å
74	K	95.5	Very high	86.6	Confident	108 Å²	108	89 Å²	89	47%	0.47	46%	0.463	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.4	145.2	166.9	-73.2	-173.5	173.5	-173.7	0	109.6	I28 F29 Y43	I28-K74 CarbonylContact C-O 3.51Å; I28-K74 VanDerWaalsContact CA-O 3.26Å; I28-K74 WeakPolarHBondContact CA-O 3.35Å; I28-K74 WeakPolarHBondContact CB-O 3.44Å; F29-K74 HydrophobicContact CB-CB 4.32Å; F29-K74 PolarHBondContact N-O 3.22Å; F29-K74 PolarHBondContact O-N 2.88Å; Y43-K74 HydrophobicContact CD1-CG 4.48Å; Y43-K74 HydrophobicContact CE1-CD 4.07Å; Y43-K74 HydrophobicContact CE1-CG 3.91Å; Y43-K74 HydrophobicContact CE2-CD 4.43Å
75	P	95.7	Very high	85.1	Confident	19 Å²	19	88.6 Å²	88.6	12%	0.123	46%	0.462	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-64.9	140.7	173	28.8	-33.6	0	0	0	109.8	A21 L22 C25 F77	A21-P75 HydrophobicContact CB-CB 3.95Å; A21-P75 HydrophobicContact CB-CG 4.03Å; L22-P75 HydrophobicContact CD2-CB 4.05Å; L22-P75 HydrophobicContact CD2-CG 4.36Å; L22-P75 HydrophobicContact CG-CB 4.46Å; L22-P75 HydrophobicContact CG-CG 4.45Å; C25-P75 HydrophobicContact CB-CB 4.1Å; P75-F77 HydrophobicContact CB-CE2 4.35Å; P75-F77 HydrophobicContact CB-CZ 4.21Å; P75-F77 HydrophobicContact CG-CE2 3.91Å; P75-F77 HydrophobicContact CG-CZ 3.9Å
76	A	94.6	Very high	83.4	Confident	4 Å²	4	90.4 Å²	90.4	3%	0.033	47%	0.473	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.1	109.7	171.9	0	0	0	0	0	109.5	H27 F29 P46	H27-A76 HydrophobicContact CB-CB 3.93Å; H27-A76 WeakPolarHBondContact O-CB 3.38Å; H27-A76 PolarHBondContact O-N 2.83Å; F29-A76 HydrophobicContact CD2-CB 3.66Å; F29-A76 HydrophobicContact CE2-CB 3.4Å; F29-A76 HydrophobicContact CZ-CB 4.07Å; P46-A76 HydrophobicContact CB-CB 3.8Å
77	F	91.9	Very high	82	Confident	171 Å²	171	94.5 Å²	94.5	75%	0.75	50%	0.496	S	S	*	.			trans	-82	122.1	175.4	-58.5	-78	0	0	0	109.4	A21 P75	A21-F77 HydrophobicContact CB-CE1 3.79Å; A21-F77 HydrophobicContact CB-CZ 3.74Å; P75-F77 HydrophobicContact CB-CE2 4.35Å; P75-F77 HydrophobicContact CB-CZ 4.21Å; P75-F77 HydrophobicContact CG-CE2 3.91Å; P75-F77 HydrophobicContact CG-CZ 3.9Å
78	R	85.7	Confident	80.4	Confident	112 Å²	112	95.5 Å²	95.5	42%	0.423	50%	0.504	S	S	.	.			trans	-108.9	143.8	176.9	-58.7	177.8	73.1	-149.8	6.4	108.7	H27 N80 D81	H27-R78 PolarHBondContact CE1-NH1 3.34Å; R78-N80 PolarHBondContact O-N 3.43Å; R78-D81 PolarHBondContact O-N 3.19Å; R78-D81 VanDerWaalsContact O-N 3.1Å
79	L	81.7	Confident	79	Confident	164 Å²	164	100.4 Å²	100.4	86%	0.859	54%	0.538	S	S	*	.	G	3₁₀ helix	trans	-56.1	-34.4	-179.2	-69.7	170.7	0	0	0	112.5
80	N	75.1	Confident	77.7	Confident	132 Å²	132	103.4 Å²	103.4	71%	0.706	56%	0.557	S	S	*	*	G	3₁₀ helix	trans	-83.2	-8.8	-176.8	-59.7	6.1	0	0	0	114	R78 V82	R78-N80 PolarHBondContact O-N 3.43Å; N80-V82 VanDerWaalsContact C-N 3.28Å
81	D	67.3	Low	76.5	Confident	80 Å²	80	112.4 Å²	112.4	43%	0.428	59%	0.589	S	S	.	*	G	3₁₀ helix	trans	-85.2	-7.8	178.4	-66	-4.1	0	0	0	111.2	S26 R78 E83	S26-D81 PolarHBondContact OG-OD2 2.78Å; R78-D81 PolarHBondContact O-N 3.19Å; R78-D81 VanDerWaalsContact O-N 3.1Å; D81-E83 VanDerWaalsContact C-N 3.33Å; D81-E83 PolarHBondContact O-N 3.34Å
82	V	64.2	Low	75.6	Confident	91 Å²	91	113.5 Å²	113.5	55%	0.552	59%	0.589	S	S	*	*			trans	-89	71.9	175.5	-171.5	0	0	0	0	108.7	N80 D84	N80-V82 VanDerWaalsContact C-N 3.28Å; V82-D84 PolarHBondContact O-N 3.37Å
83	E	61.3	Low	74.6	Confident	156 Å²	156	114.1 Å²	114.1	73%	0.729	60%	0.602	S	S	*	*			trans	-70.8	117	161.3	-69.9	-79.7	129.2	0	0	107.5	D81 T85	D81-E83 VanDerWaalsContact C-N 3.33Å; D81-E83 PolarHBondContact O-N 3.34Å; E83-T85 PolarHBondContact O-N 3.04Å
84	D	57.6	Low	73.8	Confident	152 Å²	152	118.7 Å²	118.7	81%	0.813	63%	0.63	S	S	*	*	S	Bend	trans	45.9	41.8	160.1	-70.4	-30.8	0	0	0	118.8	V82 P86	V82-D84 PolarHBondContact O-N 3.37Å; D84-P86 WeakPolarHBondContact O-CD 3.39Å
85	T	61.4	Low	73.1	Confident	100 Å²	100	121.3 Å²	121.3	61%	0.613	64%	0.642	S	S	*	*			trans	-85.2	116.8	157.2	-55.1	0	0	0	0	108.2	E83 L87	E83-T85 PolarHBondContact O-N 3.04Å; T85-L87 PolarHBondContact O-N 2.93Å
86	P	60.7	Low	72.3	Confident	115 Å²	115	128.9 Å²	128.9	75%	0.747	68%	0.675	S	S	*	*			trans	-55.7	113.1	174.3	-19.8	30.2	0	0	0	108.4	D84 P88	D84-P86 WeakPolarHBondContact O-CD 3.39Å; P86-P88 WeakPolarHBondContact O-CD 3.4Å; P86-P88 VanDerWaalsContact O-N 3.15Å
87	L	63.8	Low	71.6	Confident	153 Å²	153	139 Å²	139	80%	0.801	71%	0.713	S	S	*	*			trans	-55.4	122.6	171.6	-63.1	164.5	0	0	0	106.4	T85 S89	T85-L87 PolarHBondContact O-N 2.93Å; L87-S89 PolarHBondContact O-N 3.02Å
88	P	63.1	Low	70.8	Confident	112 Å²	112	135.2 Å²	135.2	73%	0.727	71%	0.706	S	S	*	*			trans	-58.3	121.7	168.3	23.6	-30.4	0	0	0	106.3	P86 S90	P86-P88 WeakPolarHBondContact O-CD 3.4Å; P86-P88 VanDerWaalsContact O-N 3.15Å; P88-S90 PolarHBondContact O-N 2.89Å
89	S	65.9	Low	70	Confident	113 Å²	113	136.5 Å²	136.5	79%	0.79	73%	0.728	S	S	*	*	S	Bend	trans	-39.3	116	-177.5	55.4	0	0	0	0	109.7	L87 R91	L87-S89 PolarHBondContact O-N 3.02Å; S89-R91 PolarHBondContact O-N 3.03Å
90	S	69.1	Low	69.3	Low	108 Å²	108	132 Å²	132	76%	0.755	72%	0.722	S	S	*	*			trans	5.7	88.9	173.4	178	0	0	0	0	113.3	P88 Q92	P88-S90 PolarHBondContact O-N 2.89Å; S90-Q92 PolarHBondContact O-N 3.03Å
91	R	69.7	Low	68.8	Low	223 Å²	223	130 Å²	130	84%	0.842	72%	0.723	S	S	*	*			trans	-61.4	103.4	174.1	-152.5	174.4	-172.7	168.3	2.1	106.3	S89 V93	S89-R91 PolarHBondContact O-N 3.03Å; R91-V93 VanDerWaalsContact C-N 3.33Å; R91-V93 PolarHBondContact O-N 2.85Å
92	Q	73.5	Confident	68.5	Low	174 Å²	174	133.7 Å²	133.7	81%	0.813	74%	0.742	S	S	*	*			trans	-62.3	100.7	174.3	-77	-170.9	-50.3	0	0	107.1	S90 T94	S90-Q92 PolarHBondContact O-N 3.03Å; Q92-T94 PolarHBondContact O-N 2.84Å; Q92-T94 VanDerWaalsContact O-N 3.12Å
93	V	74.1	Confident	68.1	Low	97 Å²	97	135.9 Å²	135.9	59%	0.588	76%	0.755	S	S	*	*			trans	-78.6	95	171.7	-179	0	0	0	0	106.1	R91 F95	R91-V93 VanDerWaalsContact C-N 3.33Å; R91-V93 PolarHBondContact O-N 2.85Å; V93-F95 HydrophobicContact CB-CE2 4.34Å; V93-F95 HydrophobicContact CG1-CD1 4.4Å; V93-F95 HydrophobicContact CG1-CD2 4.26Å; V93-F95 HydrophobicContact CG1-CE1 4.03Å; V93-F95 HydrophobicContact CG1-CE2 3.88Å; V93-F95 HydrophobicContact CG1-CZ 3.76Å; V93-F95 PolarHBondContact O-N 3.23Å
94	T	78.6	Confident	67.6	Low	109 Å²	109	132.9 Å²	132.9	67%	0.669	76%	0.758	S	S	*	*			trans	-76.4	104.9	169.7	-49.6	0	0	0	0	108	Q92 Q96	Q92-T94 PolarHBondContact O-N 2.84Å; Q92-T94 VanDerWaalsContact O-N 3.12Å; T94-Q96 HydrophobicContact CG2-CG 4.46Å; T94-Q96 PolarHBondContact O-N 3.12Å; T94-Q96 VanDerWaalsContact O-N 3.09Å
95	F	79.9	Confident	67.2	Low	163 Å²	163	130.4 Å²	130.4	72%	0.715	75%	0.752	S	S	*	*			trans	-70.8	101.3	169.3	-65.2	-83.3	0	0	0	108.6	V93 W97	V93-F95 HydrophobicContact CB-CE2 4.34Å; V93-F95 HydrophobicContact CG1-CD1 4.4Å; V93-F95 HydrophobicContact CG1-CD2 4.26Å; V93-F95 HydrophobicContact CG1-CE1 4.03Å; V93-F95 HydrophobicContact CG1-CE2 3.88Å; V93-F95 HydrophobicContact CG1-CZ 3.76Å; V93-F95 PolarHBondContact O-N 3.23Å; F95-W97 PolarHBondContact O-N 3.09Å
96	Q	78.5	Confident	66.6	Low	177 Å²	177	135.5 Å²	135.5	83%	0.827	76%	0.76	S	S	*	*			trans	-80.1	108.6	168.2	-67.2	-170.2	6.9	0	0	108.3	T94	T94-Q96 HydrophobicContact CG2-CG 4.46Å; T94-Q96 PolarHBondContact O-N 3.12Å; T94-Q96 VanDerWaalsContact O-N 3.09Å
97	W	79.9	Confident	66	Low	216 Å²	216	138 Å²	138	82%	0.818	76%	0.762	S	S	*	*			trans	-69.2	136.3	166.8	-70.7	91	0	0	0	109	F95	F95-W97 PolarHBondContact O-N 3.09Å
98	P	76	Confident	65.5	Low	93 Å²	93	134 Å²	134	60%	0.604	76%	0.758	S	S	*	*			trans	-62	131.2	173.9	23.3	-30.2	0	0	0	109.6	G100	P98-G100 PolarHBondContact O-N 3.36Å; P98-G100 VanDerWaalsContact O-N 3.14Å
99	P	69.5	Low	64.8	Low	138 Å²	138	135.3 Å²	135.3	90%	0.896	76%	0.763	S	S	*	*	T	Hydrogen-bonded Turn	trans	-67.3	113.9	177	25.1	-30	0	0	0	108.8
100	G	67	Low	64.2	Low	70 Å²	70	142.4 Å²	142.4	72%	0.722	79%	0.787	S	S	*	*	T	Hydrogen-bonded Turn	trans	131.2	9.4	175.4	0	0	0	0	0	117.1	P98 L102	P98-G100 PolarHBondContact O-N 3.36Å; P98-G100 VanDerWaalsContact O-N 3.14Å; G100-L102 PolarHBondContact O-N 3.14Å
101	A	63	Low	63.9	Low	90 Å²	90	144.2 Å²	144.2	74%	0.744	79%	0.789	S	S	*	*			trans	-69.9	20.5	175.1	0	0	0	0	0	115.1
102	L	61	Low	63.6	Low	157 Å²	157	140 Å²	140	82%	0.822	79%	0.786	S	S	*	*			trans	-113.2	110.5	166.3	-89.4	159.8	0	0	0	106.5	G100	G100-L102 PolarHBondContact O-N 3.14Å
103	V	55.6	Low	63.1	Low	137 Å²	137	138.1 Å²	138.1	83%	0.83	78%	0.784	S	S	*	*			trans	152.1	130.4	133.5	167.3	0	0	0	0	110.8
104	A	52.3	Low	62.5	Low	94 Å²	94	140.5 Å²	140.5	78%	0.777	80%	0.796	S	S	*	*			trans	82.4	126	167.8	0	0	0	0	0	115.3
105	S	49.2	Very low	61.4	Low	99 Å²	99	142.5 Å²	142.5	69%	0.692	80%	0.804	S	S	*	*			cis	-173.9	160.7	30.9	-158.8	0	0	0	0	110.6
106	R	48	Very low	60.2	Low	207 Å²	207	141.1 Å²	141.1	78%	0.781	81%	0.81	S	S	*	*			trans	80.1	138.1	158	-52.2	-175.9	171.4	-167.3	-11.4	116
107	E	48.7	Very low	58.9	Low	169 Å²	169	138.6 Å²	138.6	79%	0.79	81%	0.809	S	S	*	*			cis	-168.9	157.5	34.5	-151.6	101.6	74.7	0	0	109.2
108	G	52	Low	57.3	Low	69 Å²	69	132.6 Å²	132.6	71%	0.711	81%	0.808	S	S	*	*			trans	141	72.5	171.5	0	0	0	0	0	111.8
109	V	49.5	Very low	55.7	Low	139 Å²	139	135.9 Å²	135.9	84%	0.842	83%	0.825	S	S	*	*				48.9	95.1	77.9	168.3	0	0	0	0	112.7
110	M	52.8	Low	54.5	Low	262 Å²	262	135.7 Å²	135.7	100%	1.291	82%	0.818	S	S	*	*			trans	-147.8	0	138.5	-133.2	171.7	177.3	0	0	108.3

Retrieved 110 of 110 residues in 100.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).