A0A077ZNI0_TRITR Loading...

YebG domain containing protein

AlphaFold DB , UniProt , Accession A0A077ZNI0, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 96 aa.

						>A0A077ZNI0_TRITR|A0A077ZNI0
MAVEVKYVVIREGEEKMSFTSKKEADAYDKMLDTADLLDTWLTNSPVQMEDEQREALSLWLAEQKDVLSTILKTGKLPSPQVVGAESEEEDASHAA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	74.1	Confident	79	Confident	240 Å²	240	100.8 Å²	100.8	100%	1.182	54%	0.542	S	S	*	.				0	119.9	0	-79.1	169.8	156.3	0	0	107
2	A	78.5	Confident	78.4	Confident	110 Å²	110	108.7 Å²	108.7	91%	0.909	57%	0.573	S	S	*	*			trans	-85.8	120.9	173.4	0	0	0	0	0	107.9
3	V	79.9	Confident	78	Confident	134 Å²	134	105.7 Å²	105.7	81%	0.812	58%	0.584	S	S	*	*			trans	-105.8	120.4	170.2	-178.7	0	0	0	0	105.7
4	E	78.5	Confident	77.9	Confident	132 Å²	132	108.1 Å²	108.1	62%	0.617	59%	0.589	S	S	*	*			trans	-108.1	126.1	177.5	-163.1	174.2	125.8	0	0	108.2	K6	E4-K6 WeakPolarHBondContact OE1-CE 3.45Å; E4-K6 IonicContact OE1-NZ 3.38Å
5	V	81.1	Confident	77.5	Confident	85 Å²	85	111 Å²	111	52%	0.515	60%	0.597	S	S	.	*			trans	-94.2	120.9	175.8	-177.2	0	0	0	0	107.5	Y7	V5-Y7 HydrophobicContact CB-CE2 4.49Å; V5-Y7 HydrophobicContact CG1-CD2 4.28Å; V5-Y7 HydrophobicContact CG1-CE2 3.52Å
6	K	82.4	Confident	77.4	Confident	127 Å²	127	110.8 Å²	110.8	55%	0.552	59%	0.589	S	S	*	*			trans	-116.6	135.8	175.1	-66	-175.9	-180	-177.7	0	109.6	E4 F19	E4-K6 WeakPolarHBondContact OE1-CE 3.45Å; E4-K6 IonicContact OE1-NZ 3.38Å; K6-F19 CarbonylContact C-O 3.52Å; K6-F19 WeakPolarHBondContact CA-O 3.45Å
7	Y	82.3	Confident	77.6	Confident	81 Å²	81	109.6 Å²	109.6	32%	0.318	58%	0.581	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-105.5	112.2	174.5	-65	-89.7	0	0	0	107.5	V5 S18 F19 S21 K22 A25	V5-Y7 HydrophobicContact CB-CE2 4.49Å; V5-Y7 HydrophobicContact CG1-CD2 4.28Å; V5-Y7 HydrophobicContact CG1-CE2 3.52Å; Y7-S18 CarbonylContact O-C 3.58Å; Y7-S18 WeakPolarHBondContact O-CA 3Å; Y7-F19 PolarHBondContact N-O 3.29Å; Y7-F19 PolarHBondContact O-N 2.97Å; Y7-S21 VanDerWaalsContact CD2-C 3.47Å; Y7-K22 HydrophobicContact CD1-CB 4.01Å; Y7-K22 HydrophobicContact CD1-CG 3.84Å; Y7-K22 HydrophobicContact CD2-CB 4.16Å; Y7-K22 VanDerWaalsContact CD2-N 3.26Å; Y7-K22 HydrophobicContact CE1-CB 3.53Å; Y7-K22 HydrophobicContact CE1-CD 3.86Å; Y7-K22 HydrophobicContact CE1-CG 3.44Å; Y7-K22 VanDerWaalsContact CE1-CG 3.44Å; Y7-K22 HydrophobicContact CE2-CB 3.69Å; Y7-K22 HydrophobicContact CG-CB 4.3Å; Y7-A25 VanDerWaalsContact CB-CB 3.43Å; Y7-A25 HydrophobicContact CG-CB 4.22Å
8	V	80.8	Confident	77.8	Confident	65 Å²	65	107.6 Å²	107.6	39%	0.394	58%	0.576	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-100.4	127.7	-179.8	-173.7	0	0	0	0	108.2	I10 E15	V8-I10 HydrophobicContact CG1-CG1 4.02Å; V8-E15 HydrophobicContact CG1-CB 4.09Å; V8-E15 HydrophobicContact CG1-CG 4Å
9	V	80.1	Confident	78.1	Confident	7 Å²	7	103.8 Å²	103.8	4%	0.042	56%	0.555	C	S	.	*	E	Extended strand (participates in β ladder)	trans	-92.7	114.5	174.1	-177.4	0	0	0	0	107.6	K16 M17 F19 A25 Y28 L32	V9-K16 PolarHBondContact O-N 2.96Å; V9-M17 PolarHBondContact N-O 2.75Å; V9-F19 HydrophobicContact CG2-CD2 4.15Å; V9-F19 HydrophobicContact CG2-CE2 4.03Å; V9-A25 HydrophobicContact CG2-CB 4.3Å; V9-Y28 HydrophobicContact CG1-CD1 4.5Å; V9-Y28 HydrophobicContact CG2-CD1 4.3Å; V9-L32 HydrophobicContact CG1-CD1 3.69Å
10	I	80.8	Confident	78.5	Confident	100 Å²	100	103.9 Å²	103.9	51%	0.513	56%	0.559	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-109.7	126.5	-176.7	-56	176.4	0	0	0	108.5	V8 E14 E15	V8-I10 HydrophobicContact CG1-CG1 4.02Å; I10-E14 CarbonylContact C-O 3.56Å; I10-E14 WeakPolarHBondContact CA-O 3.5Å; I10-E15 HydrophobicContact CG1-CG 4.31Å
11	R	71	Confident	78.8	Confident	28 Å²	28	101 Å²	101	11%	0.106	55%	0.546	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.6	126.9	-179.8	-96.1	-81.7	168.4	100	-9.6	109.7	G13 E14 K16 L32 D33 D36	R11-G13 PolarHBondContact O-N 2.73Å; R11-E14 PolarHBondContact N-O 3.09Å; R11-E14 PolarHBondContact O-N 2.89Å; R11-K16 HydrophobicContact CB-CG 3.83Å; R11-K16 HydrophobicContact CG-CG 4.34Å; R11-L32 HydrophobicContact CG-CD1 4.35Å; R11-L32 PolarHBondContact NH1-O 2.95Å; R11-L32 PolarHBondContact NH2-O 2.93Å; R11-D33 IonicContact CZ-OD1 2.97Å; R11-D33 IonicContact NH2-OD1 3.29Å; R11-D33 PolarHBondContact NH2-OD1 3.4Å; R11-D36 IonicContact CZ-OD1 2.78Å; R11-D36 IonicContact CZ-OD2 3.23Å; R11-D36 IonicContact NE-OD2 2.65Å; R11-D36 PolarHBondContact NE-OD2 2.89Å; R11-D36 IonicContact NH1-OD1 3.52Å; R11-D36 PolarHBondContact NH1-OD1 3.4Å; R11-D36 IonicContact NH1-OD2 3.54Å; R11-D36 PolarHBondContact NH1-OD2 3.05Å; R11-D36 IonicContact NH2-OD2 3.86Å; R11-D36 PolarHBondContact NH2-OD2 3.37Å
12	E	71.5	Confident	79.4	Confident	195 Å²	195	94.9 Å²	94.9	91%	0.911	51%	0.513	S	S	*	.	T	Hydrogen-bonded Turn	trans	52.9	20.6	-179.9	-56.1	-166.1	122.9	0	0	115
13	G	73.2	Confident	79.8	Confident	70 Å²	70	97.7 Å²	97.7	72%	0.722	51%	0.505	S	S	*	.	T	Hydrogen-bonded Turn	trans	92.6	-2.1	-174.9	0	0	0	0	0	115	R11	R11-G13 PolarHBondContact O-N 2.73Å
14	E	75.8	Confident	80.1	Confident	140 Å²	140	96.3 Å²	96.3	65%	0.654	49%	0.49	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-101.4	134.9	173.6	-66	-165.1	100.7	0	0	112.2	I10 R11 K16	I10-E14 CarbonylContact C-O 3.56Å; I10-E14 WeakPolarHBondContact CA-O 3.5Å; R11-E14 PolarHBondContact N-O 3.09Å; R11-E14 PolarHBondContact O-N 2.89Å; E14-K16 PolarHBondContact O-N 3.37Å; E14-K16 VanDerWaalsContact O-N 3.15Å
15	E	73.2	Confident	80.5	Confident	151 Å²	151	90.3 Å²	90.3	71%	0.706	46%	0.463	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-73.4	101.3	174.9	-63.2	-176.5	178.6	0	0	109.6	V8 I10	V8-E15 HydrophobicContact CG1-CB 4.09Å; V8-E15 HydrophobicContact CG1-CG 4Å; I10-E15 HydrophobicContact CG1-CG 4.31Å
16	K	75	Confident	80.8	Confident	108 Å²	108	90.1 Å²	90.1	47%	0.47	46%	0.459	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-74.6	-51.2	179.2	-77.7	-82.8	-173.1	163.4	0	111.1	V9 R11 E14 E55	V9-K16 PolarHBondContact O-N 2.96Å; R11-K16 HydrophobicContact CB-CG 3.83Å; R11-K16 HydrophobicContact CG-CG 4.34Å; E14-K16 PolarHBondContact O-N 3.37Å; E14-K16 VanDerWaalsContact O-N 3.15Å; K16-E55 IonicContact NZ-OE1 3.67Å; K16-E55 PolarHBondContact NZ-OE1 3.25Å
17	M	80.8	Confident	81.1	Confident	91 Å²	91	86.9 Å²	86.9	45%	0.448	46%	0.456	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-157.4	149.7	-175.3	-158.7	168.2	-78.5	0	0	112.9	V9 F19 Y28	V9-M17 PolarHBondContact N-O 2.75Å; M17-F19 HydrophobicContact CB-CE2 3.98Å; M17-F19 HydrophobicContact CB-CZ 4.43Å; M17-F19 HydrophobicContact CG-CE2 4Å; M17-F19 HydrophobicContact CG-CZ 4.09Å; M17-F19 HydrophobicContact SD-CE1 4.34Å; M17-F19 HydrophobicContact SD-CE2 4.2Å; M17-F19 HydrophobicContact SD-CZ 3.69Å; M17-Y28 HydrophobicContact CB-CE1 4.13Å; M17-Y28 HydrophobicContact SD-CE1 4.42Å
18	S	81.6	Confident	81.2	Confident	72 Å²	72	85.7 Å²	85.7	50%	0.503	45%	0.451	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.8	135.3	173.9	72.1	0	0	0	0	111.8	Y7	Y7-S18 CarbonylContact O-C 3.58Å; Y7-S18 WeakPolarHBondContact O-CA 3Å
19	F	83.2	Confident	81.5	Confident	37 Å²	37	85.7 Å²	85.7	16%	0.162	45%	0.449	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.4	154.5	177.9	-64	-92.8	0	0	0	111	K6 Y7 V9 M17 E24 A25 Y28	K6-F19 CarbonylContact C-O 3.52Å; K6-F19 WeakPolarHBondContact CA-O 3.45Å; Y7-F19 PolarHBondContact N-O 3.29Å; Y7-F19 PolarHBondContact O-N 2.97Å; V9-F19 HydrophobicContact CG2-CD2 4.15Å; V9-F19 HydrophobicContact CG2-CE2 4.03Å; M17-F19 HydrophobicContact CB-CE2 3.98Å; M17-F19 HydrophobicContact CB-CZ 4.43Å; M17-F19 HydrophobicContact CG-CE2 4Å; M17-F19 HydrophobicContact CG-CZ 4.09Å; M17-F19 HydrophobicContact SD-CE1 4.34Å; M17-F19 HydrophobicContact SD-CE2 4.2Å; M17-F19 HydrophobicContact SD-CZ 3.69Å; F19-E24 HydrophobicContact CD1-CB 3.81Å; F19-E24 HydrophobicContact CE1-CB 4.44Å; F19-E24 HydrophobicContact CG-CB 4.38Å; F19-A25 HydrophobicContact CB-CB 4.09Å; F19-A25 HydrophobicContact CD2-CB 3.97Å; F19-A25 HydrophobicContact CG-CB 4.22Å; F19-Y28 AromaticContact CE2-CD1 3.56Å; F19-Y28 HydrophobicContact CE2-CD1 3.56Å; F19-Y28 HydrophobicContact CE2-CE1 4.3Å; F19-Y28 AromaticContact CE2-CG 3.91Å; F19-Y28 HydrophobicContact CE2-CG 3.91Å; F19-Y28 AromaticContact CZ-CD1 3.62Å; F19-Y28 HydrophobicContact CZ-CD1 3.62Å; F19-Y28 HydrophobicContact CZ-CD2 4.21Å; F19-Y28 HydrophobicContact CZ-CE1 4.27Å; F19-Y28 AromaticContact CZ-CG 3.56Å; F19-Y28 HydrophobicContact CZ-CG 3.56Å
20	T	86.3	Confident	81.8	Confident	104 Å²	104	91.8 Å²	91.8	64%	0.638	48%	0.475	S	S	*	.	S	Bend	trans	-87.2	-11.2	173.8	56.5	0	0	0	0	112.6
21	S	85.4	Confident	82.2	Confident	43 Å²	43	89.1 Å²	89.1	30%	0.301	46%	0.461	S	S	.	.			trans	-126.4	133.5	-176.8	-179.1	0	0	0	0	111.5	Y7 K23 E24 A25	Y7-S21 VanDerWaalsContact CD2-C 3.47Å; S21-K23 VanDerWaalsContact C-N 3.27Å; S21-K23 PolarHBondContact O-N 2.97Å; S21-E24 PolarHBondContact O-N 3.05Å; S21-A25 PolarHBondContact O-N 3.29Å; S21-A25 VanDerWaalsContact O-N 3.11Å
22	K	85.7	Confident	82.9	Confident	112 Å²	112	88.2 Å²	88.2	49%	0.487	46%	0.458	S	S	.	.	H	α-helix	trans	-58.5	-43.1	176.8	-167.1	177.1	172.6	-176.2	0	111.5	Y7 E24 A25 D26	Y7-K22 HydrophobicContact CD1-CB 4.01Å; Y7-K22 HydrophobicContact CD1-CG 3.84Å; Y7-K22 HydrophobicContact CD2-CB 4.16Å; Y7-K22 VanDerWaalsContact CD2-N 3.26Å; Y7-K22 HydrophobicContact CE1-CB 3.53Å; Y7-K22 HydrophobicContact CE1-CD 3.86Å; Y7-K22 HydrophobicContact CE1-CG 3.44Å; Y7-K22 VanDerWaalsContact CE1-CG 3.44Å; Y7-K22 HydrophobicContact CE2-CB 3.69Å; Y7-K22 HydrophobicContact CG-CB 4.3Å; K22-E24 VanDerWaalsContact C-N 3.32Å; K22-E24 PolarHBondContact O-N 3.29Å; K22-A25 WeakPolarHBondContact O-CB 3.42Å; K22-A25 PolarHBondContact O-N 3.06Å; K22-D26 WeakPolarHBondContact CE-OD2 3.29Å; K22-D26 WeakPolarHBondContact O-CB 3.46Å; K22-D26 PolarHBondContact O-N 3.22Å
23	K	88	Confident	83.8	Confident	169 Å²	169	83 Å²	83	74%	0.735	44%	0.436	S	S	*	.	H	α-helix	trans	-64.1	-39.5	-174.9	-175.7	-179.5	177.7	-178.1	0	111.7	S21 A27	S21-K23 VanDerWaalsContact C-N 3.27Å; S21-K23 PolarHBondContact O-N 2.97Å; K23-A27 VanDerWaalsContact O-CB 3.31Å; K23-A27 WeakPolarHBondContact O-CB 3.34Å; K23-A27 PolarHBondContact O-N 3.32Å
24	E	85.3	Confident	84.6	Confident	106 Å²	106	81.5 Å²	81.5	50%	0.495	41%	0.413	S	S	.	.	H	α-helix	trans	-69.1	-42.4	176.3	-67.8	173.9	-175.4	0	0	110.7	F19 S21 K22 A27 Y28	F19-E24 HydrophobicContact CD1-CB 3.81Å; F19-E24 HydrophobicContact CE1-CB 4.44Å; F19-E24 HydrophobicContact CG-CB 4.38Å; S21-E24 PolarHBondContact O-N 3.05Å; K22-E24 VanDerWaalsContact C-N 3.32Å; K22-E24 PolarHBondContact O-N 3.29Å; E24-A27 PolarHBondContact O-N 2.62Å; E24-Y28 WeakPolarHBondContact O-CB 3.47Å; E24-Y28 PolarHBondContact O-N 2.84Å
25	A	87	Confident	85.3	Confident	5 Å²	5	74.9 Å²	74.9	4%	0.041	38%	0.382	C	S	.	.	H	α-helix	trans	-60.3	-49.6	174.1	0	0	0	0	0	112	Y7 V9 F19 S21 K22 A27 Y28 D29	Y7-A25 VanDerWaalsContact CB-CB 3.43Å; Y7-A25 HydrophobicContact CG-CB 4.22Å; V9-A25 HydrophobicContact CG2-CB 4.3Å; F19-A25 HydrophobicContact CB-CB 4.09Å; F19-A25 HydrophobicContact CD2-CB 3.97Å; F19-A25 HydrophobicContact CG-CB 4.22Å; S21-A25 PolarHBondContact O-N 3.29Å; S21-A25 VanDerWaalsContact O-N 3.11Å; K22-A25 WeakPolarHBondContact O-CB 3.42Å; K22-A25 PolarHBondContact O-N 3.06Å; A25-A27 VanDerWaalsContact C-N 3.29Å; A25-A27 PolarHBondContact O-N 3.36Å; A25-Y28 PolarHBondContact O-N 2.93Å; A25-D29 WeakPolarHBondContact O-CB 3.48Å; A25-D29 PolarHBondContact O-N 3.29Å
26	D	88.2	Confident	86.1	Confident	81 Å²	81	70.9 Å²	70.9	43%	0.433	37%	0.366	S	S	.	.	H	α-helix	trans	-61.5	-36.7	178.7	-67.4	-14	0	0	0	111.4	K22 K30	K22-D26 WeakPolarHBondContact CE-OD2 3.29Å; K22-D26 WeakPolarHBondContact O-CB 3.46Å; K22-D26 PolarHBondContact O-N 3.22Å; D26-K30 VanDerWaalsContact O-CB 3.3Å; D26-K30 WeakPolarHBondContact O-CB 3.28Å; D26-K30 PolarHBondContact O-N 2.94Å
27	A	87.1	Confident	86.8	Confident	60 Å²	60	71.7 Å²	71.7	50%	0.496	38%	0.375	S	S	.	.	H	α-helix	trans	-69.5	-41.5	176.8	0	0	0	0	0	112.2	K23 E24 A25 M31	K23-A27 VanDerWaalsContact O-CB 3.31Å; K23-A27 WeakPolarHBondContact O-CB 3.34Å; K23-A27 PolarHBondContact O-N 3.32Å; E24-A27 PolarHBondContact O-N 2.62Å; A25-A27 VanDerWaalsContact C-N 3.29Å; A25-A27 PolarHBondContact O-N 3.36Å; A27-M31 PolarHBondContact O-N 3.33Å; A27-M31 VanDerWaalsContact O-N 3.07Å
28	Y	85.3	Confident	87.2	Confident	56 Å²	56	68.6 Å²	68.6	22%	0.22	36%	0.36	C	S	.	.	H	α-helix	trans	-69.4	-43.8	176	-170.2	-112.6	0	0	0	111.6	V9 M17 F19 E24 A25 K30 M31 L32	V9-Y28 HydrophobicContact CG1-CD1 4.5Å; V9-Y28 HydrophobicContact CG2-CD1 4.3Å; M17-Y28 HydrophobicContact CB-CE1 4.13Å; M17-Y28 HydrophobicContact SD-CE1 4.42Å; F19-Y28 AromaticContact CE2-CD1 3.56Å; F19-Y28 HydrophobicContact CE2-CD1 3.56Å; F19-Y28 HydrophobicContact CE2-CE1 4.3Å; F19-Y28 AromaticContact CE2-CG 3.91Å; F19-Y28 HydrophobicContact CE2-CG 3.91Å; F19-Y28 AromaticContact CZ-CD1 3.62Å; F19-Y28 HydrophobicContact CZ-CD1 3.62Å; F19-Y28 HydrophobicContact CZ-CD2 4.21Å; F19-Y28 HydrophobicContact CZ-CE1 4.27Å; F19-Y28 AromaticContact CZ-CG 3.56Å; F19-Y28 HydrophobicContact CZ-CG 3.56Å; E24-Y28 WeakPolarHBondContact O-CB 3.47Å; E24-Y28 PolarHBondContact O-N 2.84Å; A25-Y28 PolarHBondContact O-N 2.93Å; Y28-K30 VanDerWaalsContact C-N 3.33Å; Y28-K30 PolarHBondContact O-N 3.39Å; Y28-M31 HydrophobicContact CD2-CE 4.23Å; Y28-M31 HydrophobicContact CD2-SD 4.14Å; Y28-M31 HydrophobicContact CE2-SD 4.2Å; Y28-M31 WeakPolarHBondContact O-CB 3.16Å; Y28-M31 PolarHBondContact O-N 3.05Å; Y28-M31 VanDerWaalsContact O-N 3.1Å; Y28-L32 HydrophobicContact CD1-CD1 3.81Å; Y28-L32 HydrophobicContact CD1-CG 4.04Å; Y28-L32 HydrophobicContact CE1-CD1 3.52Å; Y28-L32 HydrophobicContact CE1-CD2 4.11Å; Y28-L32 HydrophobicContact CE1-CG 3.84Å; Y28-L32 HydrophobicContact CE2-CD2 4.36Å; Y28-L32 HydrophobicContact CG-CG 4.5Å; Y28-L32 WeakPolarHBondContact O-CB 3.31Å; Y28-L32 WeakPolarHBondContact O-CG 3.37Å; Y28-L32 PolarHBondContact O-N 2.77Å
29	D	86.6	Confident	87.6	Confident	65 Å²	65	66.5 Å²	66.5	35%	0.348	34%	0.343	S	S	.	.	H	α-helix	trans	-54	-49.1	173.6	-175.1	65.6	0	0	0	111	A25 M31 L32 D33	A25-D29 WeakPolarHBondContact O-CB 3.48Å; A25-D29 PolarHBondContact O-N 3.29Å; D29-M31 PolarHBondContact O-N 3.29Å; D29-L32 WeakPolarHBondContact O-CB 3.48Å; D29-L32 PolarHBondContact O-N 2.91Å; D29-D33 PolarHBondContact O-N 3Å
30	K	87.6	Confident	87.9	Confident	135 Å²	135	68.7 Å²	68.7	59%	0.587	36%	0.359	S	S	*	.	H	α-helix	trans	-62.3	-39.1	175.6	-174.7	173.7	-176.6	174.9	0	113.6	D26 Y28 D33 T34	D26-K30 VanDerWaalsContact O-CB 3.3Å; D26-K30 WeakPolarHBondContact O-CB 3.28Å; D26-K30 PolarHBondContact O-N 2.94Å; Y28-K30 VanDerWaalsContact C-N 3.33Å; Y28-K30 PolarHBondContact O-N 3.39Å; K30-D33 PolarHBondContact O-N 3.36Å; K30-T34 PolarHBondContact O-N 3.33Å; K30-T34 VanDerWaalsContact O-N 3.1Å; K30-T34 PolarHBondContact O-OG1 3.29Å
31	M	88.5	Confident	88	Confident	44 Å²	44	71.8 Å²	71.8	22%	0.217	36%	0.36	C	S	.	.	H	α-helix	trans	-64	-48.1	175.2	177.8	-153.4	-62.3	0	0	110	A27 Y28 D29 D33 T34 A35 A62 E63	A27-M31 PolarHBondContact O-N 3.33Å; A27-M31 VanDerWaalsContact O-N 3.07Å; Y28-M31 HydrophobicContact CD2-CE 4.23Å; Y28-M31 HydrophobicContact CD2-SD 4.14Å; Y28-M31 HydrophobicContact CE2-SD 4.2Å; Y28-M31 WeakPolarHBondContact O-CB 3.16Å; Y28-M31 PolarHBondContact O-N 3.05Å; Y28-M31 VanDerWaalsContact O-N 3.1Å; D29-M31 PolarHBondContact O-N 3.29Å; M31-D33 VanDerWaalsContact C-N 3.3Å; M31-D33 PolarHBondContact O-N 3.38Å; M31-T34 CarbonylContact O-C 3.54Å; M31-T34 WeakPolarHBondContact O-CB 3.45Å; M31-T34 PolarHBondContact O-N 2.73Å; M31-T34 VanDerWaalsContact O-N 3.16Å; M31-A35 PolarHBondContact O-N 3.15Å; M31-A62 HydrophobicContact CG-CB 3.99Å; M31-A62 WeakPolarHBondContact O-CB 3.22Å; M31-E63 HydrophobicContact CE-CG 3.83Å; M31-E63 HydrophobicContact CG-CG 4.28Å; M31-E63 HydrophobicContact SD-CG 3.5Å; M31-E63 VanDerWaalsContact SD-CG 3.5Å
32	L	86.7	Confident	88.1	Confident	8 Å²	8	70.3 Å²	70.3	4%	0.042	35%	0.348	C	S	.	.	H	α-helix	trans	-58.6	-42.4	176.6	-72.3	-171.3	0	0	0	111.2	V9 R11 Y28 D29 T34 A35 D36 L59	V9-L32 HydrophobicContact CG1-CD1 3.69Å; R11-L32 HydrophobicContact CG-CD1 4.35Å; R11-L32 PolarHBondContact NH1-O 2.95Å; R11-L32 PolarHBondContact NH2-O 2.93Å; Y28-L32 HydrophobicContact CD1-CD1 3.81Å; Y28-L32 HydrophobicContact CD1-CG 4.04Å; Y28-L32 HydrophobicContact CE1-CD1 3.52Å; Y28-L32 HydrophobicContact CE1-CD2 4.11Å; Y28-L32 HydrophobicContact CE1-CG 3.84Å; Y28-L32 HydrophobicContact CE2-CD2 4.36Å; Y28-L32 HydrophobicContact CG-CG 4.5Å; Y28-L32 WeakPolarHBondContact O-CB 3.31Å; Y28-L32 WeakPolarHBondContact O-CG 3.37Å; Y28-L32 PolarHBondContact O-N 2.77Å; D29-L32 WeakPolarHBondContact O-CB 3.48Å; D29-L32 PolarHBondContact O-N 2.91Å; L32-T34 VanDerWaalsContact C-N 3.27Å; L32-T34 PolarHBondContact O-N 2.94Å; L32-A35 WeakPolarHBondContact O-CB 3.45Å; L32-A35 PolarHBondContact O-N 2.88Å; L32-A35 VanDerWaalsContact O-N 3.09Å; L32-D36 PolarHBondContact O-N 3.37Å; L32-L59 HydrophobicContact CD2-CD2 3.67Å
33	D	88.9	Confident	88.1	Confident	86 Å²	86	68.7 Å²	68.7	46%	0.46	35%	0.348	S	S	.	.	H	α-helix	trans	-61.4	-39.5	178.1	-79.7	-7.5	0	0	0	111.4	R11 D29 K30 M31 L37	R11-D33 IonicContact CZ-OD1 2.97Å; R11-D33 IonicContact NH2-OD1 3.29Å; R11-D33 PolarHBondContact NH2-OD1 3.4Å; D29-D33 PolarHBondContact O-N 3Å; K30-D33 PolarHBondContact O-N 3.36Å; M31-D33 VanDerWaalsContact C-N 3.3Å; M31-D33 PolarHBondContact O-N 3.38Å; D33-L37 WeakPolarHBondContact O-CB 3.24Å; D33-L37 PolarHBondContact O-N 3.13Å
34	T	90.6	Very high	88.1	Confident	38 Å²	38	66.8 Å²	66.8	23%	0.233	35%	0.346	C	S	.	.	H	α-helix	trans	-66.9	-39.9	173.4	-51.3	0	0	0	0	110.9	K30 M31 L32 L37 L38 A62	K30-T34 PolarHBondContact O-N 3.33Å; K30-T34 VanDerWaalsContact O-N 3.1Å; K30-T34 PolarHBondContact O-OG1 3.29Å; M31-T34 CarbonylContact O-C 3.54Å; M31-T34 WeakPolarHBondContact O-CB 3.45Å; M31-T34 PolarHBondContact O-N 2.73Å; M31-T34 VanDerWaalsContact O-N 3.16Å; L32-T34 VanDerWaalsContact C-N 3.27Å; L32-T34 PolarHBondContact O-N 2.94Å; T34-L37 PolarHBondContact O-N 2.91Å; T34-L38 HydrophobicContact CG2-CD1 3.91Å; T34-L38 HydrophobicContact CG2-CG 4.43Å; T34-L38 WeakPolarHBondContact O-CB 3.45Å; T34-L38 WeakPolarHBondContact O-CD1 3.24Å; T34-L38 WeakPolarHBondContact O-CG 3.33Å; T34-L38 PolarHBondContact O-N 3.4Å; T34-A62 HydrophobicContact CG2-CB 4.04Å
35	A	91.1	Very high	88	Confident	1 Å²	1	63.6 Å²	63.6	1%	0.008	34%	0.335	C	S	.	.	H	α-helix	trans	-64.2	-44.8	178.5	0	0	0	0	0	112.1	M31 L32 L37 L38 D39 S58 L59 A62	M31-A35 PolarHBondContact O-N 3.15Å; L32-A35 WeakPolarHBondContact O-CB 3.45Å; L32-A35 PolarHBondContact O-N 2.88Å; L32-A35 VanDerWaalsContact O-N 3.09Å; A35-L37 VanDerWaalsContact C-N 3.31Å; A35-L37 PolarHBondContact O-N 2.9Å; A35-L38 CarbonylContact O-C 3.25Å; A35-L38 WeakPolarHBondContact O-CB 3.48Å; A35-L38 PolarHBondContact O-N 2.95Å; A35-L38 VanDerWaalsContact O-N 3.15Å; A35-D39 WeakPolarHBondContact O-CB 3.49Å; A35-D39 PolarHBondContact O-N 2.89Å; A35-S58 VanDerWaalsContact O-CB 3.24Å; A35-S58 WeakPolarHBondContact O-CB 3.24Å; A35-S58 PolarHBondContact O-OG 3.47Å; A35-L59 HydrophobicContact CB-CD2 3.59Å; A35-L59 HydrophobicContact CB-CG 4.13Å; A35-A62 HydrophobicContact CB-CB 3.75Å
36	D	88.3	Confident	87.9	Confident	67 Å²	67	69.7 Å²	69.7	36%	0.358	37%	0.374	S	S	.	.	H	α-helix	trans	-63	-40.1	176.7	-84	10.6	0	0	0	112.4	R11 L32 L38 D39 T40	R11-D36 IonicContact CZ-OD1 2.78Å; R11-D36 IonicContact CZ-OD2 3.23Å; R11-D36 IonicContact NE-OD2 2.65Å; R11-D36 PolarHBondContact NE-OD2 2.89Å; R11-D36 IonicContact NH1-OD1 3.52Å; R11-D36 PolarHBondContact NH1-OD1 3.4Å; R11-D36 IonicContact NH1-OD2 3.54Å; R11-D36 PolarHBondContact NH1-OD2 3.05Å; R11-D36 IonicContact NH2-OD2 3.86Å; R11-D36 PolarHBondContact NH2-OD2 3.37Å; L32-D36 PolarHBondContact O-N 3.37Å; D36-L38 VanDerWaalsContact C-N 3.31Å; D36-D39 PolarHBondContact O-N 2.97Å; D36-T40 WeakPolarHBondContact O-CB 3.28Å; D36-T40 PolarHBondContact O-N 2.82Å; D36-T40 PolarHBondContact O-OG1 3.43Å
37	L	90.1	Very high	87.7	Confident	125 Å²	125	69.8 Å²	69.8	65%	0.654	38%	0.378	S	S	*	.	H	α-helix	trans	-64.3	-40.8	175.9	-175.4	62.4	0	0	0	110.8	D33 T34 A35 W41	D33-L37 WeakPolarHBondContact O-CB 3.24Å; D33-L37 PolarHBondContact O-N 3.13Å; T34-L37 PolarHBondContact O-N 2.91Å; A35-L37 VanDerWaalsContact C-N 3.31Å; A35-L37 PolarHBondContact O-N 2.9Å; L37-W41 VanDerWaalsContact O-CB 3.28Å; L37-W41 WeakPolarHBondContact O-CB 3.41Å; L37-W41 PolarHBondContact O-N 3.44Å
38	L	89.5	Confident	87.5	Confident	26 Å²	26	76.3 Å²	76.3	14%	0.136	40%	0.398	C	S	.	.	H	α-helix	trans	-67.8	-38.2	175.1	-73.2	167	0	0	0	111.8	T34 A35 D36 W41 L42 L61 A62	T34-L38 HydrophobicContact CG2-CD1 3.91Å; T34-L38 HydrophobicContact CG2-CG 4.43Å; T34-L38 WeakPolarHBondContact O-CB 3.45Å; T34-L38 WeakPolarHBondContact O-CD1 3.24Å; T34-L38 WeakPolarHBondContact O-CG 3.33Å; T34-L38 PolarHBondContact O-N 3.4Å; A35-L38 CarbonylContact O-C 3.25Å; A35-L38 WeakPolarHBondContact O-CB 3.48Å; A35-L38 PolarHBondContact O-N 2.95Å; A35-L38 VanDerWaalsContact O-N 3.15Å; D36-L38 VanDerWaalsContact C-N 3.31Å; L38-W41 HydrophobicContact CD2-CE3 4.23Å; L38-W41 PolarHBondContact O-N 3.47Å; L38-L42 VanDerWaalsContact O-CB 3.31Å; L38-L42 WeakPolarHBondContact O-CB 3.37Å; L38-L42 WeakPolarHBondContact O-CG 3.36Å; L38-L42 PolarHBondContact O-N 2.77Å; L38-L61 HydrophobicContact CD1-CB 3.64Å; L38-A62 HydrophobicContact CD1-CB 4.04Å
39	D	89.5	Confident	87.5	Confident	28 Å²	28	75.5 Å²	75.5	15%	0.15	40%	0.397	C	S	.	.	H	α-helix	trans	-61.1	-51.7	176.1	-168	80.8	0	0	0	109.9	A35 D36 W41 L42 T43 R54 E55 S58	A35-D39 WeakPolarHBondContact O-CB 3.49Å; A35-D39 PolarHBondContact O-N 2.89Å; D36-D39 PolarHBondContact O-N 2.97Å; D39-W41 VanDerWaalsContact C-N 3.29Å; D39-W41 PolarHBondContact O-N 3.43Å; D39-L42 CarbonylContact O-C 3.59Å; D39-L42 WeakPolarHBondContact O-CA 3.45Å; D39-L42 WeakPolarHBondContact O-CB 3.25Å; D39-L42 PolarHBondContact O-N 3.25Å; D39-T43 WeakPolarHBondContact O-CG2 3.4Å; D39-T43 PolarHBondContact O-N 3.49Å; D39-R54 VanDerWaalsContact OD1-C 3.24Å; D39-R54 VanDerWaalsContact OD1-CG 3.28Å; D39-R54 WeakPolarHBondContact OD1-CG 3.4Å; D39-R54 IonicContact OD1-NE 3.77Å; D39-R54 PolarHBondContact OD1-NE 3.41Å; D39-R54 IonicContact OD2-CZ 3.17Å; D39-R54 IonicContact OD2-NE 2.73Å; D39-R54 PolarHBondContact OD2-NE 3.22Å; D39-R54 IonicContact OD2-NH2 2.75Å; D39-E55 WeakPolarHBondContact OD1-CA 3.48Å; D39-E55 PolarHBondContact OD1-N 2.84Å; D39-S58 VanDerWaalsContact N-CB 3.35Å
40	T	89.3	Confident	87.6	Confident	83 Å²	83	79.1 Å²	79.1	51%	0.509	41%	0.411	S	S	.	.	H	α-helix	trans	-58	-43	175.7	-56.5	0	0	0	0	111.1	D36 T43 N44	D36-T40 WeakPolarHBondContact O-CB 3.28Å; D36-T40 PolarHBondContact O-N 2.82Å; D36-T40 PolarHBondContact O-OG1 3.43Å; T40-T43 PolarHBondContact O-N 2.89Å; T40-T43 PolarHBondContact O-OG1 3.44Å; T40-N44 PolarHBondContact O-ND2 3.34Å
41	W	88.9	Confident	87.4	Confident	169 Å²	169	77.7 Å²	77.7	64%	0.64	41%	0.41	S	S	*	.	H	α-helix	trans	-65.3	-39.2	176.4	-179.8	68.1	0	0	0	112.2	L37 L38 D39 T43 N44	L37-W41 VanDerWaalsContact O-CB 3.28Å; L37-W41 WeakPolarHBondContact O-CB 3.41Å; L37-W41 PolarHBondContact O-N 3.44Å; L38-W41 HydrophobicContact CD2-CE3 4.23Å; L38-W41 PolarHBondContact O-N 3.47Å; D39-W41 VanDerWaalsContact C-N 3.29Å; D39-W41 PolarHBondContact O-N 3.43Å; W41-T43 VanDerWaalsContact C-N 3.29Å; W41-T43 PolarHBondContact O-N 3.27Å; W41-N44 WeakPolarHBondContact O-CB 3.33Å; W41-N44 PolarHBondContact O-N 2.98Å
42	L	87.1	Confident	87.4	Confident	13 Å²	13	83.4 Å²	83.4	7%	0.068	44%	0.437	C	S	.	.	H	α-helix	trans	-66.8	-26.3	176	-73.4	169.6	0	0	0	112.5	L38 D39 N44 S45 M49 R54 L57 L61	L38-L42 VanDerWaalsContact O-CB 3.31Å; L38-L42 WeakPolarHBondContact O-CB 3.37Å; L38-L42 WeakPolarHBondContact O-CG 3.36Å; L38-L42 PolarHBondContact O-N 2.77Å; D39-L42 CarbonylContact O-C 3.59Å; D39-L42 WeakPolarHBondContact O-CA 3.45Å; D39-L42 WeakPolarHBondContact O-CB 3.25Å; D39-L42 PolarHBondContact O-N 3.25Å; L42-N44 PolarHBondContact O-N 3.26Å; L42-S45 WeakPolarHBondContact O-CB 3.38Å; L42-S45 PolarHBondContact O-N 2.81Å; L42-M49 HydrophobicContact CB-CE 4.04Å; L42-M49 HydrophobicContact CD2-CE 4.1Å; L42-M49 HydrophobicContact CG-CE 4.5Å; L42-R54 HydrophobicContact CB-CG 3.71Å; L42-R54 HydrophobicContact CD1-CG 4.19Å; L42-L57 HydrophobicContact CD1-CB 4.24Å; L42-L57 HydrophobicContact CD1-CD2 3.97Å; L42-L57 HydrophobicContact CD1-CG 4.07Å; L42-L57 HydrophobicContact CD2-CD2 4.19Å; L42-L61 HydrophobicContact CD1-CD1 4.34Å
43	T	87.1	Confident	87.5	Confident	77 Å²	77	88.6 Å²	88.6	47%	0.472	46%	0.46	S	S	.	.	H	α-helix	trans	-63.9	-24.8	170.8	69.2	0	0	0	0	112.8	D39 T40 W41 S45	D39-T43 WeakPolarHBondContact O-CG2 3.4Å; D39-T43 PolarHBondContact O-N 3.49Å; T40-T43 PolarHBondContact O-N 2.89Å; T40-T43 PolarHBondContact O-OG1 3.44Å; W41-T43 VanDerWaalsContact C-N 3.29Å; W41-T43 PolarHBondContact O-N 3.27Å; T43-S45 VanDerWaalsContact C-N 3.29Å
44	N	87.2	Confident	87.5	Confident	129 Å²	129	86.4 Å²	86.4	69%	0.69	45%	0.446	S	S	*	.	T	Hydrogen-bonded Turn	trans	-85.4	-4.7	173.9	-65.2	-89.3	0	0	0	112.2	T40 W41 L42	T40-N44 PolarHBondContact O-ND2 3.34Å; W41-N44 WeakPolarHBondContact O-CB 3.33Å; W41-N44 PolarHBondContact O-N 2.98Å; L42-N44 PolarHBondContact O-N 3.26Å
45	S	82.9	Confident	87.3	Confident	40 Å²	40	88.9 Å²	88.9	28%	0.28	46%	0.455	S	S	.	.	S	Bend	trans	-68.7	141.5	175.9	-172.1	0	0	0	0	110.1	L42 T43 V47	L42-S45 WeakPolarHBondContact O-CB 3.38Å; L42-S45 PolarHBondContact O-N 2.81Å; T43-S45 VanDerWaalsContact C-N 3.29Å; S45-V47 PolarHBondContact O-N 3.17Å; S45-V47 VanDerWaalsContact O-N 3.09Å; S45-V47 WeakPolarHBondContact OG-CG2 3.28Å; S45-V47 PolarHBondContact OG-N 2.78Å
46	P	86.5	Confident	87.2	Confident	132 Å²	132	91.7 Å²	91.7	86%	0.857	48%	0.478	S	S	*	.	S	Bend	trans	-67.3	-4.3	171.1	30.2	-36.5	0	0	0	113
47	V	83.4	Confident	87.3	Confident	84 Å²	84	91.3 Å²	91.3	51%	0.509	48%	0.476	S	S	.	.	S	Bend	trans	-84.7	118.2	179.8	-174.2	0	0	0	0	109.6	S45 M49	S45-V47 PolarHBondContact O-N 3.17Å; S45-V47 VanDerWaalsContact O-N 3.09Å; S45-V47 WeakPolarHBondContact OG-CG2 3.28Å; S45-V47 PolarHBondContact OG-N 2.78Å; V47-M49 HydrophobicContact CB-CE 4.3Å; V47-M49 HydrophobicContact CG1-CE 4.44Å; V47-M49 HydrophobicContact CG1-CG 3.88Å; V47-M49 HydrophobicContact CG1-SD 4.26Å; V47-M49 PolarHBondContact O-N 2.93Å
48	Q	82.6	Confident	87.3	Confident	197 Å²	197	85.5 Å²	85.5	92%	0.921	45%	0.445	S	S	*	.			trans	-72.8	120.2	169.1	-85.8	153.7	-31.7	0	0	110.1
49	M	84.7	Confident	87.2	Confident	39 Å²	39	86.6 Å²	86.6	19%	0.192	45%	0.451	C	S	.	.			trans	-132.8	142.4	176	-64.3	172.5	-74.2	0	0	107.2	L42 V47 Q53 R54 L57	L42-M49 HydrophobicContact CB-CE 4.04Å; L42-M49 HydrophobicContact CD2-CE 4.1Å; L42-M49 HydrophobicContact CG-CE 4.5Å; V47-M49 HydrophobicContact CB-CE 4.3Å; V47-M49 HydrophobicContact CG1-CE 4.44Å; V47-M49 HydrophobicContact CG1-CG 3.88Å; V47-M49 HydrophobicContact CG1-SD 4.26Å; V47-M49 PolarHBondContact O-N 2.93Å; M49-Q53 HydrophobicContact CB-CB 4.32Å; M49-R54 HydrophobicContact CB-CB 4.33Å; M49-R54 HydrophobicContact CE-CG 4.34Å; M49-L57 HydrophobicContact SD-CD2 3.71Å
50	E	89	Confident	87.3	Confident	140 Å²	140	92.1 Å²	92.1	65%	0.654	47%	0.47	S	S	*	.			trans	-64.3	153.9	168.8	-64.5	-62.4	136.9	0	0	109.8	E52 Q53 R54	E50-E52 PolarHBondContact O-N 2.65Å; E50-Q53 HydrophobicContact CB-CB 4.5Å; E50-Q53 HydrophobicContact CB-CG 4.23Å; E50-Q53 WeakPolarHBondContact O-CA 3.46Å; E50-Q53 WeakPolarHBondContact O-CB 3.24Å; E50-Q53 PolarHBondContact O-N 3.38Å; E50-R54 PolarHBondContact O-N 2.74Å
51	D	84.3	Confident	87.3	Confident	105 Å²	105	89.4 Å²	89.4	56%	0.561	45%	0.452	S	S	*	.	H	α-helix	trans	-55.1	-42.6	-178.6	-67.5	-28.7	0	0	0	111.7	Q53 R54 E55	D51-Q53 VanDerWaalsContact C-N 3.31Å; D51-Q53 PolarHBondContact O-N 3.06Å; D51-R54 PolarHBondContact O-N 2.78Å; D51-R54 IonicContact OD1-CZ 2.77Å; D51-R54 IonicContact OD1-NH1 3.2Å; D51-R54 PolarHBondContact OD1-NH1 3.2Å; D51-R54 IonicContact OD1-NH2 2.74Å; D51-R54 PolarHBondContact OD1-NH2 3.23Å; D51-E55 WeakPolarHBondContact O-CB 3.2Å; D51-E55 PolarHBondContact O-N 3.1Å
52	E	87.2	Confident	87.3	Confident	165 Å²	165	81.4 Å²	81.4	77%	0.771	42%	0.422	S	S	*	.	H	α-helix	trans	-61	-37.4	175.7	-64.9	-178.1	178.6	0	0	112.8	E50 A56	E50-E52 PolarHBondContact O-N 2.65Å; E52-A56 VanDerWaalsContact O-CB 3.29Å; E52-A56 WeakPolarHBondContact O-CB 3.12Å; E52-A56 PolarHBondContact O-N 3.41Å
53	Q	89.7	Confident	87.4	Confident	116 Å²	116	85.7 Å²	85.7	54%	0.542	44%	0.441	S	S	.	.	H	α-helix	trans	-75	-38.6	179.7	-67.6	178.6	-32	0	0	111.4	M49 E50 D51 L57	M49-Q53 HydrophobicContact CB-CB 4.32Å; E50-Q53 HydrophobicContact CB-CB 4.5Å; E50-Q53 HydrophobicContact CB-CG 4.23Å; E50-Q53 WeakPolarHBondContact O-CA 3.46Å; E50-Q53 WeakPolarHBondContact O-CB 3.24Å; E50-Q53 PolarHBondContact O-N 3.38Å; D51-Q53 VanDerWaalsContact C-N 3.31Å; D51-Q53 PolarHBondContact O-N 3.06Å; Q53-L57 VanDerWaalsContact O-CB 3.24Å; Q53-L57 WeakPolarHBondContact O-CB 3.33Å; Q53-L57 PolarHBondContact O-N 3.17Å
54	R	88.4	Confident	87.4	Confident	41 Å²	41	85.2 Å²	85.2	16%	0.155	43%	0.434	C	S	.	.	H	α-helix	trans	-65.3	-44.9	177.5	-167.3	-177.3	55.7	-109.9	0.5	110.6	D39 L42 M49 E50 D51 L57 S58	D39-R54 VanDerWaalsContact OD1-C 3.24Å; D39-R54 VanDerWaalsContact OD1-CG 3.28Å; D39-R54 WeakPolarHBondContact OD1-CG 3.4Å; D39-R54 IonicContact OD1-NE 3.77Å; D39-R54 PolarHBondContact OD1-NE 3.41Å; D39-R54 IonicContact OD2-CZ 3.17Å; D39-R54 IonicContact OD2-NE 2.73Å; D39-R54 PolarHBondContact OD2-NE 3.22Å; D39-R54 IonicContact OD2-NH2 2.75Å; L42-R54 HydrophobicContact CB-CG 3.71Å; L42-R54 HydrophobicContact CD1-CG 4.19Å; M49-R54 HydrophobicContact CB-CB 4.33Å; M49-R54 HydrophobicContact CE-CG 4.34Å; E50-R54 PolarHBondContact O-N 2.74Å; D51-R54 PolarHBondContact O-N 2.78Å; D51-R54 IonicContact OD1-CZ 2.77Å; D51-R54 IonicContact OD1-NH1 3.2Å; D51-R54 PolarHBondContact OD1-NH1 3.2Å; D51-R54 IonicContact OD1-NH2 2.74Å; D51-R54 PolarHBondContact OD1-NH2 3.23Å; R54-L57 PolarHBondContact O-N 2.9Å; R54-S58 WeakPolarHBondContact O-CB 3.4Å; R54-S58 PolarHBondContact O-N 3.09Å; R54-S58 PolarHBondContact O-OG 3.42Å
55	E	86.3	Confident	87.2	Confident	90 Å²	90	82.1 Å²	82.1	42%	0.421	42%	0.415	S	S	.	.	H	α-helix	trans	-63.4	-45.7	176.1	-172.6	-178.7	-178.3	0	0	110.9	K16 D39 D51 L57 S58 L59	K16-E55 IonicContact NZ-OE1 3.67Å; K16-E55 PolarHBondContact NZ-OE1 3.25Å; D39-E55 WeakPolarHBondContact OD1-CA 3.48Å; D39-E55 PolarHBondContact OD1-N 2.84Å; D51-E55 WeakPolarHBondContact O-CB 3.2Å; D51-E55 PolarHBondContact O-N 3.1Å; E55-L57 VanDerWaalsContact C-N 3.31Å; E55-L57 PolarHBondContact O-N 3.16Å; E55-S58 WeakPolarHBondContact CA-OG 3.2Å; E55-S58 PolarHBondContact O-N 3.49Å; E55-S58 PolarHBondContact O-OG 2.74Å; E55-L59 HydrophobicContact CG-CD1 4.22Å; E55-L59 WeakPolarHBondContact O-CB 3.38Å; E55-L59 WeakPolarHBondContact O-CG 3.43Å; E55-L59 PolarHBondContact O-N 3.48Å
56	A	89.2	Confident	87.3	Confident	60 Å²	60	84.2 Å²	84.2	50%	0.496	42%	0.423	S	S	.	.	H	α-helix	trans	-61.7	-40	176.8	0	0	0	0	0	112.3	E52 W60	E52-A56 VanDerWaalsContact O-CB 3.29Å; E52-A56 WeakPolarHBondContact O-CB 3.12Å; E52-A56 PolarHBondContact O-N 3.41Å; A56-W60 WeakPolarHBondContact O-CB 3.5Å; A56-W60 PolarHBondContact O-N 3.37Å
57	L	89.7	Confident	87.2	Confident	59 Å²	59	79.5 Å²	79.5	31%	0.309	39%	0.391	S	S	.	.	H	α-helix	trans	-70.1	-41	178.8	-175.2	63.1	0	0	0	111.8	L42 M49 Q53 R54 E55 W60 L61	L42-L57 HydrophobicContact CD1-CB 4.24Å; L42-L57 HydrophobicContact CD1-CD2 3.97Å; L42-L57 HydrophobicContact CD1-CG 4.07Å; L42-L57 HydrophobicContact CD2-CD2 4.19Å; M49-L57 HydrophobicContact SD-CD2 3.71Å; Q53-L57 VanDerWaalsContact O-CB 3.24Å; Q53-L57 WeakPolarHBondContact O-CB 3.33Å; Q53-L57 PolarHBondContact O-N 3.17Å; R54-L57 PolarHBondContact O-N 2.9Å; E55-L57 VanDerWaalsContact C-N 3.31Å; E55-L57 PolarHBondContact O-N 3.16Å; L57-W60 HydrophobicContact CD1-CE3 4.17Å; L57-W60 PolarHBondContact O-N 3.3Å; L57-L61 HydrophobicContact CD1-CD1 4.48Å; L57-L61 HydrophobicContact CD1-CG 4.39Å; L57-L61 HydrophobicContact CG-CD1 4.09Å; L57-L61 HydrophobicContact CG-CG 4.43Å; L57-L61 WeakPolarHBondContact O-CB 3.4Å; L57-L61 VanDerWaalsContact O-CG 3.25Å; L57-L61 WeakPolarHBondContact O-CG 3.43Å; L57-L61 PolarHBondContact O-N 2.84Å
58	S	89.8	Confident	87.2	Confident	2 Å²	2	78 Å²	78	1%	0.014	38%	0.38	C	S	.	.	H	α-helix	trans	-65.5	-41.1	179.4	71.8	0	0	0	0	111.6	A35 D39 R54 E55 L61 A62	A35-S58 VanDerWaalsContact O-CB 3.24Å; A35-S58 WeakPolarHBondContact O-CB 3.24Å; A35-S58 PolarHBondContact O-OG 3.47Å; D39-S58 VanDerWaalsContact N-CB 3.35Å; R54-S58 WeakPolarHBondContact O-CB 3.4Å; R54-S58 PolarHBondContact O-N 3.09Å; R54-S58 PolarHBondContact O-OG 3.42Å; E55-S58 WeakPolarHBondContact CA-OG 3.2Å; E55-S58 PolarHBondContact O-N 3.49Å; E55-S58 PolarHBondContact O-OG 2.74Å; S58-L61 PolarHBondContact O-N 2.72Å; S58-A62 WeakPolarHBondContact O-CB 3.23Å; S58-A62 PolarHBondContact O-N 2.95Å
59	L	89.4	Confident	87.4	Confident	50 Å²	50	71.2 Å²	71.2	26%	0.262	35%	0.354	S	S	.	.	H	α-helix	trans	-61.4	-49.1	171.9	-73.3	169.8	0	0	0	111.7	L32 A35 E55 L61 A62 E63	L32-L59 HydrophobicContact CD2-CD2 3.67Å; A35-L59 HydrophobicContact CB-CD2 3.59Å; A35-L59 HydrophobicContact CB-CG 4.13Å; E55-L59 HydrophobicContact CG-CD1 4.22Å; E55-L59 WeakPolarHBondContact O-CB 3.38Å; E55-L59 WeakPolarHBondContact O-CG 3.43Å; E55-L59 PolarHBondContact O-N 3.48Å; L59-L61 VanDerWaalsContact C-N 3.34Å; L59-L61 PolarHBondContact O-N 3.02Å; L59-A62 WeakPolarHBondContact O-CB 3.4Å; L59-A62 PolarHBondContact O-N 3.08Å; L59-A62 VanDerWaalsContact O-N 3.13Å; L59-E63 PolarHBondContact O-N 2.9Å
60	W	90.2	Very high	87.5	Confident	144 Å²	144	70.8 Å²	70.8	55%	0.545	35%	0.354	S	S	.	.	H	α-helix	trans	-61.3	-41.7	179	-178.9	74.9	0	0	0	112.4	A56 L57 A62 E63 Q64	A56-W60 WeakPolarHBondContact O-CB 3.5Å; A56-W60 PolarHBondContact O-N 3.37Å; L57-W60 HydrophobicContact CD1-CE3 4.17Å; L57-W60 PolarHBondContact O-N 3.3Å; W60-A62 VanDerWaalsContact C-N 3.33Å; W60-A62 PolarHBondContact O-N 2.68Å; W60-E63 PolarHBondContact O-N 3.06Å; W60-Q64 HydrophobicContact CD2-CG 4.38Å; W60-Q64 HydrophobicContact CZ2-CG 4.18Å; W60-Q64 WeakPolarHBondContact O-CB 3.34Å; W60-Q64 WeakPolarHBondContact O-CG 3.46Å; W60-Q64 PolarHBondContact O-N 3.32Å
61	L	89.5	Confident	87.5	Confident	25 Å²	25	66.6 Å²	66.6	13%	0.131	34%	0.336	C	S	.	.	H	α-helix	trans	-65.4	-35.5	175.3	-73.9	173.6	0	0	0	112.2	L38 L42 L57 S58 L59 Q64 K65 L68	L38-L61 HydrophobicContact CD1-CB 3.64Å; L42-L61 HydrophobicContact CD1-CD1 4.34Å; L57-L61 HydrophobicContact CD1-CD1 4.48Å; L57-L61 HydrophobicContact CD1-CG 4.39Å; L57-L61 HydrophobicContact CG-CD1 4.09Å; L57-L61 HydrophobicContact CG-CG 4.43Å; L57-L61 WeakPolarHBondContact O-CB 3.4Å; L57-L61 VanDerWaalsContact O-CG 3.25Å; L57-L61 WeakPolarHBondContact O-CG 3.43Å; L57-L61 PolarHBondContact O-N 2.84Å; S58-L61 PolarHBondContact O-N 2.72Å; L59-L61 VanDerWaalsContact C-N 3.34Å; L59-L61 PolarHBondContact O-N 3.02Å; L61-Q64 CarbonylContact O-C 3.58Å; L61-Q64 VanDerWaalsContact O-C 3.25Å; L61-Q64 PolarHBondContact O-N 3.15Å; L61-K65 WeakPolarHBondContact O-CA 3.47Å; L61-K65 PolarHBondContact O-N 2.83Å; L61-L68 HydrophobicContact CD2-CD1 4.47Å; L61-L68 HydrophobicContact CD2-CD2 4.24Å
62	A	89.9	Confident	87.5	Confident	1 Å²	1	68.2 Å²	68.2	1%	0.008	34%	0.343	C	S	.	.	H	α-helix	trans	-69.5	-40.5	175.9	0	0	0	0	0	112.7	M31 T34 A35 L38 S58 L59 W60 Q64 K65	M31-A62 HydrophobicContact CG-CB 3.99Å; M31-A62 WeakPolarHBondContact O-CB 3.22Å; T34-A62 HydrophobicContact CG2-CB 4.04Å; A35-A62 HydrophobicContact CB-CB 3.75Å; L38-A62 HydrophobicContact CD1-CB 4.04Å; S58-A62 WeakPolarHBondContact O-CB 3.23Å; S58-A62 PolarHBondContact O-N 2.95Å; L59-A62 WeakPolarHBondContact O-CB 3.4Å; L59-A62 PolarHBondContact O-N 3.08Å; L59-A62 VanDerWaalsContact O-N 3.13Å; W60-A62 VanDerWaalsContact C-N 3.33Å; W60-A62 PolarHBondContact O-N 2.68Å; A62-Q64 VanDerWaalsContact C-N 3.29Å; A62-Q64 PolarHBondContact O-N 3Å; A62-K65 VanDerWaalsContact O-CB 3.24Å; A62-K65 WeakPolarHBondContact O-CB 3.39Å; A62-K65 WeakPolarHBondContact O-CG 3.38Å; A62-K65 PolarHBondContact O-N 3.04Å
63	E	88.5	Confident	87.4	Confident	103 Å²	103	68.9 Å²	68.9	48%	0.481	34%	0.344	S	S	.	.	H	α-helix	trans	-59.9	-43.6	171.2	-74.6	-178.3	178.9	0	0	111	M31 L59 W60 K65	M31-E63 HydrophobicContact CE-CG 3.83Å; M31-E63 HydrophobicContact CG-CG 4.28Å; M31-E63 HydrophobicContact SD-CG 3.5Å; M31-E63 VanDerWaalsContact SD-CG 3.5Å; L59-E63 PolarHBondContact O-N 2.9Å; W60-E63 PolarHBondContact O-N 3.06Å; E63-K65 PolarHBondContact O-N 2.86Å
64	Q	86.4	Confident	87.2	Confident	67 Å²	67	67.4 Å²	67.4	31%	0.313	34%	0.343	S	S	.	.	T	Hydrogen-bonded Turn	trans	-86.5	17.2	177.9	-59.5	-55.3	-54	0	0	112.7	W60 L61 A62 D66 V67 L68	W60-Q64 HydrophobicContact CD2-CG 4.38Å; W60-Q64 HydrophobicContact CZ2-CG 4.18Å; W60-Q64 WeakPolarHBondContact O-CB 3.34Å; W60-Q64 WeakPolarHBondContact O-CG 3.46Å; W60-Q64 PolarHBondContact O-N 3.32Å; L61-Q64 CarbonylContact O-C 3.58Å; L61-Q64 VanDerWaalsContact O-C 3.25Å; L61-Q64 PolarHBondContact O-N 3.15Å; A62-Q64 VanDerWaalsContact C-N 3.29Å; A62-Q64 PolarHBondContact O-N 3Å; Q64-D66 PolarHBondContact O-N 3.21Å; Q64-V67 HydrophobicContact CB-CB 4.24Å; Q64-V67 CarbonylContact O-C 3.52Å; Q64-V67 WeakPolarHBondContact O-CA 3.42Å; Q64-V67 WeakPolarHBondContact O-CB 3.39Å; Q64-V67 PolarHBondContact O-N 3.38Å; Q64-L68 WeakPolarHBondContact O-CB 3.17Å; Q64-L68 PolarHBondContact O-N 3.1Å
65	K	83.5	Confident	87	Confident	65 Å²	65	68.6 Å²	68.6	28%	0.283	37%	0.367	S	S	.	.	H	α-helix	trans	-54.9	-34.9	-174.9	73.5	-173.8	-167.3	-55.2	0	112.9	L61 A62 E63 S69	L61-K65 WeakPolarHBondContact O-CA 3.47Å; L61-K65 PolarHBondContact O-N 2.83Å; A62-K65 VanDerWaalsContact O-CB 3.24Å; A62-K65 WeakPolarHBondContact O-CB 3.39Å; A62-K65 WeakPolarHBondContact O-CG 3.38Å; A62-K65 PolarHBondContact O-N 3.04Å; E63-K65 PolarHBondContact O-N 2.86Å; K65-S69 VanDerWaalsContact O-CB 3.23Å; K65-S69 WeakPolarHBondContact O-CB 3.46Å; K65-S69 PolarHBondContact O-N 3.39Å; K65-S69 PolarHBondContact O-OG 3.48Å
66	D	84.5	Confident	86.8	Confident	84 Å²	84	71.4 Å²	71.4	45%	0.449	38%	0.378	S	S	.	.	H	α-helix	trans	-73.3	-45.6	-178.8	-58	-56.6	0	0	0	109.4	Q64 L68 S69 T70	Q64-D66 PolarHBondContact O-N 3.21Å; D66-L68 PolarHBondContact O-N 3.07Å; D66-S69 PolarHBondContact O-N 2.8Å; D66-T70 PolarHBondContact O-N 3.02Å; D66-T70 PolarHBondContact O-OG1 3.4Å; D66-T70 VanDerWaalsContact O-OG1 3.08Å
67	V	85.8	Confident	86.1	Confident	32 Å²	32	75.6 Å²	75.6	19%	0.194	39%	0.392	C	S	.	.	H	α-helix	trans	-59	-46.4	172.4	166.1	0	0	0	0	111.1	Q64 T70 I71 P78	Q64-V67 HydrophobicContact CB-CB 4.24Å; Q64-V67 CarbonylContact O-C 3.52Å; Q64-V67 WeakPolarHBondContact O-CA 3.42Å; Q64-V67 WeakPolarHBondContact O-CB 3.39Å; Q64-V67 PolarHBondContact O-N 3.38Å; V67-T70 PolarHBondContact O-N 2.76Å; V67-I71 HydrophobicContact CG1-CD1 3.69Å; V67-I71 HydrophobicContact CG1-CG1 4.39Å; V67-I71 WeakPolarHBondContact O-CG1 3.36Å; V67-I71 PolarHBondContact O-N 2.78Å; V67-P78 HydrophobicContact CB-CG 4.02Å; V67-P78 HydrophobicContact CG1-CG 3.66Å; V67-P78 HydrophobicContact CG2-CG 4.02Å
68	L	83.5	Confident	85	Confident	53 Å²	53	73.8 Å²	73.8	28%	0.277	38%	0.383	S	S	.	.	H	α-helix	trans	-62.4	-44.8	177.8	-175.2	65.2	0	0	0	111.2	L61 Q64 D66 T70 I71 L72	L61-L68 HydrophobicContact CD2-CD1 4.47Å; L61-L68 HydrophobicContact CD2-CD2 4.24Å; Q64-L68 WeakPolarHBondContact O-CB 3.17Å; Q64-L68 PolarHBondContact O-N 3.1Å; D66-L68 PolarHBondContact O-N 3.07Å; L68-T70 VanDerWaalsContact C-N 3.31Å; L68-T70 PolarHBondContact O-N 2.84Å; L68-I71 PolarHBondContact O-N 3.16Å; L68-L72 HydrophobicContact CG-CD1 4.22Å; L68-L72 WeakPolarHBondContact O-CB 3.49Å; L68-L72 VanDerWaalsContact O-CG 3.28Å; L68-L72 WeakPolarHBondContact O-CG 3.37Å; L68-L72 PolarHBondContact O-N 3.23Å
69	S	85.5	Confident	83.6	Confident	54 Å²	54	77.5 Å²	77.5	38%	0.378	41%	0.409	S	S	.	.	H	α-helix	trans	-60.2	-42.5	175.4	-64.7	0	0	0	0	111.3	K65 D66 L72 K73	K65-S69 VanDerWaalsContact O-CB 3.23Å; K65-S69 WeakPolarHBondContact O-CB 3.46Å; K65-S69 PolarHBondContact O-N 3.39Å; K65-S69 PolarHBondContact O-OG 3.48Å; D66-S69 PolarHBondContact O-N 2.8Å; S69-L72 PolarHBondContact O-N 3.36Å; S69-K73 WeakPolarHBondContact O-CB 3.31Å; S69-K73 WeakPolarHBondContact O-CG 3.3Å; S69-K73 PolarHBondContact O-N 2.78Å
70	T	87.6	Confident	82.1	Confident	31 Å²	31	81 Å²	81	19%	0.19	44%	0.435	C	S	.	.	H	α-helix	trans	-67.6	-41.1	176.1	-59.5	0	0	0	0	111.9	D66 V67 L68 L72 K73 T74 P78	D66-T70 PolarHBondContact O-N 3.02Å; D66-T70 PolarHBondContact O-OG1 3.4Å; D66-T70 VanDerWaalsContact O-OG1 3.08Å; V67-T70 PolarHBondContact O-N 2.76Å; L68-T70 VanDerWaalsContact C-N 3.31Å; L68-T70 PolarHBondContact O-N 2.84Å; T70-L72 VanDerWaalsContact C-N 3.33Å; T70-L72 PolarHBondContact O-N 2.93Å; T70-K73 PolarHBondContact O-N 3.23Å; T70-T74 WeakPolarHBondContact O-CB 3.42Å; T70-T74 PolarHBondContact O-N 3.11Å; T70-T74 PolarHBondContact O-OG1 3.02Å; T70-P78 HydrophobicContact CG2-CB 3.91Å; T70-P78 HydrophobicContact CG2-CG 4.1Å
71	I	88.1	Confident	80.3	Confident	52 Å²	52	82.5 Å²	82.5	27%	0.267	45%	0.448	S	S	.	.	H	α-helix	trans	-60.3	-44.5	174.6	-67.5	162.3	0	0	0	110.5	V67 L68 K73 G75 L77 P78	V67-I71 HydrophobicContact CG1-CD1 3.69Å; V67-I71 HydrophobicContact CG1-CG1 4.39Å; V67-I71 WeakPolarHBondContact O-CG1 3.36Å; V67-I71 PolarHBondContact O-N 2.78Å; L68-I71 PolarHBondContact O-N 3.16Å; I71-K73 VanDerWaalsContact C-N 3.34Å; I71-K73 PolarHBondContact O-N 2.82Å; I71-G75 WeakPolarHBondContact O-CA 2.78Å; I71-G75 PolarHBondContact O-N 2.77Å; I71-L77 HydrophobicContact CD1-CD2 3.77Å; I71-L77 HydrophobicContact CG1-CD2 4.31Å; I71-P78 VanDerWaalsContact CG1-CD 3.45Å; I71-P78 HydrophobicContact CG1-CG 4.44Å
72	L	84.1	Confident	78.5	Confident	138 Å²	138	84 Å²	84	72%	0.723	46%	0.459	S	S	*	.	H	α-helix	trans	-67.8	-33.3	179.2	-69.8	173.2	0	0	0	112.5	L68 S69 T70	L68-L72 HydrophobicContact CG-CD1 4.22Å; L68-L72 WeakPolarHBondContact O-CB 3.49Å; L68-L72 VanDerWaalsContact O-CG 3.28Å; L68-L72 WeakPolarHBondContact O-CG 3.37Å; L68-L72 PolarHBondContact O-N 3.23Å; S69-L72 PolarHBondContact O-N 3.36Å; T70-L72 VanDerWaalsContact C-N 3.33Å; T70-L72 PolarHBondContact O-N 2.93Å
73	K	86.5	Confident	76.7	Confident	179 Å²	179	89.1 Å²	89.1	78%	0.778	49%	0.489	S	S	*	.	H	α-helix	trans	-77.3	-45.9	177.5	-74.2	173.9	-179.8	-178.6	0	113.2	S69 T70 I71	S69-K73 WeakPolarHBondContact O-CB 3.31Å; S69-K73 WeakPolarHBondContact O-CG 3.3Å; S69-K73 PolarHBondContact O-N 2.78Å; T70-K73 PolarHBondContact O-N 3.23Å; I71-K73 VanDerWaalsContact C-N 3.34Å; I71-K73 PolarHBondContact O-N 2.82Å
74	T	85.2	Confident	74.9	Confident	86 Å²	86	87.3 Å²	87.3	53%	0.528	50%	0.498	S	S	.	.	H	α-helix	trans	-100	-18.7	-171.1	-48.5	0	0	0	0	112.9	T70 K76	T70-T74 WeakPolarHBondContact O-CB 3.42Å; T70-T74 PolarHBondContact O-N 3.11Å; T70-T74 PolarHBondContact O-OG1 3.02Å; T74-K76 HydrophobicContact CG2-CB 4.12Å; T74-K76 HydrophobicContact CG2-CD 4.23Å; T74-K76 HydrophobicContact CG2-CG 4.26Å; T74-K76 PolarHBondContact O-N 3.34Å
75	G	84.4	Confident	73.2	Confident	65 Å²	65	87.3 Å²	87.3	67%	0.67	51%	0.509	S	S	*	.	S	Bend	trans	68.3	15.6	-172.5	0	0	0	0	0	113.6	I71	I71-G75 WeakPolarHBondContact O-CA 2.78Å; I71-G75 PolarHBondContact O-N 2.77Å
76	K	82	Confident	71.5	Confident	149 Å²	149	91.7 Å²	91.7	65%	0.648	53%	0.531	S	S	*	.	S	Bend	trans	-130.2	144.2	-176.9	-65	-179.2	-177.2	170.8	0	109.8	T74 P78	T74-K76 HydrophobicContact CG2-CB 4.12Å; T74-K76 HydrophobicContact CG2-CD 4.23Å; T74-K76 HydrophobicContact CG2-CG 4.26Å; T74-K76 PolarHBondContact O-N 3.34Å; K76-P78 VanDerWaalsContact O-CD 3.24Å; K76-P78 WeakPolarHBondContact O-CD 3.41Å
77	L	74.7	Confident	69.7	Low	148 Å²	148	93 Å²	93	78%	0.775	55%	0.547	S	S	*	.	P	Polyproline II helix	trans	-63.3	116.9	171.1	-76.3	162.4	0	0	0	108.7	I71 S79	I71-L77 HydrophobicContact CD1-CD2 3.77Å; I71-L77 HydrophobicContact CG1-CD2 4.31Å; L77-S79 PolarHBondContact O-N 3.03Å
78	P	66.7	Low	67.8	Low	21 Å²	21	99.9 Å²	99.9	14%	0.136	58%	0.577	C	S	.	*	P	Polyproline II helix	trans	-63.3	119.8	168.6	25.9	-31	0	0	0	107	V67 T70 I71 K76 V82	V67-P78 HydrophobicContact CB-CG 4.02Å; V67-P78 HydrophobicContact CG1-CG 3.66Å; V67-P78 HydrophobicContact CG2-CG 4.02Å; T70-P78 HydrophobicContact CG2-CB 3.91Å; T70-P78 HydrophobicContact CG2-CG 4.1Å; I71-P78 VanDerWaalsContact CG1-CD 3.45Å; I71-P78 HydrophobicContact CG1-CG 4.44Å; K76-P78 VanDerWaalsContact O-CD 3.24Å; K76-P78 WeakPolarHBondContact O-CD 3.41Å; P78-V82 HydrophobicContact CB-CG2 3.37Å
79	S	59.9	Low	66	Low	80 Å²	80	106.4 Å²	106.4	56%	0.559	61%	0.606	S	S	*	*	P	Polyproline II helix	trans	-56.1	144.8	168.1	-68.2	0	0	0	0	108.2	L77 Q81 V82	L77-S79 PolarHBondContact O-N 3.03Å; S79-Q81 PolarHBondContact O-N 3.3Å; S79-V82 PolarHBondContact O-N 2.83Å
80	P	57.6	Low	64.1	Low	125 Å²	125	113.2 Å²	113.2	81%	0.812	63%	0.632	S	S	*	*	T	Hydrogen-bonded Turn	trans	-56.8	-0.7	-177.3	19.6	-31.9	0	0	0	115.3
81	Q	52.6	Low	62	Low	175 Å²	175	119.7 Å²	119.7	82%	0.818	67%	0.665	S	S	*	*	T	Hydrogen-bonded Turn	trans	-95.7	-10.3	178.6	-52.1	-137.5	110.2	0	0	114.4	S79	S79-Q81 PolarHBondContact O-N 3.3Å
82	V	51.9	Low	60.1	Low	57 Å²	57	122.2 Å²	122.2	35%	0.345	69%	0.694	S	S	.	*	G	3₁₀ helix	trans	-90.1	-10.7	-173.7	-55.4	0	0	0	0	115	P78 S79 G84 A85	P78-V82 HydrophobicContact CB-CG2 3.37Å; S79-V82 PolarHBondContact O-N 2.83Å; V82-G84 PolarHBondContact O-N 3.38Å; V82-A85 PolarHBondContact O-N 3.42Å; V82-A85 VanDerWaalsContact O-N 3.16Å
83	V	52.9	Low	58.5	Low	108 Å²	108	121.4 Å²	121.4	66%	0.655	70%	0.7	S	S	*	*	G	3₁₀ helix	trans	-66.9	-4.9	174.5	-65.8	0	0	0	0	113.6
84	G	50.3	Low	56.3	Low	64 Å²	64	121.7 Å²	121.7	66%	0.66	70%	0.703	S	S	*	*	G	3₁₀ helix	trans	-98.6	-7.2	173.8	0	0	0	0	0	116	V82	V82-G84 PolarHBondContact O-N 3.38Å
85	A	49.3	Very low	54.7	Low	67 Å²	67	122 Å²	122	55%	0.554	71%	0.714	S	S	*	*	T	Hydrogen-bonded Turn	trans	-111.5	-13.8	-162.8	0	0	0	0	0	116.3	V82 S87	V82-A85 PolarHBondContact O-N 3.42Å; V82-A85 VanDerWaalsContact O-N 3.16Å; A85-S87 VanDerWaalsContact C-N 3.29Å; A85-S87 PolarHBondContact O-N 3.38Å
86	E	49.3	Very low	52.8	Low	157 Å²	157	126.9 Å²	126.9	73%	0.734	75%	0.749	S	S	*	*	T	Hydrogen-bonded Turn	trans	-91	21.5	-174.9	-62.5	-173.7	99	0	0	114.1
87	S	46.8	Very low	51.4	Low	113 Å²	113	125.8 Å²	125.8	79%	0.79	75%	0.754	S	S	*	*	T	Hydrogen-bonded Turn	trans	-97	0.1	173.2	-49.4	0	0	0	0	114.4	A85	A85-S87 VanDerWaalsContact C-N 3.29Å; A85-S87 PolarHBondContact O-N 3.38Å
88	E	45.8	Very low	50.1	Low	175 Å²	175	124.6 Å²	124.6	82%	0.818	75%	0.753	S	S	*	*	S	Bend	trans	-120.4	8.6	-166.8	-99.4	169.7	116.3	0	0	117.4
89	E	44.9	Very low	49.2	Very low	190 Å²	190	130.3 Å²	130.3	89%	0.888	79%	0.787	S	S	*	*	S	Bend	trans	-127	53.4	177	-69.5	-165.5	174.4	0	0	114.5
90	E	45	Very low	48.6	Very low	198 Å²	198	133.3 Å²	133.3	93%	0.925	80%	0.8	S	S	*	*	S	Bend	trans	-142.8	19.6	157.2	-88.6	-157.1	114.7	0	0	114.8
91	D	43.7	Very low	48	Very low	167 Å²	167	133.8 Å²	133.8	89%	0.893	80%	0.8	S	S	*	*	S	Bend	trans	-125.4	63.1	172.8	-156	-98.6	0	0	0	111.7
92	A	49.5	Very low	47.7	Very low	104 Å²	104	131.1 Å²	131.1	86%	0.86	80%	0.798	S	S	*	*	S	Bend	trans	-152.7	41.1	169.5	0	0	0	0	0	113.2
93	S	49.8	Very low	47.4	Very low	122 Å²	122	136.4 Å²	136.4	85%	0.853	83%	0.831	S	S	*	*	S	Bend	trans	-137.2	19.2	169	72.9	0	0	0	0	115.3
94	H	40.1	Very low	47	Very low	184 Å²	184	138.5 Å²	138.5	85%	0.852	84%	0.844	S	S	*	*			trans	-126.5	77	174.8	-156.1	-10.1	0	0	0	114
95	A	52.1	Low	46.7	Very low	92 Å²	92	144.8 Å²	144.8	76%	0.76	86%	0.86	S	S	*	*			trans	-157	89.6	150.8	0	0	0	0	0	105.5
96	A	44.4	Very low	46.5	Very low	168 Å²	168	151.8 Å²	151.8	100%	1.388	89%	0.887	S	S	*	*				57.2	0	89.4	0	0	0	0	0	112.3

Retrieved 96 of 96 residues in 153 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).