A0A077ZNI7_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZNI7, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 107 aa.

						>A0A077ZNI7_TRITR|A0A077ZNI7
MLHEDMCERYRDNLSMTIPDWVLDPFTRLAEVEVAYQEELIEMQATEELKPKMKGGYTTLKKLKDIVDNLNQCEELAVYFTHYDMTSAPWKCCSIEQKGMFKRSTDR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	88	Confident	92.4	Very high	187 Å²	187	121.9 Å²	121.9	92%	0.921	56%	0.56	S	S	*	*				0	-80.4	0	-68.8	-159.2	-62.7	0	0	113.4	H3 E4 D5	M1-H3 VanDerWaalsContact C-N 3.35Å; M1-H3 PolarHBondContact O-N 3.35Å; M1-E4 WeakPolarHBondContact CA-OE2 3.45Å; M1-E4 PolarHBondContact N-OE2 2.86Å; M1-E4 PolarHBondContact O-N 3.01Å; M1-D5 PolarHBondContact O-N 3.46Å
2	L	93.7	Very high	92.2	Very high	123 Å²	123	122.1 Å²	122.1	64%	0.644	57%	0.568	S	S	*	*	H	α-helix	trans	-60	-42.1	-174.8	-174.8	67.9	0	0	0	113.2	E4 D5 M6	L2-E4 PolarHBondContact O-N 3.24Å; L2-D5 PolarHBondContact O-N 2.75Å; L2-M6 HydrophobicContact CD1-CE 3.77Å; L2-M6 HydrophobicContact CD1-CG 4.49Å; L2-M6 HydrophobicContact CG-CE 4.44Å; L2-M6 HydrophobicContact CG-CG 4.45Å; L2-M6 VanDerWaalsContact O-CG 3.24Å; L2-M6 WeakPolarHBondContact O-CG 3.13Å; L2-M6 PolarHBondContact O-N 3.37Å
3	H	92.4	Very high	91.9	Very high	147 Å²	147	120.8 Å²	120.8	68%	0.681	57%	0.568	S	S	*	*	H	α-helix	trans	-60.8	-45.5	177.5	179.9	-84.3	0	0	0	112.1	M1 M6 C7	M1-H3 VanDerWaalsContact C-N 3.35Å; M1-H3 PolarHBondContact O-N 3.35Å; H3-M6 PolarHBondContact O-N 3.31Å; H3-C7 PolarHBondContact CE1-SG 3.15Å; H3-C7 WeakPolarHBondContact O-CB 3.42Å; H3-C7 PolarHBondContact O-N 3.25Å; H3-C7 PolarHBondContact O-SG 3.45Å; H3-C7 VanDerWaalsContact O-SG 3.33Å
4	E	93.9	Very high	91.2	Very high	130 Å²	130	121.1 Å²	121.1	61%	0.607	57%	0.574	S	S	*	*	H	α-helix	trans	-63.7	-44.5	178.9	-69.4	153.9	153.8	0	0	111.4	M1 L2 M6 C7 E8	M1-E4 WeakPolarHBondContact CA-OE2 3.45Å; M1-E4 PolarHBondContact N-OE2 2.86Å; M1-E4 PolarHBondContact O-N 3.01Å; L2-E4 PolarHBondContact O-N 3.24Å; E4-M6 VanDerWaalsContact C-N 3.33Å; E4-M6 PolarHBondContact O-N 3.47Å; E4-C7 PolarHBondContact O-N 3.04Å; E4-E8 WeakPolarHBondContact O-CB 3.46Å; E4-E8 PolarHBondContact O-N 3.18Å
5	D	94.2	Very high	91	Very high	54 Å²	54	118.9 Å²	118.9	29%	0.289	58%	0.577	S	S	.	*	H	α-helix	trans	-61	-40.6	176.5	179.2	55.6	0	0	0	111.6	M1 L2 E8 R9	M1-D5 PolarHBondContact O-N 3.46Å; L2-D5 PolarHBondContact O-N 2.75Å; D5-E8 PolarHBondContact O-N 3.11Å; D5-R9 VanDerWaalsContact CG-NE 3.32Å; D5-R9 WeakPolarHBondContact O-CB 2.98Å; D5-R9 VanDerWaalsContact O-CG 3.24Å; D5-R9 WeakPolarHBondContact O-CG 3.39Å; D5-R9 PolarHBondContact O-N 3.38Å; D5-R9 IonicContact OD1-CZ 3.89Å; D5-R9 VanDerWaalsContact OD1-CZ 3.32Å; D5-R9 IonicContact OD1-NE 2.99Å; D5-R9 PolarHBondContact OD1-NE 3.21Å; D5-R9 IonicContact OD1-NH2 3.32Å; D5-R9 PolarHBondContact OD1-NH2 3.4Å; D5-R9 IonicContact OD2-CZ 2.63Å; D5-R9 IonicContact OD2-NE 2.9Å; D5-R9 PolarHBondContact OD2-NE 3.34Å; D5-R9 IonicContact OD2-NH1 3.62Å; D5-R9 IonicContact OD2-NH2 3.11Å; D5-R9 PolarHBondContact OD2-NH2 2.94Å
6	M	91.2	Very high	91	Very high	79 Å²	79	119.3 Å²	119.3	39%	0.389	58%	0.579	S	S	.	*	H	α-helix	trans	-67	-44.7	175.1	-68.4	-66.4	173.3	0	0	112.2	L2 H3 E4 E8 R9 Y10	L2-M6 HydrophobicContact CD1-CE 3.77Å; L2-M6 HydrophobicContact CD1-CG 4.49Å; L2-M6 HydrophobicContact CG-CE 4.44Å; L2-M6 HydrophobicContact CG-CG 4.45Å; L2-M6 VanDerWaalsContact O-CG 3.24Å; L2-M6 WeakPolarHBondContact O-CG 3.13Å; L2-M6 PolarHBondContact O-N 3.37Å; H3-M6 PolarHBondContact O-N 3.31Å; E4-M6 VanDerWaalsContact C-N 3.33Å; E4-M6 PolarHBondContact O-N 3.47Å; M6-E8 VanDerWaalsContact C-N 3.27Å; M6-E8 PolarHBondContact O-N 3.18Å; M6-R9 PolarHBondContact O-N 2.85Å; M6-Y10 WeakPolarHBondContact O-CB 3.3Å; M6-Y10 VanDerWaalsContact O-CD2 3.31Å; M6-Y10 WeakPolarHBondContact O-CD2 3.35Å; M6-Y10 PolarHBondContact O-N 3.25Å; M6-Y10 HydrophobicContact SD-CD2 4.33Å; M6-Y10 HydrophobicContact SD-CE2 3.84Å
7	C	92.1	Very high	90.9	Very high	50 Å²	50	120 Å²	120	34%	0.338	59%	0.593	S	S	.	*	H	α-helix	trans	-63.1	-34.2	176.6	-72.5	0	0	0	0	112.3	H3 E4 R11	H3-C7 PolarHBondContact CE1-SG 3.15Å; H3-C7 WeakPolarHBondContact O-CB 3.42Å; H3-C7 PolarHBondContact O-N 3.25Å; H3-C7 PolarHBondContact O-SG 3.45Å; H3-C7 VanDerWaalsContact O-SG 3.33Å; E4-C7 PolarHBondContact O-N 3.04Å; C7-R11 VanDerWaalsContact O-CA 3.3Å; C7-R11 WeakPolarHBondContact O-CA 3.45Å; C7-R11 WeakPolarHBondContact O-CB 3.48Å; C7-R11 PolarHBondContact O-N 3.49Å
8	E	92.8	Very high	90.8	Very high	128 Å²	128	118.5 Å²	118.5	60%	0.598	59%	0.586	S	S	*	*	H	α-helix	trans	-72.3	-44.5	177.5	-168.5	165	-152.6	0	0	111.7	E4 D5 M6 Y10	E4-E8 WeakPolarHBondContact O-CB 3.46Å; E4-E8 PolarHBondContact O-N 3.18Å; D5-E8 PolarHBondContact O-N 3.11Å; M6-E8 VanDerWaalsContact C-N 3.27Å; M6-E8 PolarHBondContact O-N 3.18Å; E8-Y10 PolarHBondContact O-N 2.93Å
9	R	94.1	Very high	90.6	Very high	169 Å²	169	115.4 Å²	115.4	64%	0.638	58%	0.576	S	S	*	*	H	α-helix	trans	-67	-35.3	178.8	-71.5	175.9	-168.1	-161.8	5.6	113.9	D5 M6	D5-R9 VanDerWaalsContact CG-NE 3.32Å; D5-R9 WeakPolarHBondContact O-CB 2.98Å; D5-R9 VanDerWaalsContact O-CG 3.24Å; D5-R9 WeakPolarHBondContact O-CG 3.39Å; D5-R9 PolarHBondContact O-N 3.38Å; D5-R9 IonicContact OD1-CZ 3.89Å; D5-R9 VanDerWaalsContact OD1-CZ 3.32Å; D5-R9 IonicContact OD1-NE 2.99Å; D5-R9 PolarHBondContact OD1-NE 3.21Å; D5-R9 IonicContact OD1-NH2 3.32Å; D5-R9 PolarHBondContact OD1-NH2 3.4Å; D5-R9 IonicContact OD2-CZ 2.63Å; D5-R9 IonicContact OD2-NE 2.9Å; D5-R9 PolarHBondContact OD2-NE 3.34Å; D5-R9 IonicContact OD2-NH1 3.62Å; D5-R9 IonicContact OD2-NH2 3.11Å; D5-R9 PolarHBondContact OD2-NH2 2.94Å; M6-R9 PolarHBondContact O-N 2.85Å
10	Y	91.8	Very high	90.4	Very high	120 Å²	120	116.3 Å²	116.3	47%	0.471	58%	0.582	S	S	.	*	T	Hydrogen-bonded Turn	trans	-106.9	14.7	-177.1	-62.9	-69.5	0	0	0	113	M6 E8 D12 N13 L14	M6-Y10 WeakPolarHBondContact O-CB 3.3Å; M6-Y10 VanDerWaalsContact O-CD2 3.31Å; M6-Y10 WeakPolarHBondContact O-CD2 3.35Å; M6-Y10 PolarHBondContact O-N 3.25Å; M6-Y10 HydrophobicContact SD-CD2 4.33Å; M6-Y10 HydrophobicContact SD-CE2 3.84Å; E8-Y10 PolarHBondContact O-N 2.93Å; Y10-D12 PolarHBondContact O-N 2.93Å; Y10-N13 PolarHBondContact O-N 3.24Å; Y10-N13 VanDerWaalsContact O-N 3.1Å; Y10-L14 WeakPolarHBondContact O-CB 3.43Å; Y10-L14 VanDerWaalsContact O-CG 3.3Å; Y10-L14 WeakPolarHBondContact O-CG 3.44Å; Y10-L14 PolarHBondContact O-N 3.07Å
11	R	91.9	Very high	90.1	Very high	154 Å²	154	118.6 Å²	118.6	58%	0.581	58%	0.584	S	S	*	*	H	α-helix	trans	-49.9	-46.9	-178.7	-169.8	-175.7	-58.2	-157.3	4.1	111.9	C7 L14 S15	C7-R11 VanDerWaalsContact O-CA 3.3Å; C7-R11 WeakPolarHBondContact O-CA 3.45Å; C7-R11 WeakPolarHBondContact O-CB 3.48Å; C7-R11 PolarHBondContact O-N 3.49Å; R11-L14 PolarHBondContact O-N 3.41Å; R11-S15 WeakPolarHBondContact O-CB 3.4Å; R11-S15 PolarHBondContact O-N 2.92Å; R11-S15 PolarHBondContact O-OG 3.46Å
12	D	90.6	Very high	90	Very high	124 Å²	124	113.2 Å²	113.2	66%	0.663	56%	0.562	S	S	*	*	H	α-helix	trans	-65.2	-48.6	-179.1	-61.4	-22.3	0	0	0	110.8	Y10 L14 S15 M16	Y10-D12 PolarHBondContact O-N 2.93Å; D12-L14 PolarHBondContact O-N 3.36Å; D12-S15 PolarHBondContact O-N 3.46Å; D12-S15 VanDerWaalsContact O-N 3.12Å; D12-S15 PolarHBondContact O-OG 3.21Å; D12-M16 WeakPolarHBondContact O-CG 3.44Å; D12-M16 PolarHBondContact O-N 3.34Å
13	N	87.3	Confident	89.8	Confident	106 Å²	106	113 Å²	113	57%	0.567	56%	0.561	S	S	*	*	H	α-helix	trans	-60.3	-41.2	176.6	-81.9	-8.3	0	0	0	112.9	Y10 S15 M16	Y10-N13 PolarHBondContact O-N 3.24Å; Y10-N13 VanDerWaalsContact O-N 3.1Å; N13-S15 PolarHBondContact O-N 2.83Å; N13-M16 PolarHBondContact O-N 3.22Å
14	L	83	Confident	89.5	Confident	125 Å²	125	109.3 Å²	109.3	65%	0.654	55%	0.546	S	S	*	.	H	α-helix	trans	-71.2	-22.6	179.1	-67.3	175.5	0	0	0	112.3	Y10 R11 D12	Y10-L14 WeakPolarHBondContact O-CB 3.43Å; Y10-L14 VanDerWaalsContact O-CG 3.3Å; Y10-L14 WeakPolarHBondContact O-CG 3.44Å; Y10-L14 PolarHBondContact O-N 3.07Å; R11-L14 PolarHBondContact O-N 3.41Å; D12-L14 PolarHBondContact O-N 3.36Å
15	S	88	Confident	88.7	Confident	88 Å²	88	106.3 Å²	106.3	62%	0.615	54%	0.538	S	S	*	.	H	α-helix	trans	-85	-11	176.2	72.9	0	0	0	0	113.9	R11 D12 N13	R11-S15 WeakPolarHBondContact O-CB 3.4Å; R11-S15 PolarHBondContact O-N 2.92Å; R11-S15 PolarHBondContact O-OG 3.46Å; D12-S15 PolarHBondContact O-N 3.46Å; D12-S15 VanDerWaalsContact O-N 3.12Å; D12-S15 PolarHBondContact O-OG 3.21Å; N13-S15 PolarHBondContact O-N 2.83Å
16	M	90.2	Very high	87.9	Confident	124 Å²	124	110.4 Å²	110.4	61%	0.611	55%	0.554	S	S	*	*	S	Bend	trans	-71.1	136.4	177.5	-69.1	179.8	67.3	0	0	110.7	D12 N13 I18	D12-M16 WeakPolarHBondContact O-CG 3.44Å; D12-M16 PolarHBondContact O-N 3.34Å; N13-M16 PolarHBondContact O-N 3.22Å; M16-I18 PolarHBondContact O-N 2.93Å
17	T	90.7	Very high	87.2	Confident	132 Å²	132	110.5 Å²	110.5	81%	0.81	56%	0.559	S	S	*	*	P	Polyproline II helix	trans	-61	119.8	169.1	-54.3	0	0	0	0	109	P19	T17-P19 WeakPolarHBondContact O-CD 3.46Å
18	I	88.4	Confident	86.2	Confident	93 Å²	93	117.8 Å²	117.8	48%	0.477	58%	0.579	S	S	.	*	P	Polyproline II helix	trans	-68.9	122.7	176.6	-55.9	176.9	0	0	0	107.7	M16 V22 L23	M16-I18 PolarHBondContact O-N 2.93Å; I18-V22 HydrophobicContact CG2-CB 3.76Å; I18-V22 HydrophobicContact CG2-CG1 3.86Å; I18-L23 HydrophobicContact CB-CD1 4.39Å; I18-L23 HydrophobicContact CB-CD2 4.22Å; I18-L23 HydrophobicContact CB-CG 4.25Å; I18-L23 HydrophobicContact CD1-CD2 4.19Å; I18-L23 HydrophobicContact CG2-CD1 4.34Å; I18-L23 HydrophobicContact CG2-CD2 3.69Å; I18-L23 HydrophobicContact CG2-CG 3.68Å
19	P	86.9	Confident	85.1	Confident	60 Å²	60	115.3 Å²	115.3	39%	0.39	57%	0.57	S	S	.	*	P	Polyproline II helix	trans	-62.6	145.1	176	-22.8	34.1	0	0	0	112	T17 W21 V22 L23	T17-P19 WeakPolarHBondContact O-CD 3.46Å; P19-W21 VanDerWaalsContact CB-CD1 3.5Å; P19-W21 HydrophobicContact CB-CG 4.34Å; P19-W21 PolarHBondContact O-N 2.96Å; P19-W21 VanDerWaalsContact O-N 3.13Å; P19-V22 HydrophobicContact CB-CG2 4.39Å; P19-V22 HydrophobicContact CG-CG2 4.45Å; P19-V22 WeakPolarHBondContact O-CB 3.5Å; P19-V22 PolarHBondContact O-N 3.21Å; P19-L23 PolarHBondContact O-N 3.28Å
20	D	87	Confident	84.1	Confident	132 Å²	132	110 Å²	110	71%	0.706	56%	0.562	S	S	*	*	H	α-helix	trans	-55.8	-36.1	-176.8	-61.4	-30.1	0	0	0	113.3	V22 L23 D24	D20-V22 PolarHBondContact O-N 2.89Å; D20-L23 PolarHBondContact O-N 3.15Å; D20-L23 VanDerWaalsContact O-N 3.1Å; D20-D24 PolarHBondContact O-N 2.94Å
21	W	84.3	Confident	83.1	Confident	165 Å²	165	112 Å²	112	63%	0.625	58%	0.576	S	S	*	*	H	α-helix	trans	-66.5	-19.2	179	66.5	-95.9	0	0	0	113.9	P19 P25	P19-W21 VanDerWaalsContact CB-CD1 3.5Å; P19-W21 HydrophobicContact CB-CG 4.34Å; P19-W21 PolarHBondContact O-N 2.96Å; P19-W21 VanDerWaalsContact O-N 3.13Å; W21-P25 WeakPolarHBondContact O-CA 3.36Å; W21-P25 WeakPolarHBondContact O-CB 3.46Å
22	V	86.3	Confident	82.2	Confident	74 Å²	74	107.5 Å²	107.5	45%	0.448	57%	0.565	S	S	.	*	H	α-helix	trans	-81.7	-37.8	172.9	179.6	0	0	0	0	110.4	I18 P19 D20	I18-V22 HydrophobicContact CG2-CB 3.76Å; I18-V22 HydrophobicContact CG2-CG1 3.86Å; P19-V22 HydrophobicContact CB-CG2 4.39Å; P19-V22 HydrophobicContact CG-CG2 4.45Å; P19-V22 WeakPolarHBondContact O-CB 3.5Å; P19-V22 PolarHBondContact O-N 3.21Å; D20-V22 PolarHBondContact O-N 2.89Å
23	L	88.6	Confident	81.5	Confident	118 Å²	118	106.6 Å²	106.6	62%	0.618	56%	0.557	S	S	*	*	H	α-helix	trans	-74.5	-38.8	179.2	-63.9	176	0	0	0	111.7	I18 P19 D20	I18-L23 HydrophobicContact CB-CD1 4.39Å; I18-L23 HydrophobicContact CB-CD2 4.22Å; I18-L23 HydrophobicContact CB-CG 4.25Å; I18-L23 HydrophobicContact CD1-CD2 4.19Å; I18-L23 HydrophobicContact CG2-CD1 4.34Å; I18-L23 HydrophobicContact CG2-CD2 3.69Å; I18-L23 HydrophobicContact CG2-CG 3.68Å; P19-L23 PolarHBondContact O-N 3.28Å; D20-L23 PolarHBondContact O-N 3.15Å; D20-L23 VanDerWaalsContact O-N 3.1Å
24	D	86.4	Confident	81	Confident	70 Å²	70	105.2 Å²	105.2	37%	0.374	55%	0.552	S	S	.	*			trans	-141.5	87.4	176.7	-173.8	0.2	0	0	0	110.1	D20 F26 T27	D20-D24 PolarHBondContact O-N 2.94Å; D24-F26 PolarHBondContact O-N 3.42Å; D24-F26 PolarHBondContact OD1-N 2.77Å; D24-T27 WeakPolarHBondContact CB-OG1 3.37Å; D24-T27 PolarHBondContact O-OG1 3.35Å; D24-T27 PolarHBondContact OD1-N 3.12Å; D24-T27 VanDerWaalsContact OD1-N 3.08Å; D24-T27 WeakPolarHBondContact OD2-CB 3.49Å; D24-T27 PolarHBondContact OD2-OG1 3.43Å
25	P	77.7	Confident	80.8	Confident	68 Å²	68	101.9 Å²	101.9	44%	0.442	54%	0.543	S	S	.	.	T	Hydrogen-bonded Turn	trans	-65.3	-15.2	176.8	21.7	-28.2	0	0	0	112.9	W21	W21-P25 WeakPolarHBondContact O-CA 3.36Å; W21-P25 WeakPolarHBondContact O-CB 3.46Å
26	F	77.1	Confident	80.4	Confident	140 Å²	140	104.7 Å²	104.7	61%	0.614	54%	0.541	S	S	*	.	T	Hydrogen-bonded Turn	trans	-99.6	-12.2	-174.5	-57.8	-79.9	0	0	0	113.8	D24 R28 L29 A30	D24-F26 PolarHBondContact O-N 3.42Å; D24-F26 PolarHBondContact OD1-N 2.77Å; F26-R28 VanDerWaalsContact C-N 3.26Å; F26-R28 PolarHBondContact O-N 3.03Å; F26-L29 HydrophobicContact CD1-CD1 3.42Å; F26-L29 VanDerWaalsContact CD1-CD1 3.42Å; F26-L29 HydrophobicContact CE1-CD1 3.93Å; F26-L29 HydrophobicContact CG-CD1 4.28Å; F26-L29 CarbonylContact O-C 3.53Å; F26-L29 WeakPolarHBondContact O-CA 3.36Å; F26-L29 WeakPolarHBondContact O-CB 3.45Å; F26-L29 PolarHBondContact O-N 3.07Å; F26-A30 PolarHBondContact O-N 3.11Å
27	T	76.6	Confident	80.1	Confident	81 Å²	81	103.3 Å²	103.3	50%	0.497	53%	0.533	S	S	.	.	H	α-helix	trans	-56.7	-44	179	-27.1	0	0	0	0	111.5	D24 L29 A30	D24-T27 WeakPolarHBondContact CB-OG1 3.37Å; D24-T27 PolarHBondContact O-OG1 3.35Å; D24-T27 PolarHBondContact OD1-N 3.12Å; D24-T27 VanDerWaalsContact OD1-N 3.08Å; D24-T27 WeakPolarHBondContact OD2-CB 3.49Å; D24-T27 PolarHBondContact OD2-OG1 3.43Å; T27-L29 VanDerWaalsContact C-N 3.28Å; T27-A30 PolarHBondContact O-N 3.14Å
28	R	70.1	Confident	79.8	Confident	202 Å²	202	103.2 Å²	103.2	76%	0.762	52%	0.523	S	S	*	.	H	α-helix	trans	-74.1	-24.2	177	-70.3	-173.4	167.1	-171.8	-4	112.5	F26 A30 V32	F26-R28 VanDerWaalsContact C-N 3.26Å; F26-R28 PolarHBondContact O-N 3.03Å; R28-A30 VanDerWaalsContact C-N 3.33Å; R28-V32 WeakPolarHBondContact O-CG2 3.42Å
29	L	70.4	Confident	79.6	Confident	76 Å²	76	103.9 Å²	103.9	40%	0.398	52%	0.524	S	S	.	.	H	α-helix	trans	-72.6	-27.9	175.6	-67.2	173.8	0	0	0	111.1	F26 T27 E31 V32 E33	F26-L29 HydrophobicContact CD1-CD1 3.42Å; F26-L29 VanDerWaalsContact CD1-CD1 3.42Å; F26-L29 HydrophobicContact CE1-CD1 3.93Å; F26-L29 HydrophobicContact CG-CD1 4.28Å; F26-L29 CarbonylContact O-C 3.53Å; F26-L29 WeakPolarHBondContact O-CA 3.36Å; F26-L29 WeakPolarHBondContact O-CB 3.45Å; F26-L29 PolarHBondContact O-N 3.07Å; T27-L29 VanDerWaalsContact C-N 3.28Å; L29-E31 VanDerWaalsContact C-N 3.33Å; L29-E31 PolarHBondContact O-N 3.42Å; L29-V32 CarbonylContact O-C 3.55Å; L29-V32 PolarHBondContact O-N 3.37Å; L29-V32 VanDerWaalsContact O-N 3.16Å; L29-E33 WeakPolarHBondContact O-CA 3.49Å; L29-E33 WeakPolarHBondContact O-CB 3.37Å; L29-E33 PolarHBondContact O-N 2.94Å
30	A	72.3	Confident	79.7	Confident	57 Å²	57	106 Å²	106	47%	0.471	53%	0.532	S	S	.	.	H	α-helix	trans	-56.8	-43.8	178.6	0	0	0	0	0	113.1	F26 T27 R28 V34	F26-A30 PolarHBondContact O-N 3.11Å; T27-A30 PolarHBondContact O-N 3.14Å; R28-A30 VanDerWaalsContact C-N 3.33Å; A30-V34 WeakPolarHBondContact O-CG2 3.44Å; A30-V34 PolarHBondContact O-N 3.2Å
31	E	71	Confident	79.7	Confident	164 Å²	164	105.1 Å²	105.1	77%	0.766	53%	0.526	S	S	*	.	H	α-helix	trans	-69.5	-41.1	176.9	-66.5	179.2	179.1	0	0	112	L29 A35	L29-E31 VanDerWaalsContact C-N 3.33Å; L29-E31 PolarHBondContact O-N 3.42Å; E31-A35 PolarHBondContact O-N 3.47Å
32	V	73.8	Confident	79.9	Confident	58 Å²	58	103.7 Å²	103.7	35%	0.352	53%	0.526	S	S	.	.	H	α-helix	trans	-73.5	-33.2	-177.2	171.7	0	0	0	0	111.6	R28 L29 A35 Y36	R28-V32 WeakPolarHBondContact O-CG2 3.42Å; L29-V32 CarbonylContact O-C 3.55Å; L29-V32 PolarHBondContact O-N 3.37Å; L29-V32 VanDerWaalsContact O-N 3.16Å; V32-A35 PolarHBondContact O-N 2.78Å; V32-Y36 HydrophobicContact CG1-CD2 3.38Å; V32-Y36 HydrophobicContact CG1-CE2 3.06Å; V32-Y36 WeakPolarHBondContact O-CB 3.45Å; V32-Y36 WeakPolarHBondContact O-CD2 3.3Å; V32-Y36 PolarHBondContact O-N 3.07Å
33	E	74.8	Confident	79.9	Confident	105 Å²	105	104.9 Å²	104.9	49%	0.491	53%	0.528	S	S	.	.	H	α-helix	trans	-68.5	-40.9	179.3	179.1	168.5	-166.2	0	0	110.7	L29 Y36 Q37	L29-E33 WeakPolarHBondContact O-CA 3.49Å; L29-E33 WeakPolarHBondContact O-CB 3.37Å; L29-E33 PolarHBondContact O-N 2.94Å; E33-Y36 PolarHBondContact O-N 3.36Å; E33-Q37 HydrophobicContact CG-CG 4.36Å; E33-Q37 VanDerWaalsContact O-CB 3.3Å; E33-Q37 WeakPolarHBondContact O-CB 3.48Å; E33-Q37 WeakPolarHBondContact O-CG 3.41Å; E33-Q37 PolarHBondContact O-N 2.82Å; E33-Q37 PolarHBondContact OE1-NE2 3.18Å
34	V	77.7	Confident	79.9	Confident	77 Å²	77	104.9 Å²	104.9	47%	0.467	53%	0.525	S	S	.	.	H	α-helix	trans	-61.4	-47.9	173.6	175.3	0	0	0	0	110.6	A30 Y36 Q37 E38	A30-V34 WeakPolarHBondContact O-CG2 3.44Å; A30-V34 PolarHBondContact O-N 3.2Å; V34-Y36 PolarHBondContact O-N 3.33Å; V34-Q37 PolarHBondContact O-N 3.24Å; V34-E38 WeakPolarHBondContact O-CG 3.43Å; V34-E38 PolarHBondContact O-N 2.93Å
35	A	78.5	Confident	79.9	Confident	56 Å²	56	103.6 Å²	103.6	46%	0.463	52%	0.524	S	S	.	.	H	α-helix	trans	-61	-43.8	178.6	0	0	0	0	0	112.3	E31 V32 E38 E39	E31-A35 PolarHBondContact O-N 3.47Å; V32-A35 PolarHBondContact O-N 2.78Å; A35-E38 PolarHBondContact O-N 3.4Å; A35-E39 PolarHBondContact O-N 3.31Å; A35-E39 VanDerWaalsContact O-N 3.15Å
36	Y	79.7	Confident	80.3	Confident	146 Å²	146	103.2 Å²	103.2	57%	0.573	52%	0.521	S	S	*	.	H	α-helix	trans	-67.7	-35.5	176.5	-76.2	-51.1	0	0	0	112.9	V32 E33 V34 L40	V32-Y36 HydrophobicContact CG1-CD2 3.38Å; V32-Y36 HydrophobicContact CG1-CE2 3.06Å; V32-Y36 WeakPolarHBondContact O-CB 3.45Å; V32-Y36 WeakPolarHBondContact O-CD2 3.3Å; V32-Y36 PolarHBondContact O-N 3.07Å; E33-Y36 PolarHBondContact O-N 3.36Å; V34-Y36 PolarHBondContact O-N 3.33Å; Y36-L40 WeakPolarHBondContact O-CB 3.34Å; Y36-L40 WeakPolarHBondContact O-CG 3.45Å; Y36-L40 PolarHBondContact O-N 3.12Å
37	Q	84	Confident	80.7	Confident	96 Å²	96	102 Å²	102	45%	0.449	52%	0.517	S	S	.	.	H	α-helix	trans	-64.9	-42.4	175.8	-77.1	176.6	9.6	0	0	111.4	E33 V34 L40 I41	E33-Q37 HydrophobicContact CG-CG 4.36Å; E33-Q37 VanDerWaalsContact O-CB 3.3Å; E33-Q37 WeakPolarHBondContact O-CB 3.48Å; E33-Q37 WeakPolarHBondContact O-CG 3.41Å; E33-Q37 PolarHBondContact O-N 2.82Å; E33-Q37 PolarHBondContact OE1-NE2 3.18Å; V34-Q37 PolarHBondContact O-N 3.24Å; Q37-L40 PolarHBondContact O-N 3.07Å; Q37-I41 WeakPolarHBondContact O-CB 3.33Å; Q37-I41 WeakPolarHBondContact O-CD1 3.06Å; Q37-I41 WeakPolarHBondContact O-CG1 3.46Å; Q37-I41 PolarHBondContact O-N 3.41Å
38	E	83.8	Confident	81	Confident	129 Å²	129	102.9 Å²	102.9	60%	0.603	52%	0.515	S	S	*	.	H	α-helix	trans	-60.8	-47.1	175.8	-72.1	-179.8	170.2	0	0	111.9	V34 A35 L40 I41 E42	V34-E38 WeakPolarHBondContact O-CG 3.43Å; V34-E38 PolarHBondContact O-N 2.93Å; A35-E38 PolarHBondContact O-N 3.4Å; E38-L40 PolarHBondContact O-N 2.9Å; E38-I41 PolarHBondContact O-N 3Å; E38-E42 PolarHBondContact O-N 3.19Å
39	E	84.6	Confident	81.5	Confident	107 Å²	107	97.5 Å²	97.5	50%	0.5	50%	0.501	S	S	.	.	H	α-helix	trans	-62.1	-41.4	178.6	-167.7	-177.7	-179.2	0	0	111.9	A35 E42 M43	A35-E39 PolarHBondContact O-N 3.31Å; A35-E39 VanDerWaalsContact O-N 3.15Å; E39-E42 PolarHBondContact O-N 3.43Å; E39-M43 HydrophobicContact CG-CE 4.27Å; E39-M43 WeakPolarHBondContact O-CG 3.49Å; E39-M43 PolarHBondContact O-N 3.31Å
40	L	88.4	Confident	82.1	Confident	106 Å²	106	98.5 Å²	98.5	56%	0.555	50%	0.502	S	S	*	.	H	α-helix	trans	-64.3	-41.7	176.3	-73	170.7	0	0	0	112.1	Y36 Q37 E38 M43 Q44	Y36-L40 WeakPolarHBondContact O-CB 3.34Å; Y36-L40 WeakPolarHBondContact O-CG 3.45Å; Y36-L40 PolarHBondContact O-N 3.12Å; Q37-L40 PolarHBondContact O-N 3.07Å; E38-L40 PolarHBondContact O-N 2.9Å; L40-M43 HydrophobicContact CD2-CE 3.84Å; L40-Q44 WeakPolarHBondContact O-CB 3.34Å; L40-Q44 PolarHBondContact O-N 3.2Å
41	I	88.1	Confident	82.3	Confident	112 Å²	112	99.7 Å²	99.7	57%	0.574	51%	0.505	S	S	*	.	H	α-helix	trans	-65.8	-43.3	177.8	-68.8	163.8	0	0	0	110.5	Q37 E38 Q44 A45	Q37-I41 WeakPolarHBondContact O-CB 3.33Å; Q37-I41 WeakPolarHBondContact O-CD1 3.06Å; Q37-I41 WeakPolarHBondContact O-CG1 3.46Å; Q37-I41 PolarHBondContact O-N 3.41Å; E38-I41 PolarHBondContact O-N 3Å; I41-Q44 PolarHBondContact O-N 2.92Å; I41-A45 WeakPolarHBondContact O-CB 3.16Å; I41-A45 PolarHBondContact O-N 3.29Å
42	E	87.8	Confident	82.6	Confident	136 Å²	136	98.8 Å²	98.8	64%	0.636	50%	0.499	S	S	*	.	H	α-helix	trans	-62.3	-45	177.7	-175.6	177.7	-174.2	0	0	111.7	E38 E39 A45 T46	E38-E42 PolarHBondContact O-N 3.19Å; E39-E42 PolarHBondContact O-N 3.43Å; E42-A45 PolarHBondContact O-N 3.25Å; E42-T46 WeakPolarHBondContact O-CB 3.49Å; E42-T46 PolarHBondContact O-N 2.96Å; E42-T46 PolarHBondContact O-OG1 3.48Å
43	M	87	Confident	82.8	Confident	98 Å²	98	102.4 Å²	102.4	48%	0.483	51%	0.513	S	S	.	.	H	α-helix	trans	-60.8	-46.4	175.4	-77.3	-168	-68.9	0	0	111.5	E39 L40 T46 E47	E39-M43 HydrophobicContact CG-CE 4.27Å; E39-M43 WeakPolarHBondContact O-CG 3.49Å; E39-M43 PolarHBondContact O-N 3.31Å; L40-M43 HydrophobicContact CD2-CE 3.84Å; M43-T46 PolarHBondContact O-N 3.35Å; M43-E47 WeakPolarHBondContact O-CG 3.42Å; M43-E47 PolarHBondContact O-N 2.89Å
44	Q	88.2	Confident	82.9	Confident	118 Å²	118	104.7 Å²	104.7	55%	0.551	52%	0.522	S	S	*	.	H	α-helix	trans	-64.1	-45.4	179.7	-174.4	175.1	-11.9	0	0	111.8	L40 I41 T46 E47 E48	L40-Q44 WeakPolarHBondContact O-CB 3.34Å; L40-Q44 PolarHBondContact O-N 3.2Å; I41-Q44 PolarHBondContact O-N 2.92Å; Q44-T46 VanDerWaalsContact C-N 3.28Å; Q44-T46 PolarHBondContact O-N 3.5Å; Q44-E47 PolarHBondContact O-N 3.41Å; Q44-E48 HydrophobicContact CG-CG 4.46Å; Q44-E48 PolarHBondContact NE2-OE1 3.03Å; Q44-E48 WeakPolarHBondContact O-CG 3.47Å; Q44-E48 PolarHBondContact O-N 3.44Å
45	A	86.5	Confident	83	Confident	43 Å²	43	102.9 Å²	102.9	36%	0.355	52%	0.519	S	S	.	.	H	α-helix	trans	-59.7	-41	176.7	0	0	0	0	0	111.4	I41 E42 E48 L49	I41-A45 WeakPolarHBondContact O-CB 3.16Å; I41-A45 PolarHBondContact O-N 3.29Å; E42-A45 PolarHBondContact O-N 3.25Å; A45-E48 PolarHBondContact O-N 2.97Å; A45-L49 VanDerWaalsContact O-CB 3.32Å; A45-L49 WeakPolarHBondContact O-CB 3.32Å; A45-L49 WeakPolarHBondContact O-CD1 3.33Å; A45-L49 WeakPolarHBondContact O-CG 3.41Å; A45-L49 PolarHBondContact O-N 3.36Å
46	T	85.8	Confident	83	Confident	61 Å²	61	102 Å²	102	37%	0.374	51%	0.514	S	S	.	.	H	α-helix	trans	-62.4	-46.3	177.2	-63.5	0	0	0	0	111.7	E42 M43 Q44 L49 K50	E42-T46 WeakPolarHBondContact O-CB 3.49Å; E42-T46 PolarHBondContact O-N 2.96Å; E42-T46 PolarHBondContact O-OG1 3.48Å; M43-T46 PolarHBondContact O-N 3.35Å; Q44-T46 VanDerWaalsContact C-N 3.28Å; Q44-T46 PolarHBondContact O-N 3.5Å; T46-L49 PolarHBondContact O-N 3.11Å; T46-K50 WeakPolarHBondContact O-CG 3.2Å; T46-K50 PolarHBondContact O-N 3.24Å; T46-K50 VanDerWaalsContact O-N 3.13Å
47	E	85.2	Confident	83	Confident	113 Å²	113	102.8 Å²	102.8	53%	0.528	52%	0.518	S	S	.	.	H	α-helix	trans	-66.2	-38.4	177.9	-68.8	-51.4	133.9	0	0	112.8	M43 Q44 K50 P51	M43-E47 WeakPolarHBondContact O-CG 3.42Å; M43-E47 PolarHBondContact O-N 2.89Å; Q44-E47 PolarHBondContact O-N 3.41Å; E47-K50 IonicContact OE1-NZ 3.24Å; E47-K50 PolarHBondContact OE1-NZ 3.17Å; E47-K50 IonicContact OE2-NZ 2.82Å; E47-P51 WeakPolarHBondContact O-CD 3.41Å
48	E	83.8	Confident	82.9	Confident	100 Å²	100	101.7 Å²	101.7	47%	0.467	52%	0.517	S	S	.	.	H	α-helix	trans	-70.4	-30.3	177	-72.7	-174.7	-165.6	0	0	113.4	Q44 A45 P51	Q44-E48 HydrophobicContact CG-CG 4.46Å; Q44-E48 PolarHBondContact NE2-OE1 3.03Å; Q44-E48 WeakPolarHBondContact O-CG 3.47Å; Q44-E48 PolarHBondContact O-N 3.44Å; A45-E48 PolarHBondContact O-N 2.97Å; E48-P51 WeakPolarHBondContact O-CD 3.47Å; E48-P51 WeakPolarHBondContact O-CG 3.41Å
49	L	79.7	Confident	82.9	Confident	89 Å²	89	99.2 Å²	99.2	47%	0.466	51%	0.511	S	S	.	.	H	α-helix	trans	-80.4	-33.8	179.8	-72.8	171.3	0	0	0	113	A45 T46 K52 M53	A45-L49 VanDerWaalsContact O-CB 3.32Å; A45-L49 WeakPolarHBondContact O-CB 3.32Å; A45-L49 WeakPolarHBondContact O-CD1 3.33Å; A45-L49 WeakPolarHBondContact O-CG 3.41Å; A45-L49 PolarHBondContact O-N 3.36Å; T46-L49 PolarHBondContact O-N 3.11Å; L49-K52 PolarHBondContact O-N 2.86Å; L49-K52 VanDerWaalsContact O-N 3.09Å; L49-M53 WeakPolarHBondContact O-CG 3.4Å; L49-M53 PolarHBondContact O-N 3.04Å
50	K	82.5	Confident	82.9	Confident	98 Å²	98	99.6 Å²	99.6	43%	0.426	52%	0.516	S	S	.	.	H	α-helix	trans	-46.7	-52.9	178	-83.3	171.4	-178.3	173.1	0	114.3	T46 E47 K52 M53 K54	T46-K50 WeakPolarHBondContact O-CG 3.2Å; T46-K50 PolarHBondContact O-N 3.24Å; T46-K50 VanDerWaalsContact O-N 3.13Å; E47-K50 IonicContact OE1-NZ 3.24Å; E47-K50 PolarHBondContact OE1-NZ 3.17Å; E47-K50 IonicContact OE2-NZ 2.82Å; K50-K52 PolarHBondContact O-N 3.46Å; K50-M53 PolarHBondContact O-N 3.23Å; K50-K54 WeakPolarHBondContact O-CG 3.19Å; K50-K54 PolarHBondContact O-N 3.4Å; K50-K54 VanDerWaalsContact O-N 3.1Å
51	P	76.5	Confident	82.8	Confident	81 Å²	81	100.3 Å²	100.3	53%	0.526	52%	0.515	S	S	.	.	H	α-helix	trans	-66.8	-36.1	-179.9	24.4	-32.6	0	0	0	112.7	E47 E48 M53 K54	E47-P51 WeakPolarHBondContact O-CD 3.41Å; E48-P51 WeakPolarHBondContact O-CD 3.47Å; E48-P51 WeakPolarHBondContact O-CG 3.41Å; P51-M53 VanDerWaalsContact C-N 3.35Å; P51-M53 PolarHBondContact O-N 2.96Å; P51-K54 PolarHBondContact O-N 3.35Å
52	K	78.7	Confident	82.9	Confident	146 Å²	146	101.8 Å²	101.8	64%	0.635	52%	0.517	S	S	*	.	H	α-helix	trans	-64.4	-40.4	176.9	-64.6	175.6	-178.2	166.5	0	111.2	L49 K50	L49-K52 PolarHBondContact O-N 2.86Å; L49-K52 VanDerWaalsContact O-N 3.09Å; K50-K52 PolarHBondContact O-N 3.46Å
53	M	76.9	Confident	82.9	Confident	134 Å²	134	99.8 Å²	99.8	66%	0.66	51%	0.51	S	S	*	.	H	α-helix	trans	-70.3	-34.5	177.6	-68.7	-175.2	76.5	0	0	113.2	L49 K50 P51 G55 G56 Y57	L49-M53 WeakPolarHBondContact O-CG 3.4Å; L49-M53 PolarHBondContact O-N 3.04Å; K50-M53 PolarHBondContact O-N 3.23Å; P51-M53 VanDerWaalsContact C-N 3.35Å; P51-M53 PolarHBondContact O-N 2.96Å; M53-G55 VanDerWaalsContact C-N 3.3Å; M53-G55 PolarHBondContact O-N 2.87Å; M53-G56 PolarHBondContact O-N 3.14Å; M53-Y57 WeakPolarHBondContact O-CB 3.11Å; M53-Y57 PolarHBondContact O-N 3.1Å
54	K	77.9	Confident	83.1	Confident	153 Å²	153	101 Å²	101	67%	0.665	51%	0.512	S	S	*	.	H	α-helix	trans	-58	-41.1	175.9	-76.6	176.2	-178.6	179	0	112.2	K50 P51 T58	K50-K54 WeakPolarHBondContact O-CG 3.19Å; K50-K54 PolarHBondContact O-N 3.4Å; K50-K54 VanDerWaalsContact O-N 3.1Å; P51-K54 PolarHBondContact O-N 3.35Å; K54-T58 VanDerWaalsContact O-CG2 3.3Å; K54-T58 WeakPolarHBondContact O-CG2 3.49Å; K54-T58 PolarHBondContact O-N 3.37Å; K54-T58 VanDerWaalsContact O-N 3.14Å; K54-T58 PolarHBondContact O-OG1 2.92Å
55	G	78.9	Confident	83.2	Confident	39 Å²	39	99 Å²	99	40%	0.402	51%	0.506	S	S	.	.	H	α-helix	trans	-62.7	-46	175.6	0	0	0	0	0	112.7	M53 T58 T59	M53-G55 VanDerWaalsContact C-N 3.3Å; M53-G55 PolarHBondContact O-N 2.87Å; G55-T58 PolarHBondContact O-OG1 2.63Å; G55-T59 PolarHBondContact O-N 3.4Å; G55-T59 PolarHBondContact O-OG1 2.87Å
56	G	79.9	Confident	83.4	Confident	36 Å²	36	101.4 Å²	101.4	37%	0.371	51%	0.512	S	S	.	.	H	α-helix	trans	-63.4	-48.3	176.9	0	0	0	0	0	112.6	M53 T58 T59 L60	M53-G56 PolarHBondContact O-N 3.14Å; G56-T58 PolarHBondContact O-N 3.22Å; G56-T59 WeakPolarHBondContact O-CB 3.49Å; G56-T59 PolarHBondContact O-N 3.5Å; G56-T59 VanDerWaalsContact O-N 3.17Å; G56-L60 WeakPolarHBondContact O-CG 2.99Å; G56-L60 PolarHBondContact O-N 3.13Å
57	Y	78	Confident	83.6	Confident	164 Å²	164	102 Å²	102	64%	0.643	52%	0.515	S	S	*	.	H	α-helix	trans	-61.6	-42.5	-178.1	-177.9	-97.1	0	0	0	112.7	M53 T59 L60 K61	M53-Y57 WeakPolarHBondContact O-CB 3.11Å; M53-Y57 PolarHBondContact O-N 3.1Å; Y57-T59 VanDerWaalsContact C-N 3.32Å; Y57-T59 PolarHBondContact O-N 3.5Å; Y57-L60 PolarHBondContact O-N 3.38Å; Y57-K61 WeakPolarHBondContact O-CB 3.39Å; Y57-K61 PolarHBondContact O-N 3.41Å
58	T	82.3	Confident	83.9	Confident	72 Å²	72	100 Å²	100	44%	0.442	51%	0.508	S	S	.	.	H	α-helix	trans	-64.8	-37.5	176.9	54.3	0	0	0	0	112	K54 G55 G56 K61 K62	K54-T58 VanDerWaalsContact O-CG2 3.3Å; K54-T58 WeakPolarHBondContact O-CG2 3.49Å; K54-T58 PolarHBondContact O-N 3.37Å; K54-T58 VanDerWaalsContact O-N 3.14Å; K54-T58 PolarHBondContact O-OG1 2.92Å; G55-T58 PolarHBondContact O-OG1 2.63Å; G56-T58 PolarHBondContact O-N 3.22Å; T58-K61 PolarHBondContact O-N 3.09Å; T58-K62 WeakPolarHBondContact O-CG 3.3Å; T58-K62 PolarHBondContact O-N 3.26Å; T58-K62 VanDerWaalsContact O-N 3.11Å
59	T	83.7	Confident	84.2	Confident	77 Å²	77	99.6 Å²	99.6	47%	0.472	51%	0.509	S	S	.	.	H	α-helix	trans	-66.5	-45.3	174.6	-54.6	0	0	0	0	111.4	G55 G56 Y57 K61 K62 L63	G55-T59 PolarHBondContact O-N 3.4Å; G55-T59 PolarHBondContact O-OG1 2.87Å; G56-T59 WeakPolarHBondContact O-CB 3.49Å; G56-T59 PolarHBondContact O-N 3.5Å; G56-T59 VanDerWaalsContact O-N 3.17Å; Y57-T59 VanDerWaalsContact C-N 3.32Å; Y57-T59 PolarHBondContact O-N 3.5Å; T59-K61 VanDerWaalsContact C-N 3.31Å; T59-K61 PolarHBondContact O-N 2.98Å; T59-K62 PolarHBondContact O-N 3Å; T59-L63 HydrophobicContact CG2-CD1 4.39Å; T59-L63 WeakPolarHBondContact O-CG 3.36Å; T59-L63 PolarHBondContact O-N 3.37Å
60	L	84.3	Confident	84.5	Confident	116 Å²	116	100.1 Å²	100.1	61%	0.607	51%	0.512	S	S	*	.	H	α-helix	trans	-60.8	-40	175.9	-70.6	174.9	0	0	0	111.9	G56 Y57 L63 K64	G56-L60 WeakPolarHBondContact O-CG 2.99Å; G56-L60 PolarHBondContact O-N 3.13Å; Y57-L60 PolarHBondContact O-N 3.38Å; L60-L63 PolarHBondContact O-N 2.94Å; L60-K64 WeakPolarHBondContact O-CB 3.41Å; L60-K64 PolarHBondContact O-N 3.3Å
61	K	87.1	Confident	84.6	Confident	121 Å²	121	99 Å²	99	53%	0.526	51%	0.511	S	S	.	.	H	α-helix	trans	-61.7	-46.6	175.2	-174.3	173.9	-179.8	176.1	0	111.9	Y57 T58 T59 L63 K64 D65	Y57-K61 WeakPolarHBondContact O-CB 3.39Å; Y57-K61 PolarHBondContact O-N 3.41Å; T58-K61 PolarHBondContact O-N 3.09Å; T59-K61 VanDerWaalsContact C-N 3.31Å; T59-K61 PolarHBondContact O-N 2.98Å; K61-L63 VanDerWaalsContact C-N 3.34Å; K61-L63 PolarHBondContact O-N 2.83Å; K61-K64 WeakPolarHBondContact O-CB 3.39Å; K61-K64 PolarHBondContact O-N 3.42Å; K61-D65 PolarHBondContact O-N 3.47Å
62	K	89.6	Confident	85.1	Confident	143 Å²	143	100.5 Å²	100.5	62%	0.622	51%	0.51	S	S	*	.	H	α-helix	trans	-60.5	-42.6	175.9	-71.7	175.7	-179.6	-179.4	0	112.3	T58 T59 K64 D65 I66	T58-K62 WeakPolarHBondContact O-CG 3.3Å; T58-K62 PolarHBondContact O-N 3.26Å; T58-K62 VanDerWaalsContact O-N 3.11Å; T59-K62 PolarHBondContact O-N 3Å; K62-K64 VanDerWaalsContact C-N 3.31Å; K62-K64 PolarHBondContact O-N 3Å; K62-D65 PolarHBondContact O-N 3.44Å; K62-I66 WeakPolarHBondContact O-CG1 3.17Å; K62-I66 PolarHBondContact O-N 2.94Å
63	L	88.2	Confident	84.9	Confident	93 Å²	93	97.3 Å²	97.3	49%	0.487	51%	0.506	S	S	.	.	H	α-helix	trans	-62.8	-40.7	176.7	-73.7	173.1	0	0	0	111.3	T59 L60 K61 I66 V67	T59-L63 HydrophobicContact CG2-CD1 4.39Å; T59-L63 WeakPolarHBondContact O-CG 3.36Å; T59-L63 PolarHBondContact O-N 3.37Å; L60-L63 PolarHBondContact O-N 2.94Å; K61-L63 VanDerWaalsContact C-N 3.34Å; K61-L63 PolarHBondContact O-N 2.83Å; L63-I66 PolarHBondContact O-N 2.88Å; L63-V67 WeakPolarHBondContact O-CG2 3.48Å; L63-V67 PolarHBondContact O-N 3.35Å
64	K	91.4	Very high	85	Confident	123 Å²	123	96.9 Å²	96.9	54%	0.535	50%	0.502	S	S	.	.	H	α-helix	trans	-60.8	-46	174.1	176.6	162.4	174.1	42.2	0	112	L60 K61 K62 I66 V67 D68	L60-K64 WeakPolarHBondContact O-CB 3.41Å; L60-K64 PolarHBondContact O-N 3.3Å; K61-K64 WeakPolarHBondContact O-CB 3.39Å; K61-K64 PolarHBondContact O-N 3.42Å; K62-K64 VanDerWaalsContact C-N 3.31Å; K62-K64 PolarHBondContact O-N 3Å; K64-I66 VanDerWaalsContact C-N 3.28Å; K64-I66 PolarHBondContact O-N 2.95Å; K64-V67 PolarHBondContact O-N 2.97Å; K64-D68 WeakPolarHBondContact CG-OD2 3.18Å; K64-D68 IonicContact NZ-OD1 2.87Å; K64-D68 PolarHBondContact NZ-OD1 2.99Å; K64-D68 IonicContact NZ-OD2 3.21Å; K64-D68 PolarHBondContact NZ-OD2 3.25Å; K64-D68 WeakPolarHBondContact O-CB 3.4Å; K64-D68 VanDerWaalsContact O-CG 3.28Å; K64-D68 PolarHBondContact O-N 3.02Å
65	D	91.2	Very high	84.9	Confident	78 Å²	78	96.4 Å²	96.4	42%	0.417	50%	0.502	S	S	.	.	H	α-helix	trans	-60.3	-39	177.1	-63.6	-23.9	0	0	0	111.4	K61 K62 N69	K61-D65 PolarHBondContact O-N 3.47Å; K62-D65 PolarHBondContact O-N 3.44Å; D65-N69 WeakPolarHBondContact O-CB 3.17Å; D65-N69 VanDerWaalsContact O-CG 3.27Å; D65-N69 PolarHBondContact O-N 3.41Å; D65-N69 VanDerWaalsContact O-N 3.07Å; D65-N69 PolarHBondContact O-ND2 3Å
66	I	89.6	Confident	84.8	Confident	92 Å²	92	98.7 Å²	98.7	47%	0.472	51%	0.505	S	S	.	.	H	α-helix	trans	-63.8	-46.6	175.6	-68.5	165.6	0	0	0	111.2	K62 L63 K64 N69 L70	K62-I66 WeakPolarHBondContact O-CG1 3.17Å; K62-I66 PolarHBondContact O-N 2.94Å; L63-I66 PolarHBondContact O-N 2.88Å; K64-I66 VanDerWaalsContact C-N 3.28Å; K64-I66 PolarHBondContact O-N 2.95Å; I66-N69 PolarHBondContact O-N 3.44Å; I66-L70 HydrophobicContact CG2-CD1 4Å; I66-L70 HydrophobicContact CG2-CG 4.4Å; I66-L70 WeakPolarHBondContact O-CG 3.37Å; I66-L70 PolarHBondContact O-N 3.23Å
67	V	89.8	Confident	84.5	Confident	73 Å²	73	99.5 Å²	99.5	44%	0.442	51%	0.508	S	S	.	.	H	α-helix	trans	-62.7	-44.2	179.6	170.7	0	0	0	0	111	L63 K64 N69 L70 N71	L63-V67 WeakPolarHBondContact O-CG2 3.48Å; L63-V67 PolarHBondContact O-N 3.35Å; K64-V67 PolarHBondContact O-N 2.97Å; V67-N69 VanDerWaalsContact C-N 3.3Å; V67-N69 PolarHBondContact O-N 2.97Å; V67-L70 PolarHBondContact O-N 2.84Å; V67-N71 VanDerWaalsContact O-CG 3.32Å; V67-N71 PolarHBondContact O-N 3.44Å; V67-N71 PolarHBondContact O-ND2 3.15Å
68	D	91.9	Very high	84.3	Confident	71 Å²	71	95.6 Å²	95.6	38%	0.38	50%	0.501	S	S	.	.	H	α-helix	trans	-62.6	-39.6	179.1	-67.5	-18.5	0	0	0	110.6	K64 Q72	K64-D68 WeakPolarHBondContact CG-OD2 3.18Å; K64-D68 IonicContact NZ-OD1 2.87Å; K64-D68 PolarHBondContact NZ-OD1 2.99Å; K64-D68 IonicContact NZ-OD2 3.21Å; K64-D68 PolarHBondContact NZ-OD2 3.25Å; K64-D68 WeakPolarHBondContact O-CB 3.4Å; K64-D68 VanDerWaalsContact O-CG 3.28Å; K64-D68 PolarHBondContact O-N 3.02Å; D68-Q72 PolarHBondContact O-N 3.42Å; D68-Q72 VanDerWaalsContact O-N 3.11Å
69	N	89.7	Confident	83.9	Confident	92 Å²	92	98.1 Å²	98.1	49%	0.492	50%	0.504	S	S	.	.	H	α-helix	trans	-66.9	-38.3	174	-73.7	-48.8	0	0	0	113.2	D65 I66 V67 Q72 C73	D65-N69 WeakPolarHBondContact O-CB 3.17Å; D65-N69 VanDerWaalsContact O-CG 3.27Å; D65-N69 PolarHBondContact O-N 3.41Å; D65-N69 VanDerWaalsContact O-N 3.07Å; D65-N69 PolarHBondContact O-ND2 3Å; I66-N69 PolarHBondContact O-N 3.44Å; V67-N69 VanDerWaalsContact C-N 3.3Å; V67-N69 PolarHBondContact O-N 2.97Å; N69-Q72 PolarHBondContact O-N 2.93Å; N69-C73 PolarHBondContact O-N 3.42Å; N69-C73 PolarHBondContact O-SG 3.43Å
70	L	86.9	Confident	83.2	Confident	100 Å²	100	97.8 Å²	97.8	52%	0.524	50%	0.496	S	S	.	.	H	α-helix	trans	-66.4	-44.8	177.7	-75	172.8	0	0	0	111.1	I66 V67 Q72 C73 E74	I66-L70 HydrophobicContact CG2-CD1 4Å; I66-L70 HydrophobicContact CG2-CG 4.4Å; I66-L70 WeakPolarHBondContact O-CG 3.37Å; I66-L70 PolarHBondContact O-N 3.23Å; V67-L70 PolarHBondContact O-N 2.84Å; L70-Q72 VanDerWaalsContact C-N 3.28Å; L70-Q72 PolarHBondContact O-N 3.42Å; L70-C73 WeakPolarHBondContact O-CB 3.34Å; L70-C73 PolarHBondContact O-N 2.65Å; L70-C73 VanDerWaalsContact O-N 3.07Å; L70-E74 PolarHBondContact O-N 3.3Å
71	N	83.2	Confident	82.4	Confident	76 Å²	76	96.3 Å²	96.3	41%	0.406	49%	0.492	S	S	.	.	H	α-helix	trans	-59	-42.1	175.5	-69.3	-21.6	0	0	0	111.1	V67 C73 E74 E75	V67-N71 VanDerWaalsContact O-CG 3.32Å; V67-N71 PolarHBondContact O-N 3.44Å; V67-N71 PolarHBondContact O-ND2 3.15Å; N71-C73 VanDerWaalsContact C-N 3.33Å; N71-C73 PolarHBondContact O-N 3.16Å; N71-E74 PolarHBondContact O-N 3.39Å; N71-E75 WeakPolarHBondContact O-CG 3.46Å; N71-E75 PolarHBondContact O-N 3.3Å
72	Q	87	Confident	81.6	Confident	111 Å²	111	97.7 Å²	97.7	52%	0.519	50%	0.5	S	S	.	.	H	α-helix	trans	-62.6	-38.9	175.2	-170.2	177.2	31.5	0	0	112.3	D68 N69 L70 E74 L76	D68-Q72 PolarHBondContact O-N 3.42Å; D68-Q72 VanDerWaalsContact O-N 3.11Å; N69-Q72 PolarHBondContact O-N 2.93Å; L70-Q72 VanDerWaalsContact C-N 3.28Å; L70-Q72 PolarHBondContact O-N 3.42Å; Q72-E74 VanDerWaalsContact C-N 3.34Å; Q72-L76 HydrophobicContact CG-CD1 4.46Å; Q72-L76 VanDerWaalsContact O-CG 3.3Å; Q72-L76 WeakPolarHBondContact O-CG 3.38Å; Q72-L76 PolarHBondContact O-N 3.41Å; Q72-L76 VanDerWaalsContact O-N 3.07Å
73	C	75.7	Confident	80.4	Confident	79 Å²	79	98 Å²	98	53%	0.534	50%	0.498	S	S	.	.	H	α-helix	trans	-63	-41	174.4	-67.6	0	0	0	0	112	N69 L70 N71 L76 A77	N69-C73 PolarHBondContact O-N 3.42Å; N69-C73 PolarHBondContact O-SG 3.43Å; L70-C73 WeakPolarHBondContact O-CB 3.34Å; L70-C73 PolarHBondContact O-N 2.65Å; L70-C73 VanDerWaalsContact O-N 3.07Å; N71-C73 VanDerWaalsContact C-N 3.33Å; N71-C73 PolarHBondContact O-N 3.16Å; C73-L76 PolarHBondContact O-N 2.99Å; C73-A77 WeakPolarHBondContact O-CB 3.3Å; C73-A77 PolarHBondContact O-N 3.21Å
74	E	78.5	Confident	79	Confident	126 Å²	126	100 Å²	100	59%	0.589	51%	0.509	S	S	*	.	H	α-helix	trans	-66	-44.2	177.7	-70.8	-177.5	174.2	0	0	111.9	L70 N71 Q72 L76 A77 V78	L70-E74 PolarHBondContact O-N 3.3Å; N71-E74 PolarHBondContact O-N 3.39Å; Q72-E74 VanDerWaalsContact C-N 3.34Å; E74-L76 VanDerWaalsContact C-N 3.32Å; E74-L76 PolarHBondContact O-N 2.93Å; E74-A77 WeakPolarHBondContact O-CB 3.3Å; E74-A77 PolarHBondContact O-N 3.01Å; E74-A77 VanDerWaalsContact O-N 3.15Å; E74-V78 WeakPolarHBondContact O-CG2 3.41Å; E74-V78 PolarHBondContact O-N 3.17Å
75	E	77	Confident	77.1	Confident	143 Å²	143	98.3 Å²	98.3	67%	0.668	50%	0.504	S	S	*	.	H	α-helix	trans	-58.6	-43.6	175	-74.3	-179.3	176.6	0	0	111.9	N71 V78 Y79	N71-E75 WeakPolarHBondContact O-CG 3.46Å; N71-E75 PolarHBondContact O-N 3.3Å; E75-V78 PolarHBondContact O-N 2.91Å; E75-Y79 PolarHBondContact O-N 3.25Å
76	L	75.7	Confident	75.4	Confident	86 Å²	86	100.9 Å²	100.9	45%	0.45	52%	0.523	S	S	.	.	H	α-helix	trans	-65.1	-39.9	175.5	-70.6	174	0	0	0	111.8	Q72 C73 E74 V78 Y79 F80	Q72-L76 HydrophobicContact CG-CD1 4.46Å; Q72-L76 VanDerWaalsContact O-CG 3.3Å; Q72-L76 WeakPolarHBondContact O-CG 3.38Å; Q72-L76 PolarHBondContact O-N 3.41Å; Q72-L76 VanDerWaalsContact O-N 3.07Å; C73-L76 PolarHBondContact O-N 2.99Å; E74-L76 VanDerWaalsContact C-N 3.32Å; E74-L76 PolarHBondContact O-N 2.93Å; L76-V78 VanDerWaalsContact C-N 3.35Å; L76-V78 PolarHBondContact O-N 3.13Å; L76-Y79 WeakPolarHBondContact O-CB 3.49Å; L76-Y79 PolarHBondContact O-N 3.1Å; L76-F80 HydrophobicContact CB-CE2 4.29Å; L76-F80 WeakPolarHBondContact O-CD2 3.31Å; L76-F80 PolarHBondContact O-N 2.8Å
77	A	73.1	Confident	73.7	Confident	54 Å²	54	101.6 Å²	101.6	45%	0.446	54%	0.536	S	S	.	.	H	α-helix	trans	-63.2	-41	176.4	0	0	0	0	0	111.9	C73 E74 F80 T81	C73-A77 WeakPolarHBondContact O-CB 3.3Å; C73-A77 PolarHBondContact O-N 3.21Å; E74-A77 WeakPolarHBondContact O-CB 3.3Å; E74-A77 PolarHBondContact O-N 3.01Å; E74-A77 VanDerWaalsContact O-N 3.15Å; A77-F80 PolarHBondContact O-N 2.56Å; A77-T81 WeakPolarHBondContact O-CG2 3.42Å; A77-T81 PolarHBondContact O-N 3.08Å; A77-T81 PolarHBondContact O-OG1 3.43Å
78	V	75	Confident	71.8	Confident	82 Å²	82	99.2 Å²	99.2	50%	0.497	52%	0.524	S	S	.	.	H	α-helix	trans	-61.9	-47.4	172.9	174.1	0	0	0	0	110	E74 E75 L76 F80 T81 H82	E74-V78 WeakPolarHBondContact O-CG2 3.41Å; E74-V78 PolarHBondContact O-N 3.17Å; E75-V78 PolarHBondContact O-N 2.91Å; L76-V78 VanDerWaalsContact C-N 3.35Å; L76-V78 PolarHBondContact O-N 3.13Å; V78-F80 VanDerWaalsContact C-N 3.33Å; V78-F80 PolarHBondContact O-N 3.27Å; V78-T81 PolarHBondContact O-N 3.17Å; V78-T81 PolarHBondContact O-OG1 3.33Å; V78-H82 PolarHBondContact O-N 3.4Å; V78-H82 PolarHBondContact O-ND1 3.28Å
79	Y	74	Confident	70	Confident	125 Å²	125	100.6 Å²	100.6	49%	0.49	54%	0.537	S	S	.	.	H	α-helix	trans	-55.4	-46.7	176.9	-176.3	-94.5	0	0	0	112.2	E75 L76 T81 H82 Y83	E75-Y79 PolarHBondContact O-N 3.25Å; L76-Y79 WeakPolarHBondContact O-CB 3.49Å; L76-Y79 PolarHBondContact O-N 3.1Å; Y79-T81 PolarHBondContact O-N 3.47Å; Y79-H82 PolarHBondContact O-N 3.12Å; Y79-Y83 HydrophobicContact CD1-CD2 4.23Å; Y79-Y83 HydrophobicContact CD2-CD2 4.28Å; Y79-Y83 HydrophobicContact CD2-CE2 4.06Å; Y79-Y83 AromaticContact CE1-CD2 3.87Å; Y79-Y83 HydrophobicContact CE1-CD2 3.87Å; Y79-Y83 HydrophobicContact CE1-CE2 4.03Å; Y79-Y83 AromaticContact CE2-CD2 3.93Å; Y79-Y83 HydrophobicContact CE2-CD2 3.93Å; Y79-Y83 AromaticContact CE2-CE2 3.39Å; Y79-Y83 HydrophobicContact CE2-CE2 3.39Å; Y79-Y83 HydrophobicContact CG-CD2 4.42Å; Y79-Y83 AromaticContact CZ-CD2 3.7Å; Y79-Y83 AromaticContact CZ-CE2 3.36Å; Y79-Y83 AromaticContact CZ-CZ 3.98Å; Y79-Y83 WeakPolarHBondContact O-CD2 3.24Å; Y79-Y83 PolarHBondContact O-N 2.7Å; Y79-Y83 WeakPolarHBondContact OH-CE2 3.45Å
80	F	68.6	Low	68.1	Low	69 Å²	69	102.7 Å²	102.7	30%	0.303	54%	0.538	S	S	.	.	H	α-helix	trans	-70.8	-29.2	-179.2	-71.8	-60	0	0	0	114.6	L76 A77 V78 H82 Y83 M85 W90	L76-F80 HydrophobicContact CB-CE2 4.29Å; L76-F80 WeakPolarHBondContact O-CD2 3.31Å; L76-F80 PolarHBondContact O-N 2.8Å; A77-F80 PolarHBondContact O-N 2.56Å; V78-F80 VanDerWaalsContact C-N 3.33Å; V78-F80 PolarHBondContact O-N 3.27Å; F80-H82 VanDerWaalsContact C-N 3.31Å; F80-Y83 CarbonylContact O-C 3.49Å; F80-Y83 PolarHBondContact O-N 3.37Å; F80-M85 WeakPolarHBondContact O-CG 3.36Å; F80-W90 HydrophobicContact CD1-CZ2 4.06Å; F80-W90 HydrophobicContact CE1-CH2 4.2Å; F80-W90 AromaticContact CE1-CZ2 3.5Å; F80-W90 HydrophobicContact CE1-CZ2 3.5Å; F80-W90 VanDerWaalsContact CE1-CZ2 3.5Å; F80-W90 HydrophobicContact CE2-CZ2 4.21Å; F80-W90 AromaticContact CZ-CH2 3.95Å; F80-W90 HydrophobicContact CZ-CH2 3.95Å; F80-W90 AromaticContact CZ-CZ2 3.59Å; F80-W90 HydrophobicContact CZ-CZ2 3.59Å
81	T	67.1	Low	66.2	Low	86 Å²	86	105.6 Å²	105.6	53%	0.528	55%	0.547	S	S	.	.	H	α-helix	trans	-71.3	-27.6	176.4	50.9	0	0	0	0	112.8	A77 V78 Y79 M85	A77-T81 WeakPolarHBondContact O-CG2 3.42Å; A77-T81 PolarHBondContact O-N 3.08Å; A77-T81 PolarHBondContact O-OG1 3.43Å; V78-T81 PolarHBondContact O-N 3.17Å; V78-T81 PolarHBondContact O-OG1 3.33Å; Y79-T81 PolarHBondContact O-N 3.47Å; T81-M85 HydrophobicContact CG2-CE 4.13Å
82	H	71.2	Confident	64.4	Low	150 Å²	150	106.7 Å²	106.7	69%	0.694	56%	0.559	S	S	*	*	H	α-helix	trans	-79.1	-30.8	174.8	-69.2	76.4	0	0	0	112.5	V78 Y79 F80 D84	V78-H82 PolarHBondContact O-N 3.4Å; V78-H82 PolarHBondContact O-ND1 3.28Å; Y79-H82 PolarHBondContact O-N 3.12Å; F80-H82 VanDerWaalsContact C-N 3.31Å; H82-D84 PolarHBondContact O-N 3.19Å
83	Y	63.1	Low	62.3	Low	148 Å²	148	104.3 Å²	104.3	58%	0.58	55%	0.554	S	S	*	*	S	Bend	trans	-89.5	91.2	174.3	-82.1	-91.9	0	0	0	110.4	Y79 F80 M85	Y79-Y83 HydrophobicContact CD1-CD2 4.23Å; Y79-Y83 HydrophobicContact CD2-CD2 4.28Å; Y79-Y83 HydrophobicContact CD2-CE2 4.06Å; Y79-Y83 AromaticContact CE1-CD2 3.87Å; Y79-Y83 HydrophobicContact CE1-CD2 3.87Å; Y79-Y83 HydrophobicContact CE1-CE2 4.03Å; Y79-Y83 AromaticContact CE2-CD2 3.93Å; Y79-Y83 HydrophobicContact CE2-CD2 3.93Å; Y79-Y83 AromaticContact CE2-CE2 3.39Å; Y79-Y83 HydrophobicContact CE2-CE2 3.39Å; Y79-Y83 HydrophobicContact CG-CD2 4.42Å; Y79-Y83 AromaticContact CZ-CD2 3.7Å; Y79-Y83 AromaticContact CZ-CE2 3.36Å; Y79-Y83 AromaticContact CZ-CZ 3.98Å; Y79-Y83 WeakPolarHBondContact O-CD2 3.24Å; Y79-Y83 PolarHBondContact O-N 2.7Å; Y79-Y83 WeakPolarHBondContact OH-CE2 3.45Å; F80-Y83 CarbonylContact O-C 3.49Å; F80-Y83 PolarHBondContact O-N 3.37Å; Y83-M85 PolarHBondContact O-N 3.43Å
84	D	58.4	Low	60.8	Low	137 Å²	137	104.2 Å²	104.2	73%	0.733	55%	0.554	S	S	*	*			trans	-8.9	94	170.3	-122.2	-24.1	0	0	0	115.1	H82 T86	H82-D84 PolarHBondContact O-N 3.19Å; D84-T86 PolarHBondContact O-N 2.8Å
85	M	52.1	Low	59.5	Low	86 Å²	86	104.6 Å²	104.6	42%	0.424	56%	0.559	S	S	.	*	T	Hydrogen-bonded Turn	trans	-73.3	26.7	-169.3	-66.9	-171.4	-77.4	0	0	115.2	F80 T81 Y83 S87	F80-M85 WeakPolarHBondContact O-CG 3.36Å; T81-M85 HydrophobicContact CG2-CE 4.13Å; Y83-M85 PolarHBondContact O-N 3.43Å; M85-S87 VanDerWaalsContact C-N 3.28Å; M85-S87 PolarHBondContact O-N 3.1Å
86	T	55.2	Low	58.1	Low	132 Å²	132	104.2 Å²	104.2	81%	0.81	56%	0.557	S	S	*	*	T	Hydrogen-bonded Turn	trans	-76.9	-13.2	-179.9	52	0	0	0	0	113.4	D84	D84-T86 PolarHBondContact O-N 2.8Å
87	S	55.1	Low	56.6	Low	107 Å²	107	106.5 Å²	106.5	75%	0.748	57%	0.565	S	S	*	*	S	Bend	trans	-117	0.1	179.4	67	0	0	0	0	115.3	M85	M85-S87 VanDerWaalsContact C-N 3.28Å; M85-S87 PolarHBondContact O-N 3.1Å
88	A	49.4	Very low	55.4	Low	24 Å²	24	112 Å²	112	20%	0.198	58%	0.579	C	S	.	*			trans	-81.4	123.2	-167.4	0	0	0	0	0	113.1	W90	A88-W90 VanDerWaalsContact C-N 3.3Å; A88-W90 HydrophobicContact CB-CZ2 4.46Å; A88-W90 VanDerWaalsContact CB-NE1 3.31Å; A88-W90 PolarHBondContact O-N 2.99Å; A88-W90 VanDerWaalsContact O-N 3.15Å
89	P	54	Low	54.1	Low	99 Å²	99	109.4 Å²	109.4	64%	0.643	57%	0.569	S	S	*	*	T	Hydrogen-bonded Turn	trans	-64.7	-19.1	-169.9	-23.3	33	0	0	0	116.6	K91 C92	P89-K91 PolarHBondContact O-N 3.05Å; P89-C92 PolarHBondContact O-N 3.01Å; P89-C92 VanDerWaalsContact O-N 3.11Å
90	W	49.4	Very low	52.6	Low	137 Å²	137	109.8 Å²	109.8	52%	0.519	58%	0.577	S	S	.	*	H	α-helix	trans	-70	-12.5	-172.2	9.2	86.8	0	0	0	115	F80 A88 C92 C93 S94	F80-W90 HydrophobicContact CD1-CZ2 4.06Å; F80-W90 HydrophobicContact CE1-CH2 4.2Å; F80-W90 AromaticContact CE1-CZ2 3.5Å; F80-W90 HydrophobicContact CE1-CZ2 3.5Å; F80-W90 VanDerWaalsContact CE1-CZ2 3.5Å; F80-W90 HydrophobicContact CE2-CZ2 4.21Å; F80-W90 AromaticContact CZ-CH2 3.95Å; F80-W90 HydrophobicContact CZ-CH2 3.95Å; F80-W90 AromaticContact CZ-CZ2 3.59Å; F80-W90 HydrophobicContact CZ-CZ2 3.59Å; A88-W90 VanDerWaalsContact C-N 3.3Å; A88-W90 HydrophobicContact CB-CZ2 4.46Å; A88-W90 VanDerWaalsContact CB-NE1 3.31Å; A88-W90 PolarHBondContact O-N 2.99Å; A88-W90 VanDerWaalsContact O-N 3.15Å; W90-C92 PolarHBondContact O-N 3.5Å; W90-C93 PolarHBondContact O-N 3.43Å; W90-S94 PolarHBondContact O-N 3.4Å
91	K	47.5	Very low	51	Low	161 Å²	161	114.3 Å²	114.3	70%	0.7	60%	0.597	S	S	*	*	H	α-helix	trans	-57.3	-28	168.4	-85.9	-174.3	178	175.5	0	112	P89	P89-K91 PolarHBondContact O-N 3.05Å
92	C	44.6	Very low	50.2	Low	99 Å²	99	117.8 Å²	117.8	67%	0.669	61%	0.605	S	S	*	*	H	α-helix	trans	-71.3	-38.1	171.9	-116.3	0	0	0	0	112.3	P89 W90 S94 I95	P89-C92 PolarHBondContact O-N 3.01Å; P89-C92 VanDerWaalsContact O-N 3.11Å; W90-C92 PolarHBondContact O-N 3.5Å; C92-S94 PolarHBondContact O-N 2.99Å; C92-I95 PolarHBondContact O-N 3.39Å
93	C	44	Very low	48.9	Very low	60 Å²	60	119.3 Å²	119.3	41%	0.405	60%	0.604	S	S	.	*	H	α-helix	trans	-71.5	-31.3	-174.8	-156.1	0	0	0	0	112.8	W90 I95 E96 Q97	W90-C93 PolarHBondContact O-N 3.43Å; C93-I95 VanDerWaalsContact C-N 3.29Å; C93-I95 PolarHBondContact O-N 3.35Å; C93-E96 PolarHBondContact O-N 2.87Å; C93-Q97 WeakPolarHBondContact O-CB 3.24Å; C93-Q97 WeakPolarHBondContact O-CG 3.4Å; C93-Q97 PolarHBondContact O-N 3.27Å
94	S	44.1	Very low	48.1	Very low	77 Å²	77	116.6 Å²	116.6	54%	0.538	61%	0.607	S	S	.	*	H	α-helix	trans	-66.4	-26.8	176.6	-62	0	0	0	0	114	W90 C92 K98	W90-S94 PolarHBondContact O-N 3.4Å; C92-S94 PolarHBondContact O-N 2.99Å; S94-K98 PolarHBondContact O-N 2.91Å
95	I	50.4	Low	47.5	Very low	134 Å²	134	114.8 Å²	114.8	69%	0.687	60%	0.601	S	S	*	*	H	α-helix	trans	-73.4	-39.9	174.5	-61.3	177.3	0	0	0	109.7	C92 C93 G99	C92-I95 PolarHBondContact O-N 3.39Å; C93-I95 VanDerWaalsContact C-N 3.29Å; C93-I95 PolarHBondContact O-N 3.35Å; I95-G99 PolarHBondContact O-N 2.98Å; I95-G99 VanDerWaalsContact O-N 3.14Å
96	E	47.9	Very low	47.3	Very low	135 Å²	135	117.7 Å²	117.7	63%	0.631	62%	0.618	S	S	*	*	H	α-helix	trans	-72.3	-38.6	176.9	-80.1	-174.9	143.5	0	0	113.3	C93 G99 M100	C93-E96 PolarHBondContact O-N 2.87Å; E96-G99 CarbonylContact O-C 3.56Å; E96-G99 WeakPolarHBondContact O-CA 3.47Å; E96-G99 PolarHBondContact O-N 2.9Å; E96-G99 VanDerWaalsContact O-N 3.12Å; E96-M100 PolarHBondContact O-N 2.99Å
97	Q	44	Very low	46.7	Very low	134 Å²	134	125.3 Å²	125.3	63%	0.626	63%	0.632	S	S	*	*	H	α-helix	trans	-66.1	-40.7	178.1	-73.8	-116.9	-12	0	0	111.8	C93 G99 M100 F101	C93-Q97 WeakPolarHBondContact O-CB 3.24Å; C93-Q97 WeakPolarHBondContact O-CG 3.4Å; C93-Q97 PolarHBondContact O-N 3.27Å; Q97-G99 VanDerWaalsContact C-N 3.28Å; Q97-G99 PolarHBondContact O-N 3.21Å; Q97-M100 PolarHBondContact O-N 2.87Å; Q97-F101 WeakPolarHBondContact O-CB 3.37Å; Q97-F101 PolarHBondContact O-N 3.43Å
98	K	48.8	Very low	46.3	Very low	170 Å²	170	126.2 Å²	126.2	74%	0.739	63%	0.626	S	S	*	*	H	α-helix	trans	-64.9	-33.1	171.4	-77	-172.8	176.6	-178	0	112.2	S94 K102	S94-K98 PolarHBondContact O-N 2.91Å; K98-K102 PolarHBondContact O-N 3.34Å
99	G	47.4	Very low	46.1	Very low	28 Å²	28	131.6 Å²	131.6	29%	0.289	65%	0.649	S	S	.	*	H	α-helix	trans	-71.2	-34.3	173.5	0	0	0	0	0	114	I95 E96 Q97 R103	I95-G99 PolarHBondContact O-N 2.98Å; I95-G99 VanDerWaalsContact O-N 3.14Å; E96-G99 CarbonylContact O-C 3.56Å; E96-G99 WeakPolarHBondContact O-CA 3.47Å; E96-G99 PolarHBondContact O-N 2.9Å; E96-G99 VanDerWaalsContact O-N 3.12Å; Q97-G99 VanDerWaalsContact C-N 3.28Å; Q97-G99 PolarHBondContact O-N 3.21Å; G99-R103 PolarHBondContact O-N 3.5Å; G99-R103 PolarHBondContact O-NE 3.31Å
100	M	42.2	Very low	45.6	Very low	133 Å²	133	133.4 Å²	133.4	66%	0.655	65%	0.649	S	S	*	*	H	α-helix	trans	-75.5	-40.3	176	-86.5	-172.5	163.1	0	0	112.2	E96 Q97 K102 R103 S104	E96-M100 PolarHBondContact O-N 2.99Å; Q97-M100 PolarHBondContact O-N 2.87Å; M100-K102 PolarHBondContact O-N 3.43Å; M100-R103 PolarHBondContact O-N 3.33Å; M100-R103 VanDerWaalsContact O-N 3.07Å; M100-S104 PolarHBondContact O-N 3.02Å; M100-S104 VanDerWaalsContact O-N 3.12Å
101	F	35.6	Very low	45.4	Very low	164 Å²	164	133.2 Å²	133.2	72%	0.719	66%	0.657	S	S	*	*	H	α-helix	trans	-63.2	-35	178	-155.9	-98.8	0	0	0	111.6	Q97 S104	Q97-F101 WeakPolarHBondContact O-CB 3.37Å; Q97-F101 PolarHBondContact O-N 3.43Å; F101-S104 PolarHBondContact O-N 2.74Å
102	K	48.8	Very low	45.3	Very low	158 Å²	158	131.4 Å²	131.4	69%	0.687	65%	0.654	S	S	*	*	H	α-helix	trans	-69.5	-31.7	173.3	-123.5	167.8	-176.7	177.2	0	113.7	K98 M100 S104 T105	K98-K102 PolarHBondContact O-N 3.34Å; M100-K102 PolarHBondContact O-N 3.43Å; K102-S104 VanDerWaalsContact C-N 3.34Å; K102-T105 PolarHBondContact O-OG1 3.2Å
103	R	45	Very low	45.3	Very low	183 Å²	183	133.6 Å²	133.6	69%	0.691	65%	0.653	S	S	*	*	H	α-helix	trans	-77	-18.8	176.7	-80.5	-173.8	-76.7	-138.5	0.8	114	G99 M100	G99-R103 PolarHBondContact O-N 3.5Å; G99-R103 PolarHBondContact O-NE 3.31Å; M100-R103 PolarHBondContact O-N 3.33Å; M100-R103 VanDerWaalsContact O-N 3.07Å
104	S	45.2	Very low	45.4	Very low	91 Å²	91	138.9 Å²	138.9	64%	0.636	67%	0.671	S	S	*	*	H	α-helix	trans	-79.1	-20.6	177.8	-173.3	0	0	0	0	113.4	M100 F101 K102	M100-S104 PolarHBondContact O-N 3.02Å; M100-S104 VanDerWaalsContact O-N 3.12Å; F101-S104 PolarHBondContact O-N 2.74Å; K102-S104 VanDerWaalsContact C-N 3.34Å
105	T	47.2	Very low	45.5	Very low	98 Å²	98	143.6 Å²	143.6	60%	0.601	68%	0.681	S	S	*	*	S	Bend	trans	-94.9	-4.2	-178.3	46.5	0	0	0	0	114.3	K102	K102-T105 PolarHBondContact O-OG1 3.2Å
106	D	46.8	Very low	45.1	Very low	147 Å²	147	144.4 Å²	144.4	79%	0.786	68%	0.68	S	S	*	*			trans	-104.1	23.8	178.5	-80.5	-17.8	0	0	0	113.3
107	R	42.7	Very low	44.9	Very low	292 Å²	292	145.3 Å²	145.3	100%	1.102	69%	0.685	S	S	*	*			trans	-126.5	0	170.9	-161	-167.9	-69.4	-176.4	-1.6	110.5

Retrieved 107 of 107 residues in 21.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).