A0A077ZNJ3_TRITR Loading...

Protein tweety homolog

Probable chloride channel.

AlphaFold DB , UniProt , Accession A0A077ZNJ3, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 137 aa.

						>A0A077ZNJ3_TRITR|A0A077ZNJ3
MWLADLFHQFPRLNFAFEAVGSTCDFTSKDYIESLIIWGTLPIIVCVLLFLVIVGLWSVKCCSKSSSNKPKSDAKAIASGLIICLVVSCVFIGVAIYCNEHSNKAIAMTVDGVDDLGHELARFGEKVPMDYFKYSLG
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	54.9	Low	58.6	Low	201 Å²	201	120.1 Å²	120.1	99%	0.99	59%	0.585	S	S	*	*				0	-59.7	0	-50.1	-61.5	-132	0	0	111.1	L3 A4 D5	M1-L3 VanDerWaalsContact C-N 3.3Å; M1-L3 PolarHBondContact O-N 3.08Å; M1-L3 VanDerWaalsContact O-N 3.11Å; M1-A4 WeakPolarHBondContact O-CB 3.49Å; M1-A4 PolarHBondContact O-N 3.49Å; M1-D5 PolarHBondContact O-N 3.43Å
2	W	66.7	Low	58.1	Low	191 Å²	191	117.7 Å²	117.7	72%	0.723	57%	0.565	S	S	*	*	H	α-helix	trans	-53.9	-36.1	-175.6	79.3	-85.8	0	0	0	116.3	D5 L6	W2-D5 PolarHBondContact O-N 2.95Å; W2-L6 HydrophobicContact CZ3-CD2 4.37Å; W2-L6 WeakPolarHBondContact O-CB 3.03Å; W2-L6 PolarHBondContact O-N 3.32Å
3	L	60.3	Low	57.2	Low	87 Å²	87	112.2 Å²	112.2	46%	0.455	54%	0.541	S	S	.	.	H	α-helix	trans	-68.7	-38.3	179.6	-158.8	73.7	0	0	0	111.5	M1 L6 F7	M1-L3 VanDerWaalsContact C-N 3.3Å; M1-L3 PolarHBondContact O-N 3.08Å; M1-L3 VanDerWaalsContact O-N 3.11Å; L3-L6 WeakPolarHBondContact O-CB 3.28Å; L3-L6 PolarHBondContact O-N 3.44Å; L3-F7 HydrophobicContact CD2-CE2 4.24Å; L3-F7 HydrophobicContact CG-CD2 4.1Å; L3-F7 HydrophobicContact CG-CE2 3.98Å; L3-F7 VanDerWaalsContact O-CD2 3.23Å; L3-F7 WeakPolarHBondContact O-CD2 3.45Å; L3-F7 PolarHBondContact O-N 3.44Å
4	A	62.4	Low	56.6	Low	50 Å²	50	105.6 Å²	105.6	41%	0.413	51%	0.51	S	S	.	.	H	α-helix	trans	-66	-42.2	177.7	0	0	0	0	0	110.8	M1 L6 F7 H8	M1-A4 WeakPolarHBondContact O-CB 3.49Å; M1-A4 PolarHBondContact O-N 3.49Å; A4-L6 VanDerWaalsContact C-N 3.31Å; A4-L6 PolarHBondContact O-N 3.38Å; A4-F7 PolarHBondContact O-N 3.39Å; A4-H8 PolarHBondContact O-CD2 2.9Å; A4-H8 PolarHBondContact O-N 3.45Å
5	D	63.6	Low	55.6	Low	96 Å²	96	107.3 Å²	107.3	51%	0.513	51%	0.514	S	S	.	.	H	α-helix	trans	-62.8	-39.1	175.4	-63.9	-42.5	0	0	0	111.8	M1 W2 H8 Q9	M1-D5 PolarHBondContact O-N 3.43Å; W2-D5 PolarHBondContact O-N 2.95Å; D5-H8 PolarHBondContact O-N 3.16Å; D5-Q9 WeakPolarHBondContact O-CB 3.13Å; D5-Q9 PolarHBondContact O-N 3.14Å
6	L	63.1	Low	55.4	Low	72 Å²	72	105.4 Å²	105.4	38%	0.377	52%	0.521	S	S	.	.	H	α-helix	trans	-61.1	-47.5	174.4	-160.2	79.1	0	0	0	110.7	W2 L3 A4 H8 Q9 F10	W2-L6 HydrophobicContact CZ3-CD2 4.37Å; W2-L6 WeakPolarHBondContact O-CB 3.03Å; W2-L6 PolarHBondContact O-N 3.32Å; L3-L6 WeakPolarHBondContact O-CB 3.28Å; L3-L6 PolarHBondContact O-N 3.44Å; A4-L6 VanDerWaalsContact C-N 3.31Å; A4-L6 PolarHBondContact O-N 3.38Å; L6-H8 VanDerWaalsContact C-N 3.34Å; L6-H8 PolarHBondContact O-N 3.42Å; L6-Q9 PolarHBondContact O-N 3.04Å; L6-F10 HydrophobicContact CD2-CE2 3.99Å; L6-F10 HydrophobicContact CG-CD2 4.2Å; L6-F10 HydrophobicContact CG-CE2 3.78Å; L6-F10 WeakPolarHBondContact O-CD2 3.25Å; L6-F10 PolarHBondContact O-N 3.12Å; L6-F10 VanDerWaalsContact O-N 3.08Å
7	F	57.6	Low	54.9	Low	142 Å²	142	109 Å²	109	62%	0.623	53%	0.534	S	S	*	.	H	α-helix	trans	-64	-34.8	176.2	-87.8	-75.3	0	0	0	113.1	L3 A4 F10	L3-F7 HydrophobicContact CD2-CE2 4.24Å; L3-F7 HydrophobicContact CG-CD2 4.1Å; L3-F7 HydrophobicContact CG-CE2 3.98Å; L3-F7 VanDerWaalsContact O-CD2 3.23Å; L3-F7 WeakPolarHBondContact O-CD2 3.45Å; L3-F7 PolarHBondContact O-N 3.44Å; A4-F7 PolarHBondContact O-N 3.39Å; F7-F10 PolarHBondContact O-N 3.11Å
8	H	56.9	Low	54.2	Low	162 Å²	162	110.9 Å²	110.9	75%	0.75	54%	0.541	S	S	*	.	H	α-helix	trans	-72.9	-31.4	174.9	-79.8	-64.6	0	0	0	113	A4 D5 L6 F10	A4-H8 PolarHBondContact O-CD2 2.9Å; A4-H8 PolarHBondContact O-N 3.45Å; D5-H8 PolarHBondContact O-N 3.16Å; L6-H8 VanDerWaalsContact C-N 3.34Å; L6-H8 PolarHBondContact O-N 3.42Å; H8-F10 VanDerWaalsContact C-N 3.33Å
9	Q	57.7	Low	53.8	Low	157 Å²	157	109.1 Å²	109.1	73%	0.734	55%	0.546	S	S	*	.	H	α-helix	trans	-76.6	-18.7	174.6	-91	-175.3	-25.8	0	0	113.4	D5 L6 P11	D5-Q9 WeakPolarHBondContact O-CB 3.13Å; D5-Q9 PolarHBondContact O-N 3.14Å; L6-Q9 PolarHBondContact O-N 3.04Å; Q9-P11 WeakPolarHBondContact O-CD 2.94Å; Q9-P11 VanDerWaalsContact O-N 3.16Å
10	F	48.1	Very low	53.6	Low	94 Å²	94	106.9 Å²	106.9	41%	0.412	54%	0.538	S	S	.	.	S	Bend	trans	-69.6	111.9	-178.4	-97.9	-71.3	0	0	0	110.3	L6 F7 H8 R12 W38	L6-F10 HydrophobicContact CD2-CE2 3.99Å; L6-F10 HydrophobicContact CG-CD2 4.2Å; L6-F10 HydrophobicContact CG-CE2 3.78Å; L6-F10 WeakPolarHBondContact O-CD2 3.25Å; L6-F10 PolarHBondContact O-N 3.12Å; L6-F10 VanDerWaalsContact O-N 3.08Å; F7-F10 PolarHBondContact O-N 3.11Å; H8-F10 VanDerWaalsContact C-N 3.33Å; F10-R12 PolarHBondContact O-N 3.23Å; F10-W38 HydrophobicContact CB-CH2 4.47Å; F10-W38 AromaticContact CD1-CH2 3.41Å; F10-W38 HydrophobicContact CD1-CH2 3.41Å; F10-W38 VanDerWaalsContact CD1-CH2 3.41Å; F10-W38 HydrophobicContact CD1-CZ2 4.02Å; F10-W38 HydrophobicContact CD1-CZ3 4.33Å; F10-W38 AromaticContact CE1-CH2 3.76Å; F10-W38 HydrophobicContact CE1-CH2 3.76Å; F10-W38 HydrophobicContact CE1-CZ3 4.48Å; F10-W38 AromaticContact CG-CH2 3.99Å; F10-W38 HydrophobicContact CG-CH2 3.99Å
11	P	53.5	Low	53.3	Low	69 Å²	69	104.4 Å²	104.4	45%	0.448	54%	0.539	S	S	.	.			trans	-60.2	132.2	173.4	25.4	-31.8	0	0	0	108.2	Q9 L13 A19	Q9-P11 WeakPolarHBondContact O-CD 2.94Å; Q9-P11 VanDerWaalsContact O-N 3.16Å; P11-L13 VanDerWaalsContact C-N 3.34Å; P11-L13 HydrophobicContact CG-CD2 4.5Å; P11-L13 PolarHBondContact O-N 3.15Å; P11-A19 HydrophobicContact CB-CB 4.39Å
12	R	52.4	Low	52.9	Low	91 Å²	91	100 Å²	100	34%	0.343	53%	0.529	S	S	.	.			trans	-68.7	94.7	174.2	-68.8	-178.1	-82	-155.9	-2.2	107.8	F10 V20 C24	F10-R12 PolarHBondContact O-N 3.23Å; R12-V20 PolarHBondContact O-N 2.99Å; R12-C24 PolarHBondContact NH1-SG 2.88Å
13	L	46.6	Very low	51.8	Low	47 Å²	47	96.2 Å²	96.2	25%	0.246	53%	0.527	C	S	.	.	B	Isolated β-bridge	trans	-79.5	129.3	177.8	-62.8	167.3	0	0	0	109.6	P11 F17 S34	P11-L13 VanDerWaalsContact C-N 3.34Å; P11-L13 HydrophobicContact CG-CD2 4.5Å; P11-L13 PolarHBondContact O-N 3.15Å; L13-F17 HydrophobicContact CD1-CD1 4.15Å; L13-F17 HydrophobicContact CD1-CE1 4.49Å; L13-S34 WeakPolarHBondContact O-CB 3.27Å
14	N	48.5	Very low	51.1	Low	20 Å²	20	95.8 Å²	95.8	11%	0.107	53%	0.53	C	S	.	.			trans	-81.7	175	165.4	-93.1	3.8	0	0	0	111.6	A16 F17 E18 V20 D30	N14-A16 PolarHBondContact O-N 3.47Å; N14-F17 PolarHBondContact O-N 3.23Å; N14-E18 PolarHBondContact N-O 3.28Å; N14-V20 HydrophobicContact CB-CG2 3.95Å; N14-V20 VanDerWaalsContact ND2-CG2 3.32Å; N14-V20 WeakPolarHBondContact ND2-CG2 3.48Å; N14-D30 VanDerWaalsContact ND2-CB 3.28Å; N14-D30 WeakPolarHBondContact ND2-CB 3.39Å; N14-D30 VanDerWaalsContact ND2-CG 3.31Å; N14-D30 PolarHBondContact ND2-OD1 2.92Å; N14-D30 PolarHBondContact OD1-O 3.45Å
15	F	42.4	Very low	50.5	Low	131 Å²	131	96.9 Å²	96.9	58%	0.575	53%	0.529	S	S	*	.	T	Hydrogen-bonded Turn	trans	-55.3	-18.3	177.3	-87.2	-109.6	0	0	0	114	F17 E33 I37	F15-F17 VanDerWaalsContact C-N 3.34Å; F15-E33 WeakPolarHBondContact CB-OE1 3.07Å; F15-E33 HydrophobicContact CD2-CB 4.48Å; F15-E33 HydrophobicContact CD2-CG 3.06Å; F15-E33 WeakPolarHBondContact CD2-OE1 3.48Å; F15-E33 HydrophobicContact CE2-CB 4.42Å; F15-E33 HydrophobicContact CE2-CG 3.11Å; F15-E33 HydrophobicContact CG-CG 4.23Å; F15-E33 HydrophobicContact CZ-CG 4.33Å; F15-E33 PolarHBondContact N-OE1 3.39Å; F15-I37 HydrophobicContact CB-CD1 4.46Å; F15-I37 HydrophobicContact CD2-CD1 3.17Å; F15-I37 HydrophobicContact CD2-CG1 3.66Å; F15-I37 HydrophobicContact CE2-CD1 3.45Å; F15-I37 VanDerWaalsContact CE2-CD1 3.45Å; F15-I37 HydrophobicContact CE2-CG1 3.33Å; F15-I37 HydrophobicContact CG-CD1 3.88Å; F15-I37 HydrophobicContact CG-CG1 4.44Å; F15-I37 HydrophobicContact CZ-CD1 4.3Å; F15-I37 HydrophobicContact CZ-CG1 3.85Å
16	A	51.9	Low	49.9	Very low	76 Å²	76	99 Å²	99	63%	0.628	53%	0.534	S	S	*	.	T	Hydrogen-bonded Turn	trans	-84.5	1.3	174.4	0	0	0	0	0	114.6	N14 E18	N14-A16 PolarHBondContact O-N 3.47Å; A16-E18 HydrophobicContact CB-CG 4.45Å; A16-E18 PolarHBondContact O-N 2.93Å; A16-E18 VanDerWaalsContact O-N 3.16Å
17	F	46	Very low	49.5	Very low	167 Å²	167	101.3 Å²	101.3	73%	0.732	55%	0.551	S	S	*	*	S	Bend	trans	57.1	20	-170.9	-77.6	-91.6	0	0	0	114.5	L13 N14 F15	L13-F17 HydrophobicContact CD1-CD1 4.15Å; L13-F17 HydrophobicContact CD1-CE1 4.49Å; N14-F17 PolarHBondContact O-N 3.23Å; F15-F17 VanDerWaalsContact C-N 3.34Å
18	E	43.1	Very low	49.3	Very low	144 Å²	144	96.7 Å²	96.7	67%	0.673	54%	0.536	S	S	*	.			trans	-95.2	140.7	173.1	-64.5	-144	132.4	0	0	111	N14 A16 V20	N14-E18 PolarHBondContact N-O 3.28Å; A16-E18 HydrophobicContact CB-CG 4.45Å; A16-E18 PolarHBondContact O-N 2.93Å; A16-E18 VanDerWaalsContact O-N 3.16Å; E18-V20 PolarHBondContact O-N 2.96Å
19	A	46.6	Very low	49.2	Very low	76 Å²	76	97.5 Å²	97.5	63%	0.628	54%	0.538	S	S	*	.	B	Isolated β-bridge	trans	-72.9	111	178.6	0	0	0	0	0	109.4	P11	P11-A19 HydrophobicContact CB-CB 4.39Å
20	V	49.7	Very low	49	Very low	64 Å²	64	93.8 Å²	93.8	39%	0.388	52%	0.523	S	S	.	.			trans	-85.3	133.8	177.7	-172	0	0	0	0	110.1	R12 N14 E18	R12-V20 PolarHBondContact O-N 2.99Å; N14-V20 HydrophobicContact CB-CG2 3.95Å; N14-V20 VanDerWaalsContact ND2-CG2 3.32Å; N14-V20 WeakPolarHBondContact ND2-CG2 3.48Å; E18-V20 PolarHBondContact O-N 2.96Å
21	G	46.5	Very low	49.4	Very low	55 Å²	55	91.9 Å²	91.9	57%	0.567	51%	0.513	S	S	*	.			trans	-54.2	152.1	-177	0	0	0	0	0	113.8	T23	G21-T23 VanDerWaalsContact C-N 3.25Å; G21-T23 PolarHBondContact O-N 3.5Å
22	S	48	Very low	49.9	Very low	110 Å²	110	92.9 Å²	92.9	77%	0.769	51%	0.514	S	S	*	.	S	Bend	trans	-70.2	57.4	-169.9	55.6	0	0	0	0	115.2
23	T	43.7	Very low	50.3	Low	111 Å²	111	91.9 Å²	91.9	68%	0.681	51%	0.513	S	S	*	.			trans	-113.2	113.1	166.3	35.9	0	0	0	0	108.6	G21 D25	G21-T23 VanDerWaalsContact C-N 3.25Å; G21-T23 PolarHBondContact O-N 3.5Å; T23-D25 PolarHBondContact O-N 3.33Å
24	C	44.7	Very low	50.9	Low	77 Å²	77	89.9 Å²	89.9	52%	0.52	50%	0.503	S	S	.	.			trans	-71	70.5	168.7	-74.7	0	0	0	0	108.3	R12 F26	R12-C24 PolarHBondContact NH1-SG 2.88Å; C24-F26 HydrophobicContact CB-CE2 4.31Å
25	D	49.2	Very low	51.8	Low	74 Å²	74	93.9 Å²	93.9	40%	0.396	52%	0.524	S	S	.	.			trans	-96.2	97.2	171.6	-158.6	-18.2	0	0	0	107.9	T23 T27 S28	T23-D25 PolarHBondContact O-N 3.33Å; D25-T27 PolarHBondContact O-N 3.45Å; D25-T27 VanDerWaalsContact O-N 3.08Å; D25-T27 VanDerWaalsContact OD1-CB 3.28Å; D25-T27 WeakPolarHBondContact OD1-CB 3.2Å; D25-T27 PolarHBondContact OD1-N 2.85Å; D25-T27 PolarHBondContact OD1-OG1 3.21Å; D25-T27 VanDerWaalsContact OD1-OG1 3.1Å; D25-S28 PolarHBondContact O-N 3.37Å; D25-S28 VanDerWaalsContact O-N 3.14Å
26	F	52.8	Low	53.1	Low	141 Å²	141	92.2 Å²	92.2	62%	0.618	52%	0.52	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.9	-7.8	178.3	-66.6	-84.1	0	0	0	112.8	C24 Y31	C24-F26 HydrophobicContact CB-CE2 4.31Å; F26-Y31 HydrophobicContact CD1-CD1 4.05Å; F26-Y31 AromaticContact CD1-CE1 3.45Å; F26-Y31 HydrophobicContact CD1-CE1 3.45Å; F26-Y31 VanDerWaalsContact CD1-CE1 3.45Å; F26-Y31 AromaticContact CE1-CE1 3.62Å; F26-Y31 HydrophobicContact CE1-CE1 3.62Å; F26-Y31 AromaticContact CE1-CZ 3.75Å; F26-Y31 WeakPolarHBondContact CE1-OH 3.35Å; F26-Y31 HydrophobicContact CG-CE1 4.44Å
27	T	54.2	Low	53.8	Low	120 Å²	120	90.8 Å²	90.8	74%	0.736	50%	0.501	S	S	*	.	T	Hydrogen-bonded Turn	trans	-88	-21.6	177.3	-42.6	0	0	0	0	112.6	D25 K29	D25-T27 PolarHBondContact O-N 3.45Å; D25-T27 VanDerWaalsContact O-N 3.08Å; D25-T27 VanDerWaalsContact OD1-CB 3.28Å; D25-T27 WeakPolarHBondContact OD1-CB 3.2Å; D25-T27 PolarHBondContact OD1-N 2.85Å; D25-T27 PolarHBondContact OD1-OG1 3.21Å; D25-T27 VanDerWaalsContact OD1-OG1 3.1Å; T27-K29 PolarHBondContact O-N 3.27Å
28	S	52.6	Low	54.9	Low	44 Å²	44	86.7 Å²	86.7	31%	0.308	48%	0.481	S	S	.	.			trans	-75.9	125.7	-173.9	-66.1	0	0	0	0	110.5	D25 D30 Y31	D25-S28 PolarHBondContact O-N 3.37Å; D25-S28 VanDerWaalsContact O-N 3.14Å; S28-D30 PolarHBondContact O-N 2.96Å; S28-D30 VanDerWaalsContact O-N 3.1Å; S28-Y31 WeakPolarHBondContact O-CB 3.41Å; S28-Y31 PolarHBondContact O-N 2.91Å
29	K	54.5	Low	56.4	Low	180 Å²	180	81.8 Å²	81.8	78%	0.783	47%	0.469	S	S	*	.	H	α-helix	trans	-48.9	-38.7	176	-69.1	173.1	-178.5	158	0	111.6	T27 Y31 I32 E33	T27-K29 PolarHBondContact O-N 3.27Å; K29-Y31 VanDerWaalsContact C-N 3.35Å; K29-Y31 PolarHBondContact O-N 2.94Å; K29-I32 PolarHBondContact O-N 3.16Å; K29-E33 WeakPolarHBondContact O-CB 3.24Å; K29-E33 PolarHBondContact O-N 3.46Å
30	D	54.7	Low	57.8	Low	78 Å²	78	81 Å²	81	42%	0.417	46%	0.457	S	S	.	.	H	α-helix	trans	-54.8	-41.8	175.1	-65.1	-14.4	0	0	0	113.7	N14 S28 E33 S34	N14-D30 VanDerWaalsContact ND2-CB 3.28Å; N14-D30 WeakPolarHBondContact ND2-CB 3.39Å; N14-D30 VanDerWaalsContact ND2-CG 3.31Å; N14-D30 PolarHBondContact ND2-OD1 2.92Å; N14-D30 PolarHBondContact OD1-O 3.45Å; S28-D30 PolarHBondContact O-N 2.96Å; S28-D30 VanDerWaalsContact O-N 3.1Å; D30-E33 PolarHBondContact O-N 3.32Å; D30-S34 PolarHBondContact O-N 3.46Å
31	Y	56.9	Low	59.1	Low	54 Å²	54	81.9 Å²	81.9	21%	0.212	46%	0.459	C	S	.	.	H	α-helix	trans	-68.5	-47.3	-178.5	-177.3	-96.9	0	0	0	111.5	F26 S28 K29 E33 S34 L35	F26-Y31 HydrophobicContact CD1-CD1 4.05Å; F26-Y31 AromaticContact CD1-CE1 3.45Å; F26-Y31 HydrophobicContact CD1-CE1 3.45Å; F26-Y31 VanDerWaalsContact CD1-CE1 3.45Å; F26-Y31 AromaticContact CE1-CE1 3.62Å; F26-Y31 HydrophobicContact CE1-CE1 3.62Å; F26-Y31 AromaticContact CE1-CZ 3.75Å; F26-Y31 WeakPolarHBondContact CE1-OH 3.35Å; F26-Y31 HydrophobicContact CG-CE1 4.44Å; S28-Y31 WeakPolarHBondContact O-CB 3.41Å; S28-Y31 PolarHBondContact O-N 2.91Å; K29-Y31 VanDerWaalsContact C-N 3.35Å; K29-Y31 PolarHBondContact O-N 2.94Å; Y31-E33 VanDerWaalsContact C-N 3.27Å; Y31-E33 PolarHBondContact O-N 3.23Å; Y31-S34 PolarHBondContact O-N 3.47Å; Y31-S34 PolarHBondContact O-OG 2.93Å; Y31-L35 PolarHBondContact O-N 2.96Å; Y31-L35 VanDerWaalsContact O-N 3.1Å
32	I	63.7	Low	60.7	Low	91 Å²	91	82.5 Å²	82.5	47%	0.467	45%	0.453	S	S	.	.	H	α-helix	trans	-61.9	-42	176.7	-62.4	173.5	0	0	0	109.9	K29 L35 I36	K29-I32 PolarHBondContact O-N 3.16Å; I32-L35 WeakPolarHBondContact O-CB 3.48Å; I32-L35 PolarHBondContact O-N 3.11Å; I32-I36 HydrophobicContact CG2-CD1 4.04Å; I32-I36 WeakPolarHBondContact O-CG1 3.44Å; I32-I36 PolarHBondContact O-N 3.44Å
33	E	60	Low	62.3	Low	69 Å²	69	79.7 Å²	79.7	32%	0.322	43%	0.429	S	S	.	.	H	α-helix	trans	-61	-47.3	179.6	-173.4	-178.5	105	0	0	111.6	F15 K29 D30 Y31 L35 I36 I37	F15-E33 WeakPolarHBondContact CB-OE1 3.07Å; F15-E33 HydrophobicContact CD2-CB 4.48Å; F15-E33 HydrophobicContact CD2-CG 3.06Å; F15-E33 WeakPolarHBondContact CD2-OE1 3.48Å; F15-E33 HydrophobicContact CE2-CB 4.42Å; F15-E33 HydrophobicContact CE2-CG 3.11Å; F15-E33 HydrophobicContact CG-CG 4.23Å; F15-E33 HydrophobicContact CZ-CG 4.33Å; F15-E33 PolarHBondContact N-OE1 3.39Å; K29-E33 WeakPolarHBondContact O-CB 3.24Å; K29-E33 PolarHBondContact O-N 3.46Å; D30-E33 PolarHBondContact O-N 3.32Å; Y31-E33 VanDerWaalsContact C-N 3.27Å; Y31-E33 PolarHBondContact O-N 3.23Å; E33-L35 VanDerWaalsContact C-N 3.31Å; E33-L35 PolarHBondContact O-N 3.43Å; E33-I36 PolarHBondContact O-N 3.09Å; E33-I37 WeakPolarHBondContact O-CG1 3.4Å; E33-I37 PolarHBondContact O-N 3.26Å
34	S	58.6	Low	64.1	Low	6 Å²	6	78.4 Å²	78.4	4%	0.042	42%	0.417	C	S	.	.	H	α-helix	trans	-60.6	-39.6	174.2	75.8	0	0	0	0	112.3	L13 D30 Y31 I36 I37 W38	L13-S34 WeakPolarHBondContact O-CB 3.27Å; D30-S34 PolarHBondContact O-N 3.46Å; Y31-S34 PolarHBondContact O-N 3.47Å; Y31-S34 PolarHBondContact O-OG 2.93Å; S34-I36 VanDerWaalsContact C-N 3.35Å; S34-I36 PolarHBondContact O-N 3.14Å; S34-I37 WeakPolarHBondContact O-CB 3.24Å; S34-I37 PolarHBondContact O-N 3.08Å; S34-W38 PolarHBondContact O-N 3.48Å
35	L	68.3	Low	65.9	Low	104 Å²	104	78.1 Å²	78.1	55%	0.545	41%	0.412	S	S	.	.	H	α-helix	trans	-65.8	-38.2	-178.8	-159.9	70.5	0	0	0	112	Y31 I32 E33 W38 G39	Y31-L35 PolarHBondContact O-N 2.96Å; Y31-L35 VanDerWaalsContact O-N 3.1Å; I32-L35 WeakPolarHBondContact O-CB 3.48Å; I32-L35 PolarHBondContact O-N 3.11Å; E33-L35 VanDerWaalsContact C-N 3.31Å; E33-L35 PolarHBondContact O-N 3.43Å; L35-W38 PolarHBondContact O-N 3.04Å; L35-G39 PolarHBondContact O-N 2.93Å
36	I	69.3	Low	67.5	Low	96 Å²	96	77.2 Å²	77.2	49%	0.492	41%	0.411	S	S	.	.	H	α-helix	trans	-64.3	-41.9	174.6	-67.8	167.3	0	0	0	110.6	I32 E33 S34 G39 T40	I32-I36 HydrophobicContact CG2-CD1 4.04Å; I32-I36 WeakPolarHBondContact O-CG1 3.44Å; I32-I36 PolarHBondContact O-N 3.44Å; E33-I36 PolarHBondContact O-N 3.09Å; S34-I36 VanDerWaalsContact C-N 3.35Å; S34-I36 PolarHBondContact O-N 3.14Å; I36-G39 PolarHBondContact O-N 3.1Å; I36-T40 WeakPolarHBondContact O-CB 3.39Å; I36-T40 PolarHBondContact O-N 3.42Å; I36-T40 PolarHBondContact O-OG1 3.22Å
37	I	66.5	Low	69	Low	45 Å²	45	73.8 Å²	73.8	23%	0.231	40%	0.402	C	S	.	.	H	α-helix	trans	-58.6	-51.2	176.4	-64.8	162.4	0	0	0	109.8	F15 E33 S34 G39 T40 L41	F15-I37 HydrophobicContact CB-CD1 4.46Å; F15-I37 HydrophobicContact CD2-CD1 3.17Å; F15-I37 HydrophobicContact CD2-CG1 3.66Å; F15-I37 HydrophobicContact CE2-CD1 3.45Å; F15-I37 VanDerWaalsContact CE2-CD1 3.45Å; F15-I37 HydrophobicContact CE2-CG1 3.33Å; F15-I37 HydrophobicContact CG-CD1 3.88Å; F15-I37 HydrophobicContact CG-CG1 4.44Å; F15-I37 HydrophobicContact CZ-CD1 4.3Å; F15-I37 HydrophobicContact CZ-CG1 3.85Å; E33-I37 WeakPolarHBondContact O-CG1 3.4Å; E33-I37 PolarHBondContact O-N 3.26Å; S34-I37 WeakPolarHBondContact O-CB 3.24Å; S34-I37 PolarHBondContact O-N 3.08Å; I37-G39 VanDerWaalsContact C-N 3.33Å; I37-G39 PolarHBondContact O-N 3.49Å; I37-T40 PolarHBondContact O-N 2.96Å; I37-L41 WeakPolarHBondContact O-CB 3.28Å; I37-L41 PolarHBondContact O-N 2.91Å
38	W	69.2	Low	70.5	Confident	82 Å²	82	72.8 Å²	72.8	31%	0.311	39%	0.391	S	S	.	.	H	α-helix	trans	-66.9	-32.4	-178.1	-74.8	106.1	0	0	0	113.4	F10 S34 L35 L41 P42	F10-W38 HydrophobicContact CB-CH2 4.47Å; F10-W38 AromaticContact CD1-CH2 3.41Å; F10-W38 HydrophobicContact CD1-CH2 3.41Å; F10-W38 VanDerWaalsContact CD1-CH2 3.41Å; F10-W38 HydrophobicContact CD1-CZ2 4.02Å; F10-W38 HydrophobicContact CD1-CZ3 4.33Å; F10-W38 AromaticContact CE1-CH2 3.76Å; F10-W38 HydrophobicContact CE1-CH2 3.76Å; F10-W38 HydrophobicContact CE1-CZ3 4.48Å; F10-W38 AromaticContact CG-CH2 3.99Å; F10-W38 HydrophobicContact CG-CH2 3.99Å; S34-W38 PolarHBondContact O-N 3.48Å; L35-W38 PolarHBondContact O-N 3.04Å; W38-L41 HydrophobicContact CZ3-CD2 4.47Å; W38-P42 WeakPolarHBondContact O-CD 3.28Å
39	G	74.2	Confident	71.9	Confident	41 Å²	41	75.4 Å²	75.4	42%	0.423	40%	0.401	S	S	.	.	H	α-helix	trans	-72.9	-37.1	173.7	0	0	0	0	0	113.1	L35 I36 I37 P42	L35-G39 PolarHBondContact O-N 2.93Å; I36-G39 PolarHBondContact O-N 3.1Å; I37-G39 VanDerWaalsContact C-N 3.33Å; I37-G39 PolarHBondContact O-N 3.49Å; G39-P42 WeakPolarHBondContact O-CD 3.48Å; G39-P42 WeakPolarHBondContact O-CG 3.13Å
40	T	76.3	Confident	73.3	Confident	60 Å²	60	70 Å²	70	37%	0.368	38%	0.378	S	S	.	.	H	α-helix	trans	-83.7	-32.2	-175.8	-51.7	0	0	0	0	112.2	I36 I37 I43 I44	I36-T40 WeakPolarHBondContact O-CB 3.39Å; I36-T40 PolarHBondContact O-N 3.42Å; I36-T40 PolarHBondContact O-OG1 3.22Å; I37-T40 PolarHBondContact O-N 2.96Å; T40-I43 WeakPolarHBondContact O-CA 3.02Å; T40-I43 WeakPolarHBondContact O-CB 3.37Å; T40-I43 PolarHBondContact O-N 3.12Å; T40-I44 HydrophobicContact CG2-CD1 3.83Å; T40-I44 HydrophobicContact CG2-CG1 4.05Å; T40-I44 WeakPolarHBondContact O-CG1 3.45Å; T40-I44 PolarHBondContact O-N 3.01Å
41	L	78	Confident	74.7	Confident	82 Å²	82	71.1 Å²	71.1	43%	0.429	38%	0.384	S	S	.	.	H	α-helix	trans	-53.4	-51.3	179.7	-174.1	66.1	0	0	0	113.8	I37 W38 I43 I44 V45	I37-L41 WeakPolarHBondContact O-CB 3.28Å; I37-L41 PolarHBondContact O-N 2.91Å; W38-L41 HydrophobicContact CZ3-CD2 4.47Å; L41-I43 PolarHBondContact O-N 3.38Å; L41-I44 PolarHBondContact O-N 2.93Å; L41-V45 WeakPolarHBondContact O-CG2 3.47Å; L41-V45 PolarHBondContact O-N 3.39Å
42	P	78.6	Confident	76.1	Confident	68 Å²	68	72.5 Å²	72.5	44%	0.442	40%	0.397	S	S	.	.	H	α-helix	trans	-63.2	-32.7	177.4	25.4	-34.5	0	0	0	111.8	W38 G39 V45 C46	W38-P42 WeakPolarHBondContact O-CD 3.28Å; G39-P42 WeakPolarHBondContact O-CD 3.48Å; G39-P42 WeakPolarHBondContact O-CG 3.13Å; P42-V45 PolarHBondContact O-N 2.9Å; P42-C46 WeakPolarHBondContact O-CB 3.29Å; P42-C46 PolarHBondContact O-N 3.46Å; P42-C46 PolarHBondContact O-SG 2.94Å
43	I	82.4	Confident	77.1	Confident	51 Å²	51	70.9 Å²	70.9	26%	0.262	39%	0.389	S	S	.	.	H	α-helix	trans	-65	-47.4	176.3	-58.8	174.6	0	0	0	110.3	T40 L41 V45 C46 V47 F91 V94	T40-I43 WeakPolarHBondContact O-CA 3.02Å; T40-I43 WeakPolarHBondContact O-CB 3.37Å; T40-I43 PolarHBondContact O-N 3.12Å; L41-I43 PolarHBondContact O-N 3.38Å; I43-V45 VanDerWaalsContact C-N 3.32Å; I43-V45 PolarHBondContact O-N 3.1Å; I43-C46 WeakPolarHBondContact O-CB 3.32Å; I43-C46 PolarHBondContact O-N 3.01Å; I43-V47 HydrophobicContact CG2-CG2 4.49Å; I43-V47 WeakPolarHBondContact O-CG2 3.39Å; I43-V47 PolarHBondContact O-N 3.43Å; I43-F91 HydrophobicContact CG2-CD2 4.21Å; I43-F91 HydrophobicContact CG2-CE2 3.67Å; I43-V94 HydrophobicContact CD1-CG1 4.47Å
44	I	81.6	Confident	78.1	Confident	84 Å²	84	70.1 Å²	70.1	43%	0.431	39%	0.389	S	S	.	.	H	α-helix	trans	-59	-46.2	176.3	-66.6	166.9	0	0	0	110.1	T40 L41 C46 V47 L48	T40-I44 HydrophobicContact CG2-CD1 3.83Å; T40-I44 HydrophobicContact CG2-CG1 4.05Å; T40-I44 WeakPolarHBondContact O-CG1 3.45Å; T40-I44 PolarHBondContact O-N 3.01Å; L41-I44 PolarHBondContact O-N 2.93Å; I44-C46 VanDerWaalsContact C-N 3.34Å; I44-C46 PolarHBondContact O-N 3.44Å; I44-V47 PolarHBondContact O-N 3.44Å; I44-L48 HydrophobicContact CG2-CD1 3.86Å; I44-L48 HydrophobicContact CG2-CG 4.25Å; I44-L48 WeakPolarHBondContact O-CB 3.38Å; I44-L48 WeakPolarHBondContact O-CG 3.5Å; I44-L48 PolarHBondContact O-N 3.39Å
45	V	82.2	Confident	79.4	Confident	70 Å²	70	71.3 Å²	71.3	42%	0.424	40%	0.403	S	S	.	.	H	α-helix	trans	-60.7	-43.5	177.7	173.5	0	0	0	0	110.9	L41 P42 I43 L48 L49	L41-V45 WeakPolarHBondContact O-CG2 3.47Å; L41-V45 PolarHBondContact O-N 3.39Å; P42-V45 PolarHBondContact O-N 2.9Å; I43-V45 VanDerWaalsContact C-N 3.32Å; I43-V45 PolarHBondContact O-N 3.1Å; V45-L48 PolarHBondContact O-N 3.16Å; V45-L49 HydrophobicContact CG1-CD1 3.94Å; V45-L49 HydrophobicContact CG1-CG 4.34Å; V45-L49 WeakPolarHBondContact O-CB 3.2Å; V45-L49 VanDerWaalsContact O-CG 3.26Å; V45-L49 WeakPolarHBondContact O-CG 3.44Å; V45-L49 PolarHBondContact O-N 3.38Å
46	C	82.7	Confident	80	Confident	56 Å²	56	71.8 Å²	71.8	38%	0.378	41%	0.405	S	S	.	.	H	α-helix	trans	-61.1	-44.7	175.8	-76	0	0	0	0	112.5	P42 I43 I44 L49 F50	P42-C46 WeakPolarHBondContact O-CB 3.29Å; P42-C46 PolarHBondContact O-N 3.46Å; P42-C46 PolarHBondContact O-SG 2.94Å; I43-C46 WeakPolarHBondContact O-CB 3.32Å; I43-C46 PolarHBondContact O-N 3.01Å; I44-C46 VanDerWaalsContact C-N 3.34Å; I44-C46 PolarHBondContact O-N 3.44Å; C46-L49 PolarHBondContact O-N 3.28Å; C46-F50 WeakPolarHBondContact O-CB 3.47Å; C46-F50 PolarHBondContact O-N 2.98Å
47	V	84.9	Confident	80.4	Confident	68 Å²	68	70.5 Å²	70.5	41%	0.412	39%	0.394	S	S	.	.	H	α-helix	trans	-66.3	-42.1	178.1	173.9	0	0	0	0	111.2	I43 I44 F50 L51	I43-V47 HydrophobicContact CG2-CG2 4.49Å; I43-V47 WeakPolarHBondContact O-CG2 3.39Å; I43-V47 PolarHBondContact O-N 3.43Å; I44-V47 PolarHBondContact O-N 3.44Å; V47-F50 WeakPolarHBondContact O-CB 3.46Å; V47-F50 PolarHBondContact O-N 2.84Å; V47-L51 WeakPolarHBondContact O-CG 3.38Å; V47-L51 PolarHBondContact O-N 3.37Å
48	L	84.8	Confident	81.1	Confident	100 Å²	100	71.5 Å²	71.5	52%	0.524	41%	0.405	S	S	.	.	H	α-helix	trans	-63.2	-46	176	-74.2	175.8	0	0	0	111.6	I44 V45 F50 L51 V52	I44-L48 HydrophobicContact CG2-CD1 3.86Å; I44-L48 HydrophobicContact CG2-CG 4.25Å; I44-L48 WeakPolarHBondContact O-CB 3.38Å; I44-L48 WeakPolarHBondContact O-CG 3.5Å; I44-L48 PolarHBondContact O-N 3.39Å; V45-L48 PolarHBondContact O-N 3.16Å; L48-F50 VanDerWaalsContact C-N 3.27Å; L48-F50 PolarHBondContact O-N 2.84Å; L48-L51 PolarHBondContact O-N 2.81Å; L48-V52 WeakPolarHBondContact O-CG2 3.45Å; L48-V52 PolarHBondContact O-N 2.94Å
49	L	82.5	Confident	81.6	Confident	98 Å²	98	72.3 Å²	72.3	51%	0.513	42%	0.419	S	S	.	.	H	α-helix	trans	-60.1	-39.7	175.4	-73.9	174.1	0	0	0	111.4	V45 C46 V52 I53	V45-L49 HydrophobicContact CG1-CD1 3.94Å; V45-L49 HydrophobicContact CG1-CG 4.34Å; V45-L49 WeakPolarHBondContact O-CB 3.2Å; V45-L49 VanDerWaalsContact O-CG 3.26Å; V45-L49 WeakPolarHBondContact O-CG 3.44Å; V45-L49 PolarHBondContact O-N 3.38Å; C46-L49 PolarHBondContact O-N 3.28Å; L49-V52 PolarHBondContact O-N 3.23Å; L49-I53 WeakPolarHBondContact O-CB 3.43Å; L49-I53 WeakPolarHBondContact O-CD1 3.19Å; L49-I53 WeakPolarHBondContact O-CG1 3.44Å; L49-I53 PolarHBondContact O-N 2.96Å
50	F	83.8	Confident	81.7	Confident	66 Å²	66	78.3 Å²	78.3	29%	0.289	43%	0.433	S	S	.	.	H	α-helix	trans	-59.3	-49.9	174	177.1	-96.1	0	0	0	111.9	C46 V47 L48 V52 I53 V54 C84 V87	C46-F50 WeakPolarHBondContact O-CB 3.47Å; C46-F50 PolarHBondContact O-N 2.98Å; V47-F50 WeakPolarHBondContact O-CB 3.46Å; V47-F50 PolarHBondContact O-N 2.84Å; L48-F50 VanDerWaalsContact C-N 3.27Å; L48-F50 PolarHBondContact O-N 2.84Å; F50-V52 VanDerWaalsContact C-N 3.33Å; F50-V52 PolarHBondContact O-N 3.3Å; F50-I53 PolarHBondContact O-N 3.49Å; F50-V54 HydrophobicContact CD1-CG2 4.35Å; F50-V54 HydrophobicContact CD2-CG2 4.45Å; F50-V54 HydrophobicContact CE1-CG2 4Å; F50-V54 HydrophobicContact CE2-CG2 4.14Å; F50-V54 HydrophobicContact CZ-CG2 3.88Å; F50-V54 WeakPolarHBondContact O-CB 3.18Å; F50-V54 WeakPolarHBondContact O-CG2 3.11Å; F50-V54 PolarHBondContact O-N 3.33Å; F50-C84 HydrophobicContact CE2-CB 3.78Å; F50-C84 WeakPolarHBondContact CE2-SG 3.46Å; F50-C84 HydrophobicContact CZ-CB 4.41Å; F50-V87 HydrophobicContact CB-CG1 4.31Å; F50-V87 HydrophobicContact CD2-CB 4.21Å; F50-V87 HydrophobicContact CD2-CG1 3.98Å; F50-V87 HydrophobicContact CG-CG1 4.49Å
51	L	85.3	Confident	81.5	Confident	103 Å²	103	77.9 Å²	77.9	54%	0.539	43%	0.432	S	S	.	.	H	α-helix	trans	-61.9	-39.8	177.7	-68.6	179	0	0	0	112.3	V47 L48 G55	V47-L51 WeakPolarHBondContact O-CG 3.38Å; V47-L51 PolarHBondContact O-N 3.37Å; L48-L51 PolarHBondContact O-N 2.81Å; L51-G55 PolarHBondContact O-N 3.47Å
52	V	85.4	Confident	81.2	Confident	83 Å²	83	78.6 Å²	78.6	50%	0.503	44%	0.443	S	S	.	.	H	α-helix	trans	-64.6	-45.5	176.4	171.1	0	0	0	0	110.8	L48 L49 F50 G55 L56	L48-V52 WeakPolarHBondContact O-CG2 3.45Å; L48-V52 PolarHBondContact O-N 2.94Å; L49-V52 PolarHBondContact O-N 3.23Å; F50-V52 VanDerWaalsContact C-N 3.33Å; F50-V52 PolarHBondContact O-N 3.3Å; V52-G55 PolarHBondContact O-N 2.99Å; V52-L56 HydrophobicContact CG1-CD1 3.73Å; V52-L56 HydrophobicContact CG1-CG 4.17Å; V52-L56 VanDerWaalsContact O-CB 3.3Å; V52-L56 WeakPolarHBondContact O-CB 3.2Å; V52-L56 WeakPolarHBondContact O-CG 3.24Å; V52-L56 PolarHBondContact O-N 3.34Å
53	I	83.7	Confident	80.6	Confident	57 Å²	57	80.2 Å²	80.2	29%	0.292	46%	0.456	S	S	.	.	H	α-helix	trans	-60.4	-52.7	177.4	-69	164.1	0	0	0	109.5	L49 F50 G55 L56 W57 I83	L49-I53 WeakPolarHBondContact O-CB 3.43Å; L49-I53 WeakPolarHBondContact O-CD1 3.19Å; L49-I53 WeakPolarHBondContact O-CG1 3.44Å; L49-I53 PolarHBondContact O-N 2.96Å; F50-I53 PolarHBondContact O-N 3.49Å; I53-G55 VanDerWaalsContact C-N 3.34Å; I53-G55 PolarHBondContact O-N 3.41Å; I53-L56 PolarHBondContact O-N 3.39Å; I53-W57 HydrophobicContact CG2-CG 4.47Å; I53-W57 WeakPolarHBondContact O-CB 3.48Å; I53-W57 PolarHBondContact O-N 3.03Å; I53-I83 HydrophobicContact CD1-CG2 4.2Å; I53-I83 HydrophobicContact CG2-CD1 4.47Å; I53-I83 HydrophobicContact CG2-CG2 4.18Å
54	V	83	Confident	79.6	Confident	52 Å²	52	82.6 Å²	82.6	32%	0.315	46%	0.464	S	S	.	.	H	α-helix	trans	-60.1	-42.7	179.5	173.7	0	0	0	0	111.5	F50 W57 S58	F50-V54 HydrophobicContact CD1-CG2 4.35Å; F50-V54 HydrophobicContact CD2-CG2 4.45Å; F50-V54 HydrophobicContact CE1-CG2 4Å; F50-V54 HydrophobicContact CE2-CG2 4.14Å; F50-V54 HydrophobicContact CZ-CG2 3.88Å; F50-V54 WeakPolarHBondContact O-CB 3.18Å; F50-V54 WeakPolarHBondContact O-CG2 3.11Å; F50-V54 PolarHBondContact O-N 3.33Å; V54-W57 VanDerWaalsContact O-CB 3.27Å; V54-W57 WeakPolarHBondContact O-CB 2.94Å; V54-W57 PolarHBondContact O-N 3.45Å; V54-S58 PolarHBondContact O-N 2.92Å; V54-S58 PolarHBondContact O-OG 2.82Å
55	G	84.3	Confident	78.3	Confident	32 Å²	32	83.9 Å²	83.9	33%	0.33	48%	0.48	S	S	.	.	H	α-helix	trans	-65.1	-49.4	178.5	0	0	0	0	0	113.1	L51 V52 I53 W57 S58 V59	L51-G55 PolarHBondContact O-N 3.47Å; V52-G55 PolarHBondContact O-N 2.99Å; I53-G55 VanDerWaalsContact C-N 3.34Å; I53-G55 PolarHBondContact O-N 3.41Å; G55-W57 PolarHBondContact O-N 2.78Å; G55-S58 PolarHBondContact O-N 3.19Å; G55-V59 VanDerWaalsContact O-CG2 3.31Å; G55-V59 WeakPolarHBondContact O-CG2 3.49Å; G55-V59 PolarHBondContact O-N 3.21Å
56	L	81.8	Confident	77	Confident	113 Å²	113	86.4 Å²	86.4	59%	0.592	50%	0.501	S	S	*	.	H	α-helix	trans	-58.4	-34	175.1	-71.8	175.5	0	0	0	111.5	V52 I53 K60	V52-L56 HydrophobicContact CG1-CD1 3.73Å; V52-L56 HydrophobicContact CG1-CG 4.17Å; V52-L56 VanDerWaalsContact O-CB 3.3Å; V52-L56 WeakPolarHBondContact O-CB 3.2Å; V52-L56 WeakPolarHBondContact O-CG 3.24Å; V52-L56 PolarHBondContact O-N 3.34Å; I53-L56 PolarHBondContact O-N 3.39Å; L56-K60 WeakPolarHBondContact O-CB 3.36Å; L56-K60 PolarHBondContact O-N 2.92Å
57	W	77.5	Confident	75.7	Confident	70 Å²	70	86.7 Å²	86.7	27%	0.265	50%	0.504	S	S	.	.	H	α-helix	trans	-70.2	-48.4	176.7	-87.4	49.5	0	0	0	113.6	I53 V54 G55 V59 K60 C61 A76 S79 I83	I53-W57 HydrophobicContact CG2-CG 4.47Å; I53-W57 WeakPolarHBondContact O-CB 3.48Å; I53-W57 PolarHBondContact O-N 3.03Å; V54-W57 VanDerWaalsContact O-CB 3.27Å; V54-W57 WeakPolarHBondContact O-CB 2.94Å; V54-W57 PolarHBondContact O-N 3.45Å; G55-W57 PolarHBondContact O-N 2.78Å; W57-V59 VanDerWaalsContact C-N 3.27Å; W57-V59 PolarHBondContact O-N 3.39Å; W57-K60 PolarHBondContact O-N 3.31Å; W57-C61 WeakPolarHBondContact O-CB 3.5Å; W57-C61 PolarHBondContact O-N 3.44Å; W57-C61 PolarHBondContact O-SG 3.24Å; W57-A76 WeakPolarHBondContact CH2-O 3.33Å; W57-A76 VanDerWaalsContact CZ3-C 3.43Å; W57-A76 WeakPolarHBondContact CZ3-O 3.42Å; W57-S79 VanDerWaalsContact CH2-OG 3.24Å; W57-S79 WeakPolarHBondContact CH2-OG 3.35Å; W57-I83 HydrophobicContact CZ2-CD1 3.88Å
58	S	80.7	Confident	74.2	Confident	65 Å²	65	91.6 Å²	91.6	46%	0.455	53%	0.528	S	S	.	.	H	α-helix	trans	-56.1	-46.3	173.3	-58.2	0	0	0	0	110.2	V54 G55 K60 C61 C62	V54-S58 PolarHBondContact O-N 2.92Å; V54-S58 PolarHBondContact O-OG 2.82Å; G55-S58 PolarHBondContact O-N 3.19Å; S58-K60 PolarHBondContact O-N 3.35Å; S58-C61 PolarHBondContact O-N 3.2Å; S58-C62 WeakPolarHBondContact O-CB 3.36Å; S58-C62 PolarHBondContact O-N 3.1Å; S58-C62 PolarHBondContact O-SG 3.03Å
59	V	80.9	Confident	72.9	Confident	100 Å²	100	93.9 Å²	93.9	61%	0.606	53%	0.534	S	S	*	.	H	α-helix	trans	-61.7	-46.2	177.6	173.9	0	0	0	0	111.7	G55 W57 C62 S63	G55-V59 VanDerWaalsContact O-CG2 3.31Å; G55-V59 WeakPolarHBondContact O-CG2 3.49Å; G55-V59 PolarHBondContact O-N 3.21Å; W57-V59 VanDerWaalsContact C-N 3.27Å; W57-V59 PolarHBondContact O-N 3.39Å; V59-C62 PolarHBondContact O-N 3.06Å; V59-S63 WeakPolarHBondContact O-CB 3.39Å; V59-S63 PolarHBondContact O-N 3.3Å
60	K	75.6	Confident	71.8	Confident	167 Å²	167	94.6 Å²	94.6	73%	0.726	54%	0.544	S	S	*	.	H	α-helix	trans	-64.8	-39.4	177.6	-102.6	-165	166.4	73.1	0	112.8	L56 W57 S58 K64	L56-K60 WeakPolarHBondContact O-CB 3.36Å; L56-K60 PolarHBondContact O-N 2.92Å; W57-K60 PolarHBondContact O-N 3.31Å; S58-K60 PolarHBondContact O-N 3.35Å; K60-K64 PolarHBondContact O-N 3.15Å
61	C	71.9	Confident	70.8	Confident	51 Å²	51	99.9 Å²	99.9	35%	0.345	57%	0.567	S	S	.	*	H	α-helix	trans	-66	-46.7	176.9	-67.6	0	0	0	0	110.8	W57 S58 K64	W57-C61 WeakPolarHBondContact O-CB 3.5Å; W57-C61 PolarHBondContact O-N 3.44Å; W57-C61 PolarHBondContact O-SG 3.24Å; S58-C61 PolarHBondContact O-N 3.2Å; C61-K64 PolarHBondContact O-N 2.84Å
62	C	70.9	Confident	69.8	Low	97 Å²	97	96.7 Å²	96.7	66%	0.655	55%	0.553	S	S	*	*	H	α-helix	trans	-68.3	-39.1	179	-67.2	0	0	0	0	112.7	S58 V59 K64 S65	S58-C62 WeakPolarHBondContact O-CB 3.36Å; S58-C62 PolarHBondContact O-N 3.1Å; S58-C62 PolarHBondContact O-SG 3.03Å; V59-C62 PolarHBondContact O-N 3.06Å; C62-K64 PolarHBondContact O-N 2.91Å; C62-S65 WeakPolarHBondContact O-CB 3.33Å; C62-S65 PolarHBondContact O-N 3.49Å
63	S	66.6	Low	69	Low	102 Å²	102	96 Å²	96	71%	0.713	55%	0.547	S	S	*	.	H	α-helix	trans	-64.7	-25.1	177.6	179.4	0	0	0	0	112.5	V59 S65	V59-S63 WeakPolarHBondContact O-CB 3.39Å; V59-S63 PolarHBondContact O-N 3.3Å; S63-S65 PolarHBondContact O-N 3.09Å
64	K	60.9	Low	68.6	Low	100 Å²	100	96.3 Å²	96.3	44%	0.435	56%	0.557	S	S	.	*	T	Hydrogen-bonded Turn	trans	-77.6	1.3	178.3	-158.9	169.1	-176.7	177.7	0	114.3	K60 C61 C62 S66 S67 S72	K60-K64 PolarHBondContact O-N 3.15Å; C61-K64 PolarHBondContact O-N 2.84Å; C62-K64 PolarHBondContact O-N 2.91Å; K64-S66 PolarHBondContact O-N 3.38Å; K64-S67 PolarHBondContact O-N 3.45Å; K64-S72 WeakPolarHBondContact CE-OG 3.43Å; K64-S72 PolarHBondContact NZ-OG 3.41Å
65	S	55.7	Low	68.3	Low	111 Å²	111	101.6 Å²	101.6	78%	0.776	58%	0.576	S	S	*	*	T	Hydrogen-bonded Turn	trans	-63.1	16.3	-175.8	-169.5	0	0	0	0	116.8	C62 S63	C62-S65 WeakPolarHBondContact O-CB 3.33Å; C62-S65 PolarHBondContact O-N 3.49Å; S63-S65 PolarHBondContact O-N 3.09Å
66	S	54.7	Low	67.8	Low	123 Å²	123	101.6 Å²	101.6	86%	0.86	57%	0.573	S	S	*	*	T	Hydrogen-bonded Turn	trans	-124.3	10.7	177.4	-135.2	0	0	0	0	115.8	K64	K64-S66 PolarHBondContact O-N 3.38Å
67	S	54.2	Low	67.6	Low	63 Å²	63	100.7 Å²	100.7	44%	0.441	57%	0.568	S	S	.	*	S	Bend	trans	-129.8	108.7	172.7	113.7	0	0	0	0	111.4	K64 K69	K64-S67 PolarHBondContact O-N 3.45Å; S67-K69 PolarHBondContact O-N 2.83Å
68	N	53.5	Low	67.8	Low	170 Å²	170	99.7 Å²	99.7	91%	0.909	57%	0.574	S	S	*	*			trans	-53.3	84.1	175.1	-65.4	-51.7	0	0	0	112.6
69	K	59	Low	67.8	Low	149 Å²	149	99 Å²	99	65%	0.648	57%	0.57	S	S	*	*			trans	-147.3	101.4	166	-62.5	-168.3	-157.8	-173.2	0	111.1	S67 K71	S67-K69 PolarHBondContact O-N 2.83Å; K69-K71 PolarHBondContact O-N 2.71Å; K69-K71 VanDerWaalsContact O-N 3.09Å
70	P	59.3	Low	67.9	Low	112 Å²	112	94.7 Å²	94.7	73%	0.727	55%	0.545	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.6	-16.2	-175.2	23.7	-33.3	0	0	0	115
71	K	61.6	Low	68.2	Low	178 Å²	178	91.7 Å²	91.7	77%	0.774	54%	0.536	S	S	*	.	H	α-helix	trans	-79.8	-23.5	-172.5	-60.3	-172	-174	-175.9	0	114.6	K69	K69-K71 PolarHBondContact O-N 2.71Å; K69-K71 VanDerWaalsContact O-N 3.09Å
72	S	64.7	Low	68.9	Low	35 Å²	35	94.2 Å²	94.2	25%	0.245	55%	0.545	C	S	.	.	H	α-helix	trans	-77.6	-29.9	-178.3	57.1	0	0	0	0	113.2	K64 K75 A76	K64-S72 WeakPolarHBondContact CE-OG 3.43Å; K64-S72 PolarHBondContact NZ-OG 3.41Å; S72-K75 PolarHBondContact O-N 3.27Å; S72-A76 PolarHBondContact O-N 2.84Å
73	D	69.4	Low	69.5	Low	70 Å²	70	92.3 Å²	92.3	37%	0.374	53%	0.528	S	S	.	.	H	α-helix	trans	-78.6	-37.8	-168.4	-54.7	-10.9	0	0	0	109.6	K75 A76 I77	D73-K75 VanDerWaalsContact C-N 3.32Å; D73-K75 PolarHBondContact O-N 3.38Å; D73-A76 WeakPolarHBondContact O-CB 3.4Å; D73-A76 PolarHBondContact O-N 2.92Å; D73-I77 WeakPolarHBondContact O-CB 3.48Å; D73-I77 WeakPolarHBondContact O-CD1 3.43Å; D73-I77 VanDerWaalsContact O-CG1 3.23Å; D73-I77 WeakPolarHBondContact O-CG1 3.47Å; D73-I77 PolarHBondContact O-N 3.25Å
74	A	73.5	Confident	70.3	Confident	62 Å²	62	89 Å²	89	51%	0.512	50%	0.504	S	S	.	.	H	α-helix	trans	-58.8	-41.1	170.8	0	0	0	0	0	112.5	A78	A74-A78 WeakPolarHBondContact O-CB 2.98Å; A74-A78 PolarHBondContact O-N 3.18Å
75	K	77.5	Confident	71.6	Confident	164 Å²	164	89.4 Å²	89.4	71%	0.713	51%	0.511	S	S	*	.	H	α-helix	trans	-68.9	-39.4	177.7	-70.1	-168.7	177.7	-163.6	0	112.3	S72 D73 S79	S72-K75 PolarHBondContact O-N 3.27Å; D73-K75 VanDerWaalsContact C-N 3.32Å; D73-K75 PolarHBondContact O-N 3.38Å; K75-S79 PolarHBondContact O-N 3.26Å; K75-S79 VanDerWaalsContact O-N 3.14Å; K75-S79 PolarHBondContact O-OG 3.47Å
76	A	74.4	Confident	73.1	Confident	31 Å²	31	88.2 Å²	88.2	26%	0.256	50%	0.498	S	S	.	.	H	α-helix	trans	-58.2	-67	171.4	0	0	0	0	0	107.8	W57 S72 D73 A78 S79 G80	W57-A76 WeakPolarHBondContact CH2-O 3.33Å; W57-A76 VanDerWaalsContact CZ3-C 3.43Å; W57-A76 WeakPolarHBondContact CZ3-O 3.42Å; S72-A76 PolarHBondContact O-N 2.84Å; D73-A76 WeakPolarHBondContact O-CB 3.4Å; D73-A76 PolarHBondContact O-N 2.92Å; A76-A78 VanDerWaalsContact C-N 3.27Å; A76-A78 PolarHBondContact O-N 2.81Å; A76-S79 PolarHBondContact O-N 3.41Å; A76-S79 PolarHBondContact O-OG 3.49Å; A76-G80 PolarHBondContact O-N 3.08Å
77	I	76.6	Confident	74.5	Confident	95 Å²	95	84.3 Å²	84.3	49%	0.487	47%	0.47	S	S	.	.	H	α-helix	trans	-46.1	-48.6	-179.2	-63.9	163	0	0	0	112.5	D73 S79 G80 L81	D73-I77 WeakPolarHBondContact O-CB 3.48Å; D73-I77 WeakPolarHBondContact O-CD1 3.43Å; D73-I77 VanDerWaalsContact O-CG1 3.23Å; D73-I77 WeakPolarHBondContact O-CG1 3.47Å; D73-I77 PolarHBondContact O-N 3.25Å; I77-S79 PolarHBondContact O-N 2.86Å; I77-G80 PolarHBondContact O-N 2.94Å; I77-L81 HydrophobicContact CG2-CD1 4.03Å; I77-L81 HydrophobicContact CG2-CG 4.34Å; I77-L81 WeakPolarHBondContact O-CG 3.34Å; I77-L81 PolarHBondContact O-N 3.45Å
78	A	81.3	Confident	75.9	Confident	48 Å²	48	83.7 Å²	83.7	40%	0.397	47%	0.465	S	S	.	.	H	α-helix	trans	-58	-44.8	179	0	0	0	0	0	113	A74 A76 G80 I82	A74-A78 WeakPolarHBondContact O-CB 2.98Å; A74-A78 PolarHBondContact O-N 3.18Å; A76-A78 VanDerWaalsContact C-N 3.27Å; A76-A78 PolarHBondContact O-N 2.81Å; A78-G80 PolarHBondContact O-N 3.48Å; A78-I82 VanDerWaalsContact O-CG1 3.26Å; A78-I82 WeakPolarHBondContact O-CG1 3.37Å; A78-I82 PolarHBondContact O-N 3.38Å
79	S	81.6	Confident	77.6	Confident	52 Å²	52	79.6 Å²	79.6	36%	0.364	45%	0.449	S	S	.	.	H	α-helix	trans	-66.6	-22.3	178.1	41.7	0	0	0	0	113	W57 K75 A76 I77 I83	W57-S79 VanDerWaalsContact CH2-OG 3.24Å; W57-S79 WeakPolarHBondContact CH2-OG 3.35Å; K75-S79 PolarHBondContact O-N 3.26Å; K75-S79 VanDerWaalsContact O-N 3.14Å; K75-S79 PolarHBondContact O-OG 3.47Å; A76-S79 PolarHBondContact O-N 3.41Å; A76-S79 PolarHBondContact O-OG 3.49Å; I77-S79 PolarHBondContact O-N 2.86Å; S79-I83 WeakPolarHBondContact O-CD1 3.23Å; S79-I83 VanDerWaalsContact O-CG1 3.28Å; S79-I83 WeakPolarHBondContact O-CG1 3.09Å; S79-I83 PolarHBondContact O-N 3.22Å
80	G	82.1	Confident	78.9	Confident	8 Å²	8	76.4 Å²	76.4	8%	0.082	44%	0.441	C	S	.	.	H	α-helix	trans	-84.9	-41.2	-176.7	0	0	0	0	0	110.4	A76 I77 A78 I82 I83 C84	A76-G80 PolarHBondContact O-N 3.08Å; I77-G80 PolarHBondContact O-N 2.94Å; A78-G80 PolarHBondContact O-N 3.48Å; G80-I82 VanDerWaalsContact C-N 3.26Å; G80-I82 PolarHBondContact O-N 3Å; G80-I83 PolarHBondContact O-N 3.25Å; G80-C84 WeakPolarHBondContact O-CB 3.41Å; G80-C84 PolarHBondContact O-N 3.44Å; G80-C84 PolarHBondContact O-SG 3.26Å
81	L	82.9	Confident	80.1	Confident	104 Å²	104	76 Å²	76	55%	0.545	43%	0.429	S	S	.	.	H	α-helix	trans	-57	-43	167.5	-64.9	177.2	0	0	0	110.5	I77 C84 L85	I77-L81 HydrophobicContact CG2-CD1 4.03Å; I77-L81 HydrophobicContact CG2-CG 4.34Å; I77-L81 WeakPolarHBondContact O-CG 3.34Å; I77-L81 PolarHBondContact O-N 3.45Å; L81-C84 PolarHBondContact O-N 2.8Å; L81-L85 WeakPolarHBondContact O-CB 3.4Å; L81-L85 WeakPolarHBondContact O-CG 3.28Å; L81-L85 PolarHBondContact O-N 3.04Å
82	I	86.3	Confident	81.3	Confident	104 Å²	104	72 Å²	72	53%	0.533	42%	0.415	S	S	.	.	H	α-helix	trans	-60.3	-48	175.5	-68.8	165.6	0	0	0	111.2	A78 G80 C84 L85 V86	A78-I82 VanDerWaalsContact O-CG1 3.26Å; A78-I82 WeakPolarHBondContact O-CG1 3.37Å; A78-I82 PolarHBondContact O-N 3.38Å; G80-I82 VanDerWaalsContact C-N 3.26Å; G80-I82 PolarHBondContact O-N 3Å; I82-C84 PolarHBondContact O-N 2.96Å; I82-L85 PolarHBondContact O-N 3.44Å; I82-V86 HydrophobicContact CG2-CG2 4.41Å; I82-V86 WeakPolarHBondContact O-CG2 3.19Å; I82-V86 PolarHBondContact O-N 2.92Å
83	I	84.6	Confident	82.3	Confident	58 Å²	58	72.2 Å²	72.2	30%	0.297	42%	0.423	S	S	.	.	H	α-helix	trans	-62.9	-43.9	178.4	-66.5	162	0	0	0	110.9	I53 W57 S79 G80 L85 V86 V87	I53-I83 HydrophobicContact CD1-CG2 4.2Å; I53-I83 HydrophobicContact CG2-CD1 4.47Å; I53-I83 HydrophobicContact CG2-CG2 4.18Å; W57-I83 HydrophobicContact CZ2-CD1 3.88Å; S79-I83 WeakPolarHBondContact O-CD1 3.23Å; S79-I83 VanDerWaalsContact O-CG1 3.28Å; S79-I83 WeakPolarHBondContact O-CG1 3.09Å; S79-I83 PolarHBondContact O-N 3.22Å; G80-I83 PolarHBondContact O-N 3.25Å; I83-L85 VanDerWaalsContact C-N 3.32Å; I83-L85 PolarHBondContact O-N 2.85Å; I83-V86 PolarHBondContact O-N 3.21Å; I83-V87 HydrophobicContact CG2-CG2 4.34Å; I83-V87 WeakPolarHBondContact O-CG2 3.23Å; I83-V87 PolarHBondContact O-N 3.32Å
84	C	82.7	Confident	83	Confident	32 Å²	32	71.7 Å²	71.7	22%	0.216	42%	0.422	C	S	.	.	H	α-helix	trans	-60	-44.7	177.3	-67	0	0	0	0	111.1	F50 G80 L81 I82 V87 S88	F50-C84 HydrophobicContact CE2-CB 3.78Å; F50-C84 WeakPolarHBondContact CE2-SG 3.46Å; F50-C84 HydrophobicContact CZ-CB 4.41Å; G80-C84 WeakPolarHBondContact O-CB 3.41Å; G80-C84 PolarHBondContact O-N 3.44Å; G80-C84 PolarHBondContact O-SG 3.26Å; L81-C84 PolarHBondContact O-N 2.8Å; I82-C84 PolarHBondContact O-N 2.96Å; C84-V87 PolarHBondContact O-N 3.4Å; C84-S88 WeakPolarHBondContact O-CB 3.42Å; C84-S88 PolarHBondContact O-N 3.45Å; C84-S88 PolarHBondContact O-OG 3.23Å
85	L	87.7	Confident	83.4	Confident	109 Å²	109	71 Å²	71	57%	0.571	42%	0.416	S	S	*	.	H	α-helix	trans	-59.6	-49.5	175.8	-74.9	171.7	0	0	0	110.9	L81 I82 I83 V87 S88 C89	L81-L85 WeakPolarHBondContact O-CB 3.4Å; L81-L85 WeakPolarHBondContact O-CG 3.28Å; L81-L85 PolarHBondContact O-N 3.04Å; I82-L85 PolarHBondContact O-N 3.44Å; I83-L85 VanDerWaalsContact C-N 3.32Å; I83-L85 PolarHBondContact O-N 2.85Å; L85-V87 PolarHBondContact O-N 3.24Å; L85-S88 VanDerWaalsContact CA-OG 3.3Å; L85-S88 WeakPolarHBondContact CA-OG 3.44Å; L85-S88 PolarHBondContact O-N 3.3Å; L85-S88 PolarHBondContact O-OG 3.1Å; L85-C89 WeakPolarHBondContact O-CB 3.34Å; L85-C89 PolarHBondContact O-N 3.44Å; L85-C89 PolarHBondContact O-SG 2.9Å
86	V	87.2	Confident	83.8	Confident	85 Å²	85	68.1 Å²	68.1	52%	0.515	41%	0.407	S	S	.	.	H	α-helix	trans	-58.1	-47.3	178.1	175.1	0	0	0	0	111.3	I82 I83 S88 C89 V90	I82-V86 HydrophobicContact CG2-CG2 4.41Å; I82-V86 WeakPolarHBondContact O-CG2 3.19Å; I82-V86 PolarHBondContact O-N 2.92Å; I83-V86 PolarHBondContact O-N 3.21Å; V86-S88 PolarHBondContact O-N 2.84Å; V86-C89 PolarHBondContact O-N 3.04Å; V86-V90 WeakPolarHBondContact O-CG2 3.4Å; V86-V90 PolarHBondContact O-N 2.86Å
87	V	84	Confident	84.2	Confident	42 Å²	42	73.1 Å²	73.1	26%	0.255	42%	0.42	S	S	.	.	H	α-helix	trans	-62.9	-43.9	178.4	173.3	0	0	0	0	111.2	F50 I83 C84 L85 C89 V90 F91	F50-V87 HydrophobicContact CB-CG1 4.31Å; F50-V87 HydrophobicContact CD2-CB 4.21Å; F50-V87 HydrophobicContact CD2-CG1 3.98Å; F50-V87 HydrophobicContact CG-CG1 4.49Å; I83-V87 HydrophobicContact CG2-CG2 4.34Å; I83-V87 WeakPolarHBondContact O-CG2 3.23Å; I83-V87 PolarHBondContact O-N 3.32Å; C84-V87 PolarHBondContact O-N 3.4Å; L85-V87 PolarHBondContact O-N 3.24Å; V87-C89 VanDerWaalsContact C-N 3.34Å; V87-C89 PolarHBondContact O-N 3.49Å; V87-V90 PolarHBondContact O-N 3.06Å; V87-F91 WeakPolarHBondContact O-CB 3.37Å; V87-F91 PolarHBondContact O-N 2.85Å
88	S	85	Confident	84.4	Confident	49 Å²	49	71.2 Å²	71.2	34%	0.343	42%	0.415	S	S	.	.	H	α-helix	trans	-64.3	-37	176.8	58.7	0	0	0	0	112.5	C84 L85 V86 F91 I92	C84-S88 WeakPolarHBondContact O-CB 3.42Å; C84-S88 PolarHBondContact O-N 3.45Å; C84-S88 PolarHBondContact O-OG 3.23Å; L85-S88 VanDerWaalsContact CA-OG 3.3Å; L85-S88 WeakPolarHBondContact CA-OG 3.44Å; L85-S88 PolarHBondContact O-N 3.3Å; L85-S88 PolarHBondContact O-OG 3.1Å; V86-S88 PolarHBondContact O-N 2.84Å; S88-F91 PolarHBondContact O-N 2.98Å; S88-I92 WeakPolarHBondContact O-CB 3.26Å; S88-I92 WeakPolarHBondContact O-CD1 3.45Å; S88-I92 WeakPolarHBondContact O-CG1 3.44Å; S88-I92 PolarHBondContact O-N 3.25Å
89	C	88.1	Confident	84.5	Confident	84 Å²	84	73.7 Å²	73.7	57%	0.568	42%	0.421	S	S	*	.	H	α-helix	trans	-63.8	-43.1	173.4	-70.5	0	0	0	0	111.9	L85 V86 V87 G93	L85-C89 WeakPolarHBondContact O-CB 3.34Å; L85-C89 PolarHBondContact O-N 3.44Å; L85-C89 PolarHBondContact O-SG 2.9Å; V86-C89 PolarHBondContact O-N 3.04Å; V87-C89 VanDerWaalsContact C-N 3.34Å; V87-C89 PolarHBondContact O-N 3.49Å; C89-G93 PolarHBondContact O-N 3.25Å
90	V	85.8	Confident	84.5	Confident	82 Å²	82	77.3 Å²	77.3	50%	0.497	43%	0.433	S	S	.	.	H	α-helix	trans	-62.2	-46.1	175	172.3	0	0	0	0	110.3	V86 V87 G93 V94	V86-V90 WeakPolarHBondContact O-CG2 3.4Å; V86-V90 PolarHBondContact O-N 2.86Å; V87-V90 PolarHBondContact O-N 3.06Å; V90-G93 PolarHBondContact O-N 3.48Å; V90-V94 HydrophobicContact CG1-CG2 4.43Å; V90-V94 WeakPolarHBondContact O-CG2 3.33Å; V90-V94 PolarHBondContact O-N 3.35Å
91	F	84.3	Confident	84.4	Confident	104 Å²	104	80.8 Å²	80.8	46%	0.456	45%	0.447	S	S	.	.	H	α-helix	trans	-61.5	-46.2	178.8	-178.2	-95.5	0	0	0	112.2	I43 V87 S88 G93 V94 A95	I43-F91 HydrophobicContact CG2-CD2 4.21Å; I43-F91 HydrophobicContact CG2-CE2 3.67Å; V87-F91 WeakPolarHBondContact O-CB 3.37Å; V87-F91 PolarHBondContact O-N 2.85Å; S88-F91 PolarHBondContact O-N 2.98Å; F91-G93 VanDerWaalsContact C-N 3.34Å; F91-G93 PolarHBondContact O-N 3.49Å; F91-V94 PolarHBondContact O-N 2.92Å; F91-A95 WeakPolarHBondContact O-CB 3.3Å; F91-A95 PolarHBondContact O-N 2.88Å
92	I	87.4	Confident	84.2	Confident	94 Å²	94	78.9 Å²	78.9	48%	0.482	44%	0.442	S	S	.	.	H	α-helix	trans	-61.7	-43.6	175.6	-68.3	164.7	0	0	0	110.3	S88 V94 A95 I96	S88-I92 WeakPolarHBondContact O-CB 3.26Å; S88-I92 WeakPolarHBondContact O-CD1 3.45Å; S88-I92 WeakPolarHBondContact O-CG1 3.44Å; S88-I92 PolarHBondContact O-N 3.25Å; I92-V94 PolarHBondContact O-N 2.89Å; I92-A95 PolarHBondContact O-N 2.96Å; I92-I96 HydrophobicContact CG2-CD1 3.66Å; I92-I96 HydrophobicContact CG2-CG1 4.29Å; I92-I96 VanDerWaalsContact O-CG1 3.28Å; I92-I96 WeakPolarHBondContact O-CG1 3.39Å; I92-I96 PolarHBondContact O-N 3.47Å
93	G	86.6	Confident	83.8	Confident	40 Å²	40	78.4 Å²	78.4	41%	0.412	44%	0.44	S	S	.	.	H	α-helix	trans	-59.6	-45.5	176.9	0	0	0	0	0	112.5	C89 V90 F91 Y97	C89-G93 PolarHBondContact O-N 3.25Å; V90-G93 PolarHBondContact O-N 3.48Å; F91-G93 VanDerWaalsContact C-N 3.34Å; F91-G93 PolarHBondContact O-N 3.49Å; G93-Y97 VanDerWaalsContact O-CB 3.23Å; G93-Y97 WeakPolarHBondContact O-CB 3.49Å; G93-Y97 PolarHBondContact O-N 2.88Å
94	V	83.5	Confident	83.7	Confident	58 Å²	58	81.6 Å²	81.6	35%	0.352	45%	0.452	S	S	.	.	H	α-helix	trans	-63.9	-44	174.7	173	0	0	0	0	110.9	I43 V90 F91 I92 I96 Y97 C98	I43-V94 HydrophobicContact CD1-CG1 4.47Å; V90-V94 HydrophobicContact CG1-CG2 4.43Å; V90-V94 WeakPolarHBondContact O-CG2 3.33Å; V90-V94 PolarHBondContact O-N 3.35Å; F91-V94 PolarHBondContact O-N 2.92Å; I92-V94 PolarHBondContact O-N 2.89Å; V94-I96 PolarHBondContact O-N 2.87Å; V94-Y97 WeakPolarHBondContact O-CB 3.47Å; V94-Y97 PolarHBondContact O-N 2.88Å; V94-C98 WeakPolarHBondContact O-CB 3.33Å; V94-C98 PolarHBondContact O-N 2.91Å; V94-C98 PolarHBondContact O-SG 3.21Å
95	A	81.6	Confident	83.4	Confident	47 Å²	47	82.5 Å²	82.5	39%	0.388	46%	0.462	S	S	.	.	H	α-helix	trans	-62.1	-43.8	179.2	0	0	0	0	0	112.2	F91 I92 N99	F91-A95 WeakPolarHBondContact O-CB 3.3Å; F91-A95 PolarHBondContact O-N 2.88Å; I92-A95 PolarHBondContact O-N 2.96Å; A95-N99 WeakPolarHBondContact O-CB 3.49Å; A95-N99 PolarHBondContact O-N 2.86Å
96	I	86.1	Confident	82.9	Confident	104 Å²	104	82.2 Å²	82.2	53%	0.533	46%	0.46	S	S	.	.	H	α-helix	trans	-64	-45.4	175.1	-66.8	168.4	0	0	0	110.3	I92 V94 C98 N99 E100	I92-I96 HydrophobicContact CG2-CD1 3.66Å; I92-I96 HydrophobicContact CG2-CG1 4.29Å; I92-I96 VanDerWaalsContact O-CG1 3.28Å; I92-I96 WeakPolarHBondContact O-CG1 3.39Å; I92-I96 PolarHBondContact O-N 3.47Å; V94-I96 PolarHBondContact O-N 2.87Å; I96-C98 PolarHBondContact O-N 3.4Å; I96-N99 WeakPolarHBondContact O-CB 3.4Å; I96-N99 PolarHBondContact O-N 3.26Å; I96-E100 PolarHBondContact O-N 3Å
97	Y	82.9	Confident	82.8	Confident	136 Å²	136	80.5 Å²	80.5	53%	0.533	45%	0.454	S	S	.	.	H	α-helix	trans	-58.7	-48.3	177.8	179.4	-91.9	0	0	0	111.7	G93 V94 N99 E100 H101	G93-Y97 VanDerWaalsContact O-CB 3.23Å; G93-Y97 WeakPolarHBondContact O-CB 3.49Å; G93-Y97 PolarHBondContact O-N 2.88Å; V94-Y97 WeakPolarHBondContact O-CB 3.47Å; V94-Y97 PolarHBondContact O-N 2.88Å; Y97-N99 VanDerWaalsContact C-N 3.33Å; Y97-N99 PolarHBondContact O-N 3.32Å; Y97-E100 PolarHBondContact O-N 3.27Å; Y97-H101 AromaticContact CD1-ND1 3.97Å; Y97-H101 AromaticContact CD2-CE1 3.4Å; Y97-H101 VanDerWaalsContact CD2-CE1 3.4Å; Y97-H101 WeakPolarHBondContact CD2-CE1 3.34Å; Y97-H101 AromaticContact CD2-ND1 3.67Å; Y97-H101 AromaticContact CE1-ND1 3.85Å; Y97-H101 AromaticContact CE2-CE1 2.98Å; Y97-H101 WeakPolarHBondContact CE2-CE1 3.4Å; Y97-H101 AromaticContact CE2-ND1 3.56Å; Y97-H101 AromaticContact CE2-NE2 3.43Å; Y97-H101 WeakPolarHBondContact CE2-NE2 3.31Å; Y97-H101 AromaticContact CG-ND1 3.87Å; Y97-H101 AromaticContact CZ-CD2 3.79Å; Y97-H101 AromaticContact CZ-CE1 3.31Å; Y97-H101 AromaticContact CZ-CG 3.94Å; Y97-H101 AromaticContact CZ-ND1 3.63Å; Y97-H101 AromaticContact CZ-NE2 3.38Å; Y97-H101 WeakPolarHBondContact O-CB 3.49Å; Y97-H101 PolarHBondContact O-N 2.78Å; Y97-H101 PolarHBondContact O-ND1 3.49Å; Y97-H101 PolarHBondContact OH-NE2 3.38Å
98	C	80	Confident	82.8	Confident	56 Å²	56	84 Å²	84	38%	0.378	47%	0.469	S	S	.	.	H	α-helix	trans	-59.5	-43.6	175.1	-70.6	0	0	0	0	111.3	V94 I96 E100 H101 S102	V94-C98 WeakPolarHBondContact O-CB 3.33Å; V94-C98 PolarHBondContact O-N 2.91Å; V94-C98 PolarHBondContact O-SG 3.21Å; I96-C98 PolarHBondContact O-N 3.4Å; C98-E100 PolarHBondContact O-N 3.28Å; C98-H101 PolarHBondContact O-N 2.93Å; C98-S102 WeakPolarHBondContact O-CB 3.27Å; C98-S102 PolarHBondContact O-N 3.38Å; C98-S102 PolarHBondContact O-OG 3.36Å
99	N	83.8	Confident	82.8	Confident	99 Å²	99	86 Å²	86	53%	0.529	48%	0.48	S	S	.	.	H	α-helix	trans	-61.2	-44.4	179.7	-167.7	25	0	0	0	112.3	A95 I96 Y97 N103	A95-N99 WeakPolarHBondContact O-CB 3.49Å; A95-N99 PolarHBondContact O-N 2.86Å; I96-N99 WeakPolarHBondContact O-CB 3.4Å; I96-N99 PolarHBondContact O-N 3.26Å; Y97-N99 VanDerWaalsContact C-N 3.33Å; Y97-N99 PolarHBondContact O-N 3.32Å; N99-N103 WeakPolarHBondContact O-CB 3.3Å; N99-N103 PolarHBondContact O-N 3Å; N99-N103 VanDerWaalsContact O-N 3.15Å; N99-N103 PolarHBondContact O-ND2 2.99Å; N99-N103 PolarHBondContact OD1-ND2 3.11Å
100	E	82.8	Confident	82.9	Confident	129 Å²	129	86.2 Å²	86.2	60%	0.603	48%	0.478	S	S	*	.	H	α-helix	trans	-64.5	-46.7	177	-175.7	179.8	178.5	0	0	112.1	I96 Y97 C98 K104	I96-E100 PolarHBondContact O-N 3Å; Y97-E100 PolarHBondContact O-N 3.27Å; C98-E100 PolarHBondContact O-N 3.28Å; E100-K104 WeakPolarHBondContact O-CB 3.36Å; E100-K104 PolarHBondContact O-N 2.98Å; E100-K104 VanDerWaalsContact O-N 3.09Å
101	H	79.8	Confident	83.1	Confident	81 Å²	81	87.7 Å²	87.7	38%	0.375	48%	0.483	S	S	.	.	H	α-helix	trans	-71.6	-39.1	-175.6	-72.1	68.7	0	0	0	112	Y97 C98 K104 A105	Y97-H101 AromaticContact CD1-ND1 3.97Å; Y97-H101 AromaticContact CD2-CE1 3.4Å; Y97-H101 VanDerWaalsContact CD2-CE1 3.4Å; Y97-H101 WeakPolarHBondContact CD2-CE1 3.34Å; Y97-H101 AromaticContact CD2-ND1 3.67Å; Y97-H101 AromaticContact CE1-ND1 3.85Å; Y97-H101 AromaticContact CE2-CE1 2.98Å; Y97-H101 WeakPolarHBondContact CE2-CE1 3.4Å; Y97-H101 AromaticContact CE2-ND1 3.56Å; Y97-H101 AromaticContact CE2-NE2 3.43Å; Y97-H101 WeakPolarHBondContact CE2-NE2 3.31Å; Y97-H101 AromaticContact CG-ND1 3.87Å; Y97-H101 AromaticContact CZ-CD2 3.79Å; Y97-H101 AromaticContact CZ-CE1 3.31Å; Y97-H101 AromaticContact CZ-CG 3.94Å; Y97-H101 AromaticContact CZ-ND1 3.63Å; Y97-H101 AromaticContact CZ-NE2 3.38Å; Y97-H101 WeakPolarHBondContact O-CB 3.49Å; Y97-H101 PolarHBondContact O-N 2.78Å; Y97-H101 PolarHBondContact O-ND1 3.49Å; Y97-H101 PolarHBondContact OH-NE2 3.38Å; C98-H101 PolarHBondContact O-N 2.93Å; H101-K104 PolarHBondContact O-N 2.85Å; H101-A105 VanDerWaalsContact O-CB 3.24Å; H101-A105 WeakPolarHBondContact O-CB 3.38Å; H101-A105 PolarHBondContact O-N 3.23Å
102	S	77.4	Confident	83.5	Confident	63 Å²	63	84.3 Å²	84.3	44%	0.441	48%	0.478	S	S	.	.	H	α-helix	trans	-64.7	-44.6	175.7	-67.7	0	0	0	0	111.5	C98 K104 A105 I106	C98-S102 WeakPolarHBondContact O-CB 3.27Å; C98-S102 PolarHBondContact O-N 3.38Å; C98-S102 PolarHBondContact O-OG 3.36Å; S102-K104 VanDerWaalsContact C-N 3.35Å; S102-K104 PolarHBondContact O-N 3.28Å; S102-A105 PolarHBondContact O-N 2.84Å; S102-I106 WeakPolarHBondContact O-CB 3.47Å; S102-I106 WeakPolarHBondContact O-CD1 3.46Å; S102-I106 WeakPolarHBondContact O-CG1 3.2Å; S102-I106 PolarHBondContact O-N 3.46Å
103	N	79.1	Confident	83.6	Confident	94 Å²	94	84.2 Å²	84.2	50%	0.503	48%	0.482	S	S	.	.	H	α-helix	trans	-62.7	-43.2	178.3	-71.7	-13.2	0	0	0	111.7	N99 I106 A107	N99-N103 WeakPolarHBondContact O-CB 3.3Å; N99-N103 PolarHBondContact O-N 3Å; N99-N103 VanDerWaalsContact O-N 3.15Å; N99-N103 PolarHBondContact O-ND2 2.99Å; N99-N103 PolarHBondContact OD1-ND2 3.11Å; N103-I106 PolarHBondContact O-N 3.27Å; N103-A107 WeakPolarHBondContact O-CB 3.35Å; N103-A107 PolarHBondContact O-N 2.92Å
104	K	80.8	Confident	84	Confident	126 Å²	126	87 Å²	87	55%	0.548	49%	0.487	S	S	.	.	H	α-helix	trans	-64.9	-43.4	177.1	-171.6	176.1	-178.6	179.4	0	112.1	E100 H101 S102 A107 M108	E100-K104 WeakPolarHBondContact O-CB 3.36Å; E100-K104 PolarHBondContact O-N 2.98Å; E100-K104 VanDerWaalsContact O-N 3.09Å; H101-K104 PolarHBondContact O-N 2.85Å; S102-K104 VanDerWaalsContact C-N 3.35Å; S102-K104 PolarHBondContact O-N 3.28Å; K104-A107 PolarHBondContact O-N 3.23Å; K104-M108 HydrophobicContact CD-CE 4.12Å; K104-M108 HydrophobicContact CG-CE 3.81Å; K104-M108 HydrophobicContact CG-SD 4.28Å; K104-M108 VanDerWaalsContact O-CG 3.29Å; K104-M108 WeakPolarHBondContact O-CG 3.19Å; K104-M108 PolarHBondContact O-N 3.41Å
105	A	76.6	Confident	84.4	Confident	51 Å²	51	89.1 Å²	89.1	42%	0.421	50%	0.496	S	S	.	.	H	α-helix	trans	-63.1	-43.1	178.2	0	0	0	0	0	112	H101 S102 M108 T109	H101-A105 VanDerWaalsContact O-CB 3.24Å; H101-A105 WeakPolarHBondContact O-CB 3.38Å; H101-A105 PolarHBondContact O-N 3.23Å; S102-A105 PolarHBondContact O-N 2.84Å; A105-M108 PolarHBondContact O-N 2.8Å; A105-T109 WeakPolarHBondContact O-CB 3.19Å; A105-T109 PolarHBondContact O-N 3.4Å; A105-T109 PolarHBondContact O-OG1 2.96Å
106	I	78	Confident	85	Confident	103 Å²	103	92.1 Å²	92.1	53%	0.528	51%	0.505	S	S	.	.	H	α-helix	trans	-64.7	-46.2	177.2	-67.7	165.1	0	0	0	110.2	S102 N103 M108 T109 V110	S102-I106 WeakPolarHBondContact O-CB 3.47Å; S102-I106 WeakPolarHBondContact O-CD1 3.46Å; S102-I106 WeakPolarHBondContact O-CG1 3.2Å; S102-I106 PolarHBondContact O-N 3.46Å; N103-I106 PolarHBondContact O-N 3.27Å; I106-M108 PolarHBondContact O-N 3.25Å; I106-T109 PolarHBondContact O-N 3.3Å; I106-T109 VanDerWaalsContact O-N 3.12Å; I106-V110 HydrophobicContact CG2-CG2 4.36Å; I106-V110 WeakPolarHBondContact O-CG2 3.33Å; I106-V110 PolarHBondContact O-N 2.9Å
107	A	84.9	Confident	85.3	Confident	48 Å²	48	89.1 Å²	89.1	40%	0.397	50%	0.5	S	S	.	.	H	α-helix	trans	-57.3	-48	177.1	0	0	0	0	0	111.7	N103 K104 T109 V110 D111	N103-A107 WeakPolarHBondContact O-CB 3.35Å; N103-A107 PolarHBondContact O-N 2.92Å; K104-A107 PolarHBondContact O-N 3.23Å; A107-T109 VanDerWaalsContact C-N 3.26Å; A107-T109 PolarHBondContact O-N 2.87Å; A107-V110 PolarHBondContact O-N 3.43Å; A107-D111 PolarHBondContact O-N 3.37Å
108	M	85.1	Confident	85.8	Confident	115 Å²	115	88.2 Å²	88.2	57%	0.567	50%	0.5	S	S	*	.	H	α-helix	trans	-61.4	-34.2	176.7	-71.9	175.9	173.5	0	0	113.2	K104 A105 I106 G112	K104-M108 HydrophobicContact CD-CE 4.12Å; K104-M108 HydrophobicContact CG-CE 3.81Å; K104-M108 HydrophobicContact CG-SD 4.28Å; K104-M108 VanDerWaalsContact O-CG 3.29Å; K104-M108 WeakPolarHBondContact O-CG 3.19Å; K104-M108 PolarHBondContact O-N 3.41Å; A105-M108 PolarHBondContact O-N 2.8Å; I106-M108 PolarHBondContact O-N 3.25Å; M108-G112 PolarHBondContact O-N 3.34Å
109	T	84.3	Confident	86.4	Confident	92 Å²	92	88.9 Å²	88.9	56%	0.564	50%	0.498	S	S	*	.	H	α-helix	trans	-71.8	-42.3	178.5	-56.6	0	0	0	0	110.7	A105 I106 A107 G112 V113	A105-T109 WeakPolarHBondContact O-CB 3.19Å; A105-T109 PolarHBondContact O-N 3.4Å; A105-T109 PolarHBondContact O-OG1 2.96Å; I106-T109 PolarHBondContact O-N 3.3Å; I106-T109 VanDerWaalsContact O-N 3.12Å; A107-T109 VanDerWaalsContact C-N 3.26Å; A107-T109 PolarHBondContact O-N 2.87Å; T109-G112 PolarHBondContact O-N 2.86Å; T109-V113 VanDerWaalsContact O-CG2 3.27Å; T109-V113 WeakPolarHBondContact O-CG2 3.16Å; T109-V113 PolarHBondContact O-N 3.41Å
110	V	90.3	Very high	86.8	Confident	89 Å²	89	90 Å²	90	54%	0.539	50%	0.503	S	S	.	.	H	α-helix	trans	-62.7	-46.4	175.9	172.4	0	0	0	0	110.5	I106 A107 G112 V113 D114	I106-V110 HydrophobicContact CG2-CG2 4.36Å; I106-V110 WeakPolarHBondContact O-CG2 3.33Å; I106-V110 PolarHBondContact O-N 2.9Å; A107-V110 PolarHBondContact O-N 3.43Å; V110-G112 VanDerWaalsContact C-N 3.33Å; V110-G112 PolarHBondContact O-N 3.28Å; V110-V113 PolarHBondContact O-N 2.89Å; V110-D114 PolarHBondContact O-N 3.42Å
111	D	90	Very high	87.2	Confident	112 Å²	112	87 Å²	87	60%	0.599	50%	0.5	S	S	*	.	H	α-helix	trans	-60.6	-42.2	177	-69	-17.3	0	0	0	111.6	A107 D114 D115	A107-D111 PolarHBondContact O-N 3.37Å; D111-D114 PolarHBondContact O-N 3.44Å; D111-D115 PolarHBondContact O-N 3.49Å
112	G	91.4	Very high	87.7	Confident	33 Å²	33	89.3 Å²	89.3	34%	0.34	51%	0.506	S	S	.	.	H	α-helix	trans	-65.7	-36.3	176.8	0	0	0	0	0	113.5	M108 T109 V110 L116	M108-G112 PolarHBondContact O-N 3.34Å; T109-G112 PolarHBondContact O-N 2.86Å; V110-G112 VanDerWaalsContact C-N 3.33Å; V110-G112 PolarHBondContact O-N 3.28Å; G112-L116 WeakPolarHBondContact O-CB 3.17Å; G112-L116 WeakPolarHBondContact O-CD1 3.35Å; G112-L116 VanDerWaalsContact O-CG 3.24Å; G112-L116 WeakPolarHBondContact O-CG 3.21Å; G112-L116 PolarHBondContact O-N 2.82Å; G112-L116 VanDerWaalsContact O-N 3.11Å
113	V	91.5	Very high	88.3	Confident	93 Å²	93	92 Å²	92	56%	0.564	51%	0.509	S	S	*	.	H	α-helix	trans	-70	-38.1	176.1	169.7	0	0	0	0	111.4	T109 V110 L116 G117	T109-V113 VanDerWaalsContact O-CG2 3.27Å; T109-V113 WeakPolarHBondContact O-CG2 3.16Å; T109-V113 PolarHBondContact O-N 3.41Å; V110-V113 PolarHBondContact O-N 2.89Å; V113-L116 PolarHBondContact O-N 3.25Å; V113-G117 PolarHBondContact O-N 3.23Å
114	D	92.9	Very high	88.8	Confident	97 Å²	97	89.8 Å²	89.8	52%	0.519	51%	0.509	S	S	.	.	H	α-helix	trans	-64.5	-46.3	176.7	-166.4	-107.8	0	0	0	111.3	V110 D111 L116 G117 H118	V110-D114 PolarHBondContact O-N 3.42Å; D111-D114 PolarHBondContact O-N 3.44Å; D114-L116 PolarHBondContact O-N 3.31Å; D114-G117 WeakPolarHBondContact O-CA 3.43Å; D114-G117 PolarHBondContact O-N 3.26Å; D114-G117 VanDerWaalsContact O-N 3.09Å; D114-H118 PolarHBondContact O-CD2 3.5Å; D114-H118 VanDerWaalsContact O-CD2 3.23Å; D114-H118 PolarHBondContact O-N 2.92Å; D114-H118 IonicContact OD1-CD2 3.32Å; D114-H118 PolarHBondContact OD1-CD2 3.07Å; D114-H118 IonicContact OD1-NE2 3.46Å; D114-H118 PolarHBondContact OD1-NE2 2.79Å
115	D	93.5	Very high	89.1	Confident	104 Å²	104	90.6 Å²	90.6	56%	0.556	51%	0.514	S	S	*	.	H	α-helix	trans	-60	-43.3	175.8	-170.9	65	0	0	0	112.2	D111 G117 H118 E119	D111-D115 PolarHBondContact O-N 3.49Å; D115-G117 VanDerWaalsContact C-N 3.34Å; D115-G117 PolarHBondContact O-N 3.27Å; D115-H118 PolarHBondContact O-N 3.06Å; D115-E119 PolarHBondContact O-N 3.26Å
116	L	93.2	Very high	89.4	Confident	110 Å²	110	92.6 Å²	92.6	58%	0.576	51%	0.514	S	S	*	.	H	α-helix	trans	-61.4	-41.3	173.3	-75	167.1	0	0	0	112.1	G112 V113 D114 H118 E119 L120	G112-L116 WeakPolarHBondContact O-CB 3.17Å; G112-L116 WeakPolarHBondContact O-CD1 3.35Å; G112-L116 VanDerWaalsContact O-CG 3.24Å; G112-L116 WeakPolarHBondContact O-CG 3.21Å; G112-L116 PolarHBondContact O-N 2.82Å; G112-L116 VanDerWaalsContact O-N 3.11Å; V113-L116 PolarHBondContact O-N 3.25Å; D114-L116 PolarHBondContact O-N 3.31Å; L116-H118 VanDerWaalsContact C-N 3.35Å; L116-E119 PolarHBondContact O-N 2.94Å; L116-L120 WeakPolarHBondContact O-CB 3.39Å; L116-L120 VanDerWaalsContact O-CG 3.24Å; L116-L120 WeakPolarHBondContact O-CG 3.47Å; L116-L120 PolarHBondContact O-N 3.42Å
117	G	93.8	Very high	89.7	Confident	40 Å²	40	91.2 Å²	91.2	41%	0.412	51%	0.51	S	S	.	.	H	α-helix	trans	-61.4	-42.7	175.5	0	0	0	0	0	112.3	V113 D114 D115 L120 A121	V113-G117 PolarHBondContact O-N 3.23Å; D114-G117 WeakPolarHBondContact O-CA 3.43Å; D114-G117 PolarHBondContact O-N 3.26Å; D114-G117 VanDerWaalsContact O-N 3.09Å; D115-G117 VanDerWaalsContact C-N 3.34Å; D115-G117 PolarHBondContact O-N 3.27Å; G117-L120 PolarHBondContact O-N 3.34Å; G117-A121 WeakPolarHBondContact O-CB 3.26Å; G117-A121 PolarHBondContact O-N 2.88Å
118	H	91.9	Very high	89.4	Confident	118 Å²	118	92.3 Å²	92.3	55%	0.546	51%	0.513	S	S	.	.	H	α-helix	trans	-65.8	-44.2	176.5	-82.9	-67	0	0	0	112.9	D114 D115 L116 A121 R122	D114-H118 PolarHBondContact O-CD2 3.5Å; D114-H118 VanDerWaalsContact O-CD2 3.23Å; D114-H118 PolarHBondContact O-N 2.92Å; D114-H118 IonicContact OD1-CD2 3.32Å; D114-H118 PolarHBondContact OD1-CD2 3.07Å; D114-H118 IonicContact OD1-NE2 3.46Å; D114-H118 PolarHBondContact OD1-NE2 2.79Å; D115-H118 PolarHBondContact O-N 3.06Å; L116-H118 VanDerWaalsContact C-N 3.35Å; H118-A121 PolarHBondContact O-N 2.82Å; H118-R122 WeakPolarHBondContact O-CB 3.48Å; H118-R122 PolarHBondContact O-N 3.46Å
119	E	92.7	Very high	89	Confident	70 Å²	70	93 Å²	93	33%	0.327	52%	0.516	S	S	.	.	H	α-helix	trans	-65.6	-39.7	175.9	-77.2	-67.5	128.8	0	0	111.4	D115 L116 A121 R122 F123	D115-E119 PolarHBondContact O-N 3.26Å; L116-E119 PolarHBondContact O-N 2.94Å; E119-A121 PolarHBondContact O-N 3.06Å; E119-R122 WeakPolarHBondContact O-CB 3.19Å; E119-R122 PolarHBondContact O-N 3.01Å; E119-R122 IonicContact OE1-NH1 3.16Å; E119-R122 PolarHBondContact OE1-NH1 3.03Å; E119-R122 VanDerWaalsContact OE1-NH1 3.16Å; E119-F123 WeakPolarHBondContact O-CD2 3.23Å; E119-F123 PolarHBondContact O-N 3.44Å
120	L	92.8	Very high	88.7	Confident	122 Å²	122	92.7 Å²	92.7	64%	0.639	51%	0.511	S	S	*	.	H	α-helix	trans	-61.7	-43.6	173.8	-76.4	169.5	0	0	0	112.4	L116 G117 R122 F123 G124	L116-L120 WeakPolarHBondContact O-CB 3.39Å; L116-L120 VanDerWaalsContact O-CG 3.24Å; L116-L120 WeakPolarHBondContact O-CG 3.47Å; L116-L120 PolarHBondContact O-N 3.42Å; G117-L120 PolarHBondContact O-N 3.34Å; L120-R122 VanDerWaalsContact C-N 3.3Å; L120-R122 PolarHBondContact O-N 2.88Å; L120-F123 PolarHBondContact O-N 2.86Å; L120-G124 PolarHBondContact O-N 2.96Å
121	A	91.4	Very high	88.1	Confident	65 Å²	65	96.6 Å²	96.6	54%	0.537	52%	0.517	S	S	.	.	H	α-helix	trans	-61	-41.3	174.7	0	0	0	0	0	111.4	G117 H118 E119 G124 E125	G117-A121 WeakPolarHBondContact O-CB 3.26Å; G117-A121 PolarHBondContact O-N 2.88Å; H118-A121 PolarHBondContact O-N 2.82Å; E119-A121 PolarHBondContact O-N 3.06Å; A121-G124 PolarHBondContact O-N 3.04Å; A121-E125 PolarHBondContact O-N 3.39Å
122	R	90.7	Very high	87.4	Confident	131 Å²	131	98.2 Å²	98.2	49%	0.494	52%	0.519	S	S	.	.	H	α-helix	trans	-64.7	-40.4	176.6	-172	-175.9	-170.8	-169.9	4.6	112.9	H118 E119 L120 E125 K126	H118-R122 WeakPolarHBondContact O-CB 3.48Å; H118-R122 PolarHBondContact O-N 3.46Å; E119-R122 WeakPolarHBondContact O-CB 3.19Å; E119-R122 PolarHBondContact O-N 3.01Å; E119-R122 IonicContact OE1-NH1 3.16Å; E119-R122 PolarHBondContact OE1-NH1 3.03Å; E119-R122 VanDerWaalsContact OE1-NH1 3.16Å; L120-R122 VanDerWaalsContact C-N 3.3Å; L120-R122 PolarHBondContact O-N 2.88Å; R122-E125 PolarHBondContact O-N 3.26Å; R122-K126 WeakPolarHBondContact O-CG 3.42Å; R122-K126 PolarHBondContact O-N 2.85Å; R122-K126 VanDerWaalsContact O-N 3.15Å
123	F	88.9	Confident	87	Confident	119 Å²	119	104.4 Å²	104.4	52%	0.522	54%	0.537	S	S	.	.	H	α-helix	trans	-64.3	-44	171.8	-79.3	-67.9	0	0	0	110.8	E119 L120 E125 K126 V127	E119-F123 WeakPolarHBondContact O-CD2 3.23Å; E119-F123 PolarHBondContact O-N 3.44Å; L120-F123 PolarHBondContact O-N 2.86Å; F123-E125 VanDerWaalsContact C-N 3.25Å; F123-E125 PolarHBondContact O-N 3.22Å; F123-K126 PolarHBondContact O-N 3.26Å; F123-V127 WeakPolarHBondContact O-CG2 2.82Å; F123-V127 PolarHBondContact O-N 2.93Å; F123-V127 VanDerWaalsContact O-N 3.12Å
124	G	89.4	Confident	86.3	Confident	47 Å²	47	109 Å²	109	49%	0.485	55%	0.545	S	S	.	.	H	α-helix	trans	-57.3	-34.1	176.3	0	0	0	0	0	114	L120 A121 P128	L120-G124 PolarHBondContact O-N 2.96Å; A121-G124 PolarHBondContact O-N 3.04Å; G124-P128 WeakPolarHBondContact O-CD 3.49Å
125	E	87	Confident	85.6	Confident	143 Å²	143	109.4 Å²	109.4	67%	0.668	56%	0.556	S	S	*	*	H	α-helix	trans	-79	-36.7	176.3	-172.6	178.6	146.7	0	0	113.4	A121 R122 F123 P128	A121-E125 PolarHBondContact O-N 3.39Å; R122-E125 PolarHBondContact O-N 3.26Å; F123-E125 VanDerWaalsContact C-N 3.25Å; F123-E125 PolarHBondContact O-N 3.22Å; E125-P128 VanDerWaalsContact O-CD 3.25Å; E125-P128 WeakPolarHBondContact O-CD 2.94Å; E125-P128 VanDerWaalsContact O-CG 3.28Å; E125-P128 WeakPolarHBondContact O-CG 3.24Å
126	K	84	Confident	85	Confident	94 Å²	94	111 Å²	111	41%	0.409	56%	0.563	S	S	.	*	H	α-helix	trans	-67.9	-39.3	179	-75.8	176.9	-179.3	173.7	0	112.7	R122 F123 M129 D130	R122-K126 WeakPolarHBondContact O-CG 3.42Å; R122-K126 PolarHBondContact O-N 2.85Å; R122-K126 VanDerWaalsContact O-N 3.15Å; F123-K126 PolarHBondContact O-N 3.26Å; K126-M129 PolarHBondContact O-N 2.8Å; K126-M129 VanDerWaalsContact O-N 3.16Å; K126-D130 PolarHBondContact O-N 3.27Å
127	V	84.1	Confident	83.9	Confident	73 Å²	73	111.7 Å²	111.7	44%	0.442	60%	0.597	S	S	.	*	H	α-helix	trans	-52.6	-53.8	-178.1	171.8	0	0	0	0	112.8	F123 M129 D130 Y131	F123-V127 WeakPolarHBondContact O-CG2 2.82Å; F123-V127 PolarHBondContact O-N 2.93Å; F123-V127 VanDerWaalsContact O-N 3.12Å; V127-M129 PolarHBondContact O-N 3.14Å; V127-D130 PolarHBondContact O-N 2.89Å; V127-Y131 HydrophobicContact CG1-CD2 3.77Å; V127-Y131 HydrophobicContact CG1-CE2 3.4Å; V127-Y131 WeakPolarHBondContact O-CD2 3.5Å; V127-Y131 PolarHBondContact O-N 3.2Å; V127-Y131 VanDerWaalsContact O-N 3.11Å
128	P	79.2	Confident	83.4	Confident	71 Å²	71	115.3 Å²	115.3	46%	0.461	61%	0.607	S	S	.	*	H	α-helix	trans	-66.3	-33.6	177.9	25.2	-34	0	0	0	113.4	G124 E125 Y131 F132	G124-P128 WeakPolarHBondContact O-CD 3.49Å; E125-P128 VanDerWaalsContact O-CD 3.25Å; E125-P128 WeakPolarHBondContact O-CD 2.94Å; E125-P128 VanDerWaalsContact O-CG 3.28Å; E125-P128 WeakPolarHBondContact O-CG 3.24Å; P128-Y131 PolarHBondContact O-N 3.26Å; P128-F132 WeakPolarHBondContact O-CB 3.19Å; P128-F132 PolarHBondContact O-N 3.26Å
129	M	75.7	Confident	82.9	Confident	130 Å²	130	115.1 Å²	115.1	64%	0.64	61%	0.61	S	S	*	*	H	α-helix	trans	-65.9	-40.4	177.3	-70.2	-62.1	-68.8	0	0	112	K126 V127 F132 K133	K126-M129 PolarHBondContact O-N 2.8Å; K126-M129 VanDerWaalsContact O-N 3.16Å; V127-M129 PolarHBondContact O-N 3.14Å; M129-F132 PolarHBondContact O-N 3.39Å; M129-K133 WeakPolarHBondContact O-CB 3.39Å; M129-K133 PolarHBondContact O-N 3.02Å
130	D	78.1	Confident	82.4	Confident	86 Å²	86	117.6 Å²	117.6	46%	0.46	63%	0.625	S	S	.	*	H	α-helix	trans	-65.1	-46.7	174.1	-76.8	-32.2	0	0	0	110.5	K126 V127 F132 K133 Y134	K126-D130 PolarHBondContact O-N 3.27Å; V127-D130 PolarHBondContact O-N 2.89Å; D130-F132 VanDerWaalsContact C-N 3.3Å; D130-F132 PolarHBondContact O-N 2.86Å; D130-K133 PolarHBondContact O-N 3.35Å; D130-K133 VanDerWaalsContact O-N 3.14Å; D130-Y134 HydrophobicContact CB-CD2 4.47Å; D130-Y134 HydrophobicContact CB-CE2 4.46Å; D130-Y134 WeakPolarHBondContact O-CD2 3.28Å; D130-Y134 PolarHBondContact O-N 3.46Å
131	Y	76.9	Confident	81.8	Confident	170 Å²	170	117.4 Å²	117.4	67%	0.667	63%	0.625	S	S	*	*	H	α-helix	trans	-57	-41.7	175.4	-78.2	-65.9	0	0	0	112.8	V127 P128 Y134 S135	V127-Y131 HydrophobicContact CG1-CD2 3.77Å; V127-Y131 HydrophobicContact CG1-CE2 3.4Å; V127-Y131 WeakPolarHBondContact O-CD2 3.5Å; V127-Y131 PolarHBondContact O-N 3.2Å; V127-Y131 VanDerWaalsContact O-N 3.11Å; P128-Y131 PolarHBondContact O-N 3.26Å; Y131-Y134 PolarHBondContact O-N 3.35Å; Y131-S135 PolarHBondContact O-N 3.3Å; Y131-S135 VanDerWaalsContact O-N 3.08Å
132	F	77	Confident	81.2	Confident	147 Å²	147	120.6 Å²	120.6	65%	0.645	63%	0.63	S	S	*	*	H	α-helix	trans	-66.2	-39.1	178	-150.1	-91.3	0	0	0	111.9	P128 M129 D130 S135 L136	P128-F132 WeakPolarHBondContact O-CB 3.19Å; P128-F132 PolarHBondContact O-N 3.26Å; M129-F132 PolarHBondContact O-N 3.39Å; D130-F132 VanDerWaalsContact C-N 3.3Å; D130-F132 PolarHBondContact O-N 2.86Å; F132-S135 PolarHBondContact O-N 2.77Å; F132-L136 HydrophobicContact CD1-CD1 3.7Å; F132-L136 HydrophobicContact CE1-CD1 3.76Å; F132-L136 PolarHBondContact O-N 3.09Å
133	K	81.2	Confident	80.5	Confident	162 Å²	162	119.9 Å²	119.9	70%	0.704	64%	0.639	S	S	*	*	H	α-helix	trans	-67.8	-38.8	176.7	-167.3	179.5	179.7	-175	0	112.3	M129 D130 S135 L136	M129-K133 WeakPolarHBondContact O-CB 3.39Å; M129-K133 PolarHBondContact O-N 3.02Å; D130-K133 PolarHBondContact O-N 3.35Å; D130-K133 VanDerWaalsContact O-N 3.14Å; K133-S135 VanDerWaalsContact C-N 3.34Å; K133-L136 PolarHBondContact O-N 2.8Å
134	Y	77.2	Confident	79.9	Confident	190 Å²	190	120 Å²	120	75%	0.745	65%	0.648	S	S	*	*	H	α-helix	trans	-68	-30.6	174.6	-82.2	-73	0	0	0	113	D130 Y131 L136	D130-Y134 HydrophobicContact CB-CD2 4.47Å; D130-Y134 HydrophobicContact CB-CE2 4.46Å; D130-Y134 WeakPolarHBondContact O-CD2 3.28Å; D130-Y134 PolarHBondContact O-N 3.46Å; Y131-Y134 PolarHBondContact O-N 3.35Å; Y134-L136 VanDerWaalsContact C-N 3.32Å
135	S	79.6	Confident	79.2	Confident	105 Å²	105	125.6 Å²	125.6	73%	0.734	66%	0.66	S	S	*	*	H	α-helix	trans	-79.5	-11.9	179.7	-163.7	0	0	0	0	114.2	Y131 F132 K133	Y131-S135 PolarHBondContact O-N 3.3Å; Y131-S135 VanDerWaalsContact O-N 3.08Å; F132-S135 PolarHBondContact O-N 2.77Å; K133-S135 VanDerWaalsContact C-N 3.34Å
136	L	79.5	Confident	78.6	Confident	137 Å²	137	124.2 Å²	124.2	72%	0.717	66%	0.659	S	S	*	*	T	Hydrogen-bonded Turn	trans	-100.2	-7.9	-179.9	-77.7	168	0	0	0	113.9	F132 K133 Y134	F132-L136 HydrophobicContact CD1-CD1 3.7Å; F132-L136 HydrophobicContact CE1-CD1 3.76Å; F132-L136 PolarHBondContact O-N 3.09Å; K133-L136 PolarHBondContact O-N 2.8Å; Y134-L136 VanDerWaalsContact C-N 3.32Å
137	G	70.2	Confident	78.1	Confident	125 Å²	125	126.9 Å²	126.9	100%	1.289	68%	0.682	S	S	*	*			trans	-101.3	0	176.5	0	0	0	0	0	111.9

Retrieved 137 of 137 residues in 35.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).