A0A077ZNQ9_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZNQ9, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 135 aa.

						>A0A077ZNQ9_TRITR|A0A077ZNQ9
RVWCGVSWCGAVWCGVAGYAPAYGLGQCDVSVAWRDVAWRDVTWRDVAWRDVAWRDVAWRGAARYGLAWRRVAQHGVVWGNVVWGNVVWGAWWSARFVWCGVRCVVGCGVDPWCSDKLTTAQRRYHFTYKEIKRI
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	R	27	Very low	26.4	Very low	298 Å²	298	147.2 Å²	147.2	100%	1.125	83%	0.832	S	S	*	*				0	116	0	-69.8	-179.6	-175.2	174.3	1.5	106.6
2	V	20.8	Very low	26.7	Very low	126 Å²	126	146.5 Å²	146.5	76%	0.764	83%	0.833	S	S	*	*			trans	-94.6	111.9	-176.2	174.6	0	0	0	0	107.6
3	W	23.6	Very low	26.7	Very low	249 Å²	249	153.5 Å²	153.5	94%	0.943	84%	0.838	S	S	*	*			trans	-137.1	120.8	163.4	-81.7	74.5	0	0	0	110.1
4	C	25.3	Very low	27.2	Very low	111 Å²	111	151.6 Å²	151.6	75%	0.75	84%	0.839	S	S	*	*	P	Polyproline II helix	trans	-72.7	144.7	-176.7	-68.9	0	0	0	0	111.7
5	G	25.6	Very low	27.5	Very low	79 Å²	79	146.5 Å²	146.5	81%	0.814	84%	0.836	S	S	*	*	P	Polyproline II helix	trans	-66.3	142.6	171.8	0	0	0	0	0	112
6	V	28.6	Very low	27.9	Very low	138 Å²	138	146.4 Å²	146.4	84%	0.836	84%	0.838	S	S	*	*	P	Polyproline II helix	trans	-94.1	116.3	172.8	-173.6	0	0	0	0	107.4
7	S	24.9	Very low	28.2	Very low	108 Å²	108	143.5 Å²	143.5	76%	0.755	84%	0.836	S	S	*	*			trans	-105.2	119.5	169.2	66.9	0	0	0	0	109.4
8	W	25.8	Very low	28.5	Very low	228 Å²	228	138.2 Å²	138.2	86%	0.864	82%	0.817	S	S	*	*			trans	-99.8	120.7	173.7	-160.5	-51.3	0	0	0	109.8
9	C	28.6	Very low	28.9	Very low	118 Å²	118	143.1 Å²	143.1	80%	0.797	82%	0.822	S	S	*	*			trans	-93.9	114.8	170.4	-73.5	0	0	0	0	110.7
10	G	29.7	Very low	29.2	Very low	73 Å²	73	140.9 Å²	140.9	75%	0.753	82%	0.822	S	S	*	*			trans	46.5	109.5	145.8	0	0	0	0	0	120.7
11	A	31	Very low	29.6	Very low	91 Å²	91	140.4 Å²	140.4	75%	0.752	82%	0.823	S	S	*	*	P	Polyproline II helix	trans	-104	125.1	155.1	0	0	0	0	0	109.5
12	V	29.8	Very low	29.9	Very low	139 Å²	139	129.8 Å²	129.8	84%	0.842	80%	0.799	S	S	*	*	P	Polyproline II helix	trans	-102.7	131.1	177.1	176.7	0	0	0	0	108.6
13	W	26.7	Very low	30.5	Very low	237 Å²	237	134.3 Å²	134.3	90%	0.898	80%	0.804	S	S	*	*	P	Polyproline II helix	trans	-103.3	136.1	179.2	-95.1	33.2	0	0	0	111.3
14	C	33.1	Very low	30.8	Very low	127 Å²	127	125.7 Å²	125.7	86%	0.858	79%	0.792	S	S	*	*			trans	-130.8	128.3	158.5	-76	0	0	0	0	109.1
15	G	31.8	Very low	31	Very low	76 Å²	76	128.9 Å²	128.9	78%	0.784	80%	0.801	S	S	*	*			trans	-79.1	166.6	-168.7	0	0	0	0	0	115.1
16	V	34	Very low	31.2	Very low	144 Å²	144	128.5 Å²	128.5	87%	0.873	80%	0.797	S	S	*	*			trans	-125.9	117.1	170.2	178	0	0	0	0	108.2
17	A	34	Very low	31.4	Very low	97 Å²	97	130.2 Å²	130.2	80%	0.802	80%	0.796	S	S	*	*			trans	-89.6	131.1	159.4	0	0	0	0	0	107.2
18	G	33.2	Very low	31.6	Very low	49 Å²	49	131.2 Å²	131.2	51%	0.505	80%	0.802	S	S	.	*			trans	-133.8	132	174.5	0	0	0	0	0	110.2
19	Y	36.1	Very low	31.9	Very low	230 Å²	230	126.5 Å²	126.5	90%	0.902	79%	0.793	S	S	*	*			trans	-157.3	148.8	147.5	-40.6	-81.3	0	0	0	109.4
20	A	34.5	Very low	32	Very low	99 Å²	99	127.2 Å²	127.2	82%	0.818	79%	0.793	S	S	*	*			trans	97.8	103.6	162.2	0	0	0	0	0	117.5
21	P	36.7	Very low	32	Very low	132 Å²	132	128.7 Å²	128.7	86%	0.857	79%	0.792	S	S	*	*			trans	-93.5	132.4	171.2	35.3	-26.3	0	0	0	110.4
22	A	34.5	Very low	32.1	Very low	74 Å²	74	128.9 Å²	128.9	61%	0.612	78%	0.784	S	S	*	*			trans	-162.9	132.1	155.8	0	0	0	0	0	109.3
23	Y	33.1	Very low	32	Very low	221 Å²	221	126.2 Å²	126.2	87%	0.867	78%	0.777	S	S	*	*	S	Bend	trans	57.5	114.9	164.6	68.6	-90.8	0	0	0	119.2
24	G	29.3	Very low	32.2	Very low	68 Å²	68	125.9 Å²	125.9	70%	0.701	78%	0.775	S	S	*	*			trans	76.3	125.5	135.9	0	0	0	0	0	118.2
25	L	30.7	Very low	32	Very low	179 Å²	179	130 Å²	130	94%	0.937	77%	0.773	S	S	*	*			trans	84.6	95	159.1	-48.8	171.3	0	0	0	116
26	G	30.1	Very low	32.2	Very low	70 Å²	70	133.4 Å²	133.4	72%	0.722	77%	0.773	S	S	*	*			trans	56.7	88.1	130.9	0	0	0	0	0	118.1
27	Q	33	Very low	32.1	Very low	175 Å²	175	131.8 Å²	131.8	82%	0.818	76%	0.763	S	S	*	*			trans	-155.1	122.8	142	-114.3	140.5	21.6	0	0	110.9	D29	Q27-D29 PolarHBondContact O-N 2.95Å; Q27-D29 VanDerWaalsContact C-N 3.25Å
28	C	27.8	Very low	31.9	Very low	129 Å²	129	131.2 Å²	131.2	87%	0.872	76%	0.758	S	S	*	*			trans	-79.8	74	176.7	-49.5	0	0	0	0	108.3	V30	C28-V30 PolarHBondContact O-N 2.91Å
29	D	32.8	Very low	31.8	Very low	129 Å²	129	138.7 Å²	138.7	69%	0.69	77%	0.771	S	S	*	*			trans	-84.9	99.3	172.6	-82.3	-43.3	0	0	0	109.7	Q27 S31	Q27-D29 PolarHBondContact O-N 2.95Å; Q27-D29 VanDerWaalsContact C-N 3.25Å; D29-S31 PolarHBondContact O-N 3.26Å
30	V	31	Very low	31.5	Very low	132 Å²	132	137.8 Å²	137.8	80%	0.8	77%	0.767	S	S	*	*			trans	-68.2	84.3	161.8	-178.1	0	0	0	0	107	C28 V32	C28-V30 PolarHBondContact O-N 2.91Å; V30-V32 PolarHBondContact O-N 2.98Å; V30-V32 HydrophobicContact CG1-CG2 4.32Å
31	S	29.6	Very low	31.6	Very low	105 Å²	105	139.3 Å²	139.3	73%	0.734	76%	0.761	S	S	*	*			trans	-71.2	94	171.9	31.8	0	0	0	0	108.2	D29 A33	D29-S31 PolarHBondContact O-N 3.26Å; S31-A33 VanDerWaalsContact C-N 3.26Å; S31-A33 PolarHBondContact O-N 3.44Å
32	V	32.6	Very low	31.4	Very low	95 Å²	95	137 Å²	137	58%	0.576	74%	0.744	S	S	*	*			trans	-70.1	92.2	165	-173.6	0	0	0	0	106.8	V30 W34	V30-V32 PolarHBondContact O-N 2.98Å; V30-V32 HydrophobicContact CG1-CG2 4.32Å; V32-W34 VanDerWaalsContact C-N 3.31Å; V32-W34 HydrophobicContact CG1-CD2 4.31Å; V32-W34 HydrophobicContact CG1-CG 4.3Å; V32-W34 HydrophobicContact CG1-CZ2 4.2Å; V32-W34 VanDerWaalsContact O-CD1 3.29Å; V32-W34 PolarHBondContact O-N 3.21Å
33	A	27.3	Very low	31.3	Very low	83 Å²	83	138.4 Å²	138.4	69%	0.686	75%	0.745	S	S	*	*			trans	-67.3	91.1	171.1	0	0	0	0	0	108.8	S31 R35	S31-A33 VanDerWaalsContact C-N 3.26Å; S31-A33 PolarHBondContact O-N 3.44Å; A33-R35 PolarHBondContact O-N 3.26Å
34	W	30.2	Very low	31.3	Very low	230 Å²	230	138.1 Å²	138.1	87%	0.871	74%	0.743	S	S	*	*			trans	-74.7	67.7	161.8	-61.8	90.7	0	0	0	108.4	V32	V32-W34 VanDerWaalsContact C-N 3.31Å; V32-W34 HydrophobicContact CG1-CD2 4.31Å; V32-W34 HydrophobicContact CG1-CG 4.3Å; V32-W34 HydrophobicContact CG1-CZ2 4.2Å; V32-W34 VanDerWaalsContact O-CD1 3.29Å; V32-W34 PolarHBondContact O-N 3.21Å
35	R	29.1	Very low	31.5	Very low	213 Å²	213	145.7 Å²	145.7	80%	0.804	75%	0.75	S	S	*	*			trans	-88.7	135.1	162.8	-97.6	-178.9	169.7	157.1	-3.1	107.3	A33	A33-R35 PolarHBondContact O-N 3.26Å
36	D	35.9	Very low	31.7	Very low	148 Å²	148	144 Å²	144	79%	0.791	74%	0.742	S	S	*	*			trans	87.2	48.3	161	-46.3	-40.3	0	0	0	119.3
37	V	32	Very low	31.9	Very low	109 Å²	109	145.8 Å²	145.8	66%	0.661	74%	0.739	S	S	*	*			trans	-115.4	75.8	148.3	-161.6	0	0	0	0	109.9	W39	V37-W39 VanDerWaalsContact C-N 3.28Å; V37-W39 PolarHBondContact O-N 2.79Å; V37-W39 VanDerWaalsContact CG1-NE1 3.25Å; V37-W39 HydrophobicContact CG1-CG 4.31Å; V37-W39 VanDerWaalsContact CG1-CD1 3.42Å
38	A	30	Very low	31.9	Very low	85 Å²	85	141.4 Å²	141.4	70%	0.702	73%	0.732	S	S	*	*			trans	-65	88.5	163.1	0	0	0	0	0	109.1	R40	A38-R40 PolarHBondContact O-N 3Å
39	W	31.5	Very low	32	Very low	206 Å²	206	147.2 Å²	147.2	78%	0.78	74%	0.736	S	S	*	*			trans	-74.2	66.2	155.6	-70.1	96.9	0	0	0	108.2	V37 D41 V42	V37-W39 VanDerWaalsContact C-N 3.28Å; V37-W39 PolarHBondContact O-N 2.79Å; V37-W39 VanDerWaalsContact CG1-NE1 3.25Å; V37-W39 HydrophobicContact CG1-CG 4.31Å; V37-W39 VanDerWaalsContact CG1-CD1 3.42Å; W39-D41 PolarHBondContact O-N 2.87Å; W39-V42 HydrophobicContact CE3-CG2 3.45Å; W39-V42 VanDerWaalsContact CE3-CG2 3.45Å; W39-V42 HydrophobicContact CZ3-CG2 3.62Å
40	R	30.6	Very low	31.8	Very low	212 Å²	212	151.6 Å²	151.6	80%	0.8	74%	0.743	S	S	*	*			trans	-62.6	121	155.8	-95.5	179.6	170.2	148.7	-3.7	106.3	A38	A38-R40 PolarHBondContact O-N 3Å
41	D	35.2	Very low	32	Very low	131 Å²	131	152.7 Å²	152.7	70%	0.701	74%	0.744	S	S	*	*			trans	68.3	39.7	153	-52	-50.3	0	0	0	118.9	W39 T43	W39-D41 PolarHBondContact O-N 2.87Å; D41-T43 PolarHBondContact O-N 3.1Å
42	V	33.4	Very low	32.1	Very low	84 Å²	84	154 Å²	154	51%	0.509	75%	0.747	S	S	.	*			trans	-82	80.6	153	-173	0	0	0	0	107.8	W39 W44	W39-V42 HydrophobicContact CE3-CG2 3.45Å; W39-V42 VanDerWaalsContact CE3-CG2 3.45Å; W39-V42 HydrophobicContact CZ3-CG2 3.62Å; V42-W44 PolarHBondContact O-N 3.21Å; V42-W44 VanDerWaalsContact C-N 3.34Å
43	T	31.6	Very low	32	Very low	103 Å²	103	153.2 Å²	153.2	63%	0.632	75%	0.751	S	S	*	*			trans	-58.2	95.5	167.2	46.9	0	0	0	0	109.2	D41 R45	D41-T43 PolarHBondContact O-N 3.1Å; T43-R45 PolarHBondContact O-N 3.29Å
44	W	33.3	Very low	32.2	Very low	214 Å²	214	158.7 Å²	158.7	81%	0.811	75%	0.754	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69.4	63	166.3	-89.5	69.2	0	0	0	110.5	V42 V47	V42-W44 PolarHBondContact O-N 3.21Å; V42-W44 VanDerWaalsContact C-N 3.34Å; W44-V47 HydrophobicContact CE3-CG2 4.02Å; W44-V47 HydrophobicContact CZ3-CG2 4.19Å
45	R	34.2	Very low	32.2	Very low	228 Å²	228	158.3 Å²	158.3	86%	0.86	75%	0.752	S	S	*	*	T	Hydrogen-bonded Turn	trans	-120.8	-1.9	172.7	-90.6	-173.2	172.9	156.5	-0.8	114.6	T43	T43-R45 PolarHBondContact O-N 3.29Å
46	D	34.6	Very low	32.5	Very low	143 Å²	143	155.6 Å²	155.6	77%	0.765	75%	0.754	S	S	*	*			trans	-132.7	33.7	-175.6	-66.5	-62.4	0	0	0	113.8	A48	D46-A48 VanDerWaalsContact C-N 3.26Å; D46-A48 PolarHBondContact O-N 2.91Å
47	V	34.2	Very low	32.3	Very low	108 Å²	108	154.6 Å²	154.6	66%	0.655	75%	0.753	S	S	*	*			trans	-72.5	94.5	163.7	-176.6	0	0	0	0	107.3	W44 W49	W44-V47 HydrophobicContact CE3-CG2 4.02Å; W44-V47 HydrophobicContact CZ3-CG2 4.19Å; V47-W49 PolarHBondContact O-N 3.02Å; V47-W49 VanDerWaalsContact O-N 3.1Å
48	A	32	Very low	32.3	Very low	82 Å²	82	153.9 Å²	153.9	68%	0.678	76%	0.758	S	S	*	*			trans	-41.7	108.9	-173.9	0	0	0	0	0	113.5	D46 R50	D46-A48 VanDerWaalsContact C-N 3.26Å; D46-A48 PolarHBondContact O-N 2.91Å; A48-R50 VanDerWaalsContact C-N 3.26Å; A48-R50 PolarHBondContact O-N 3.05Å
49	W	29.7	Very low	32.2	Very low	252 Å²	252	159.3 Å²	159.3	96%	0.955	76%	0.761	S	S	*	*			trans	-53	89.2	146.3	-70.8	74.9	0	0	0	108.9	V47	V47-W49 PolarHBondContact O-N 3.02Å; V47-W49 VanDerWaalsContact O-N 3.1Å
50	R	30	Very low	32.3	Very low	221 Å²	221	161 Å²	161	83%	0.834	77%	0.767	S	S	*	*			trans	-158.7	0.4	169.5	-116.6	160.2	-169.2	178.9	3	120.4	A48	A48-R50 VanDerWaalsContact C-N 3.26Å; A48-R50 PolarHBondContact O-N 3.05Å
51	D	34.2	Very low	32.5	Very low	155 Å²	155	154.5 Å²	154.5	83%	0.829	77%	0.765	S	S	*	*			trans	-132.9	21.3	179.6	-74.6	-54.1	0	0	0	115.9	A53	D51-A53 PolarHBondContact O-N 2.95Å
52	V	32.5	Very low	32.3	Very low	131 Å²	131	153.7 Å²	153.7	79%	0.794	78%	0.777	S	S	*	*			trans	-81.6	64.1	155.5	-170.7	0	0	0	0	107.5	W54	V52-W54 PolarHBondContact O-N 3.24Å
53	A	31	Very low	32.3	Very low	79 Å²	79	153.8 Å²	153.8	65%	0.653	79%	0.787	S	S	*	*			trans	-71.9	99.3	171.2	0	0	0	0	0	107.9	D51 R55	D51-A53 PolarHBondContact O-N 2.95Å; A53-R55 VanDerWaalsContact C-N 3.31Å; A53-R55 PolarHBondContact O-N 3.05Å
54	W	29.8	Very low	32.4	Very low	198 Å²	198	159.3 Å²	159.3	75%	0.75	80%	0.796	S	S	*	*			trans	-44	93.4	154.1	-74.7	68.5	0	0	0	110.4	V52 W59	V52-W54 PolarHBondContact O-N 3.24Å; W54-W59 AromaticContact CH2-NE1 3.85Å; W54-W59 AromaticContact CZ3-CD1 3.8Å; W54-W59 AromaticContact CZ3-NE1 3.57Å
55	R	31.3	Very low	32.4	Very low	222 Å²	222	160 Å²	160	84%	0.838	80%	0.8	S	S	*	*			trans	-138	116.3	160.8	-87.3	-174.8	167.3	162.7	-4.4	107.6	A53	A53-R55 VanDerWaalsContact C-N 3.31Å; A53-R55 PolarHBondContact O-N 3.05Å
56	D	34.5	Very low	32.1	Very low	157 Å²	157	152.4 Å²	152.4	84%	0.84	79%	0.792	S	S	*	*	S	Bend	trans	102.9	8.2	165.9	-49.7	-28.2	0	0	0	120.3
57	V	32.6	Very low	31.8	Very low	126 Å²	126	154.3 Å²	154.3	76%	0.764	80%	0.802	S	S	*	*			trans	-127.2	58.2	160.9	-163.1	0	0	0	0	110.4	W59	V57-W59 PolarHBondContact O-N 2.87Å
58	A	31.2	Very low	31.6	Very low	94 Å²	94	152.7 Å²	152.7	78%	0.777	80%	0.8	S	S	*	*			trans	-80.9	89.7	166.4	0	0	0	0	0	109
59	W	28.6	Very low	31.7	Very low	199 Å²	199	159.1 Å²	159.1	75%	0.754	81%	0.806	S	S	*	*				16.1	110.7	129.4	-61.9	79.7	0	0	0	115.9	W54 V57	W54-W59 AromaticContact CH2-NE1 3.85Å; W54-W59 AromaticContact CZ3-CD1 3.8Å; W54-W59 AromaticContact CZ3-NE1 3.57Å; V57-W59 PolarHBondContact O-N 2.87Å
60	R	32.8	Very low	31.7	Very low	243 Å²	243	157.1 Å²	157.1	92%	0.917	80%	0.799	S	S	*	*				-177	95.3	118.7	-97.4	163.9	-169.9	-166.6	4	109.8	A62	R60-A62 PolarHBondContact O-N 3.34Å
61	G	36.3	Very low	31.7	Very low	74 Å²	74	157 Å²	157	76%	0.763	80%	0.798	S	S	*	*				49.4	68	129.4	0	0	0	0	0	114.8	A63	G61-A63 PolarHBondContact O-N 3.37Å
62	A	31.2	Very low	31.5	Very low	114 Å²	114	157.4 Å²	157.4	94%	0.942	81%	0.806	S	S	*	*			trans	-52.9	84.9	142.5	0	0	0	0	0	108.4	R60	R60-A62 PolarHBondContact O-N 3.34Å
63	A	32	Very low	31.3	Very low	86 Å²	86	153.5 Å²	153.5	71%	0.711	79%	0.788	S	S	*	*			trans	-138.6	66.9	172.5	0	0	0	0	0	107.1	G61	G61-A63 PolarHBondContact O-N 3.37Å
64	R	33.8	Very low	31.1	Very low	219 Å²	219	157.9 Å²	157.9	83%	0.826	79%	0.794	S	S	*	*	S	Bend	trans	-150.6	1.7	163.1	-117.8	176.1	-167.5	-166.9	2.6	117.6
65	Y	32.8	Very low	30.9	Very low	230 Å²	230	157.2 Å²	157.2	90%	0.902	80%	0.799	S	S	*	*	S	Bend	trans	-140.5	96.2	167.2	-65.6	-74.5	0	0	0	109.2
66	G	29.5	Very low	30.7	Very low	67 Å²	67	150.3 Å²	150.3	69%	0.691	80%	0.797	S	S	*	*			trans	-70.9	147.4	-174.4	0	0	0	0	0	113.1
67	L	28.5	Very low	30.5	Very low	184 Å²	184	149.1 Å²	149.1	96%	0.963	80%	0.796	S	S	*	*			trans	63.7	77.4	145.3	-61.3	164.7	0	0	0	114.8
68	A	29.8	Very low	30.2	Very low	74 Å²	74	149.3 Å²	149.3	61%	0.612	80%	0.796	S	S	*	*			trans	-138.2	95	170.6	0	0	0	0	0	109.1
69	W	33.1	Very low	30	Very low	217 Å²	217	157.5 Å²	157.5	82%	0.822	81%	0.807	S	S	*	*	S	Bend	trans	67.4	121.9	150	-40.9	96.3	0	0	0	116.4
70	R	30.8	Very low	29.9	Very low	210 Å²	210	150.1 Å²	150.1	79%	0.792	79%	0.793	S	S	*	*			cis	-165.9	128.1	9.5	-98.8	163.1	171.6	-120.6	-0.6	103	V72	R70-V72 PolarHBondContact O-N 2.9Å
71	R	29.9	Very low	29.6	Very low	217 Å²	217	145.9 Å²	145.9	82%	0.819	79%	0.789	S	S	*	*			trans	28.5	97.3	145.4	-55.5	-178.1	-177.7	177.3	-0.5	113.5	A73	R71-A73 PolarHBondContact O-N 2.93Å; R71-A73 HydrophobicContact CB-CB 3.66Å
72	V	30.5	Very low	29.3	Very low	164 Å²	164	148.7 Å²	148.7	99%	0.994	79%	0.791	S	S	*	*				6.1	61.1	77.8	-162.7	0	0	0	0	112.1	R70	R70-V72 PolarHBondContact O-N 2.9Å
73	A	26.9	Very low	29	Very low	50 Å²	50	148.3 Å²	148.3	41%	0.413	78%	0.777	S	S	.	*			trans	-144.6	107.6	163.3	0	0	0	0	0	102.9	R71	R71-A73 PolarHBondContact O-N 2.93Å; R71-A73 HydrophobicContact CB-CB 3.66Å
74	Q	27.1	Very low	28.9	Very low	170 Å²	170	155.8 Å²	155.8	79%	0.794	79%	0.787	S	S	*	*				56.6	119.2	104.1	-63.4	177.6	3.4	0	0	110.4
75	H	26.2	Very low	28.7	Very low	184 Å²	184	148.6 Å²	148.6	85%	0.852	78%	0.781	S	S	*	*			trans	98.7	103.4	176.9	-54.2	-74.5	0	0	0	116.2
76	G	26.7	Very low	28.5	Very low	77 Å²	77	144.8 Å²	144.8	79%	0.794	78%	0.776	S	S	*	*			trans	78.8	75.5	135.4	0	0	0	0	0	116.7
77	V	29.6	Very low	28.5	Very low	133 Å²	133	148.1 Å²	148.1	81%	0.806	78%	0.783	S	S	*	*			trans	-111.4	101.8	155.3	-162.3	0	0	0	0	107.1	W79	V77-W79 PolarHBondContact O-N 3.1Å
78	V	27.8	Very low	28.5	Very low	129 Å²	129	145.2 Å²	145.2	78%	0.782	77%	0.772	S	S	*	*			trans	-55.9	117.1	177.4	177.1	0	0	0	0	108.5	G80	V78-G80 PolarHBondContact O-N 2.98Å
79	W	26.7	Very low	28.2	Very low	266 Å²	266	153.8 Å²	153.8	100%	1.008	79%	0.789	S	S	*	*			trans	-74.7	80.4	166.1	-78.4	48.8	0	0	0	107.3	V77	V77-W79 PolarHBondContact O-N 3.1Å
80	G	25.8	Very low	27.9	Very low	44 Å²	44	146.9 Å²	146.9	45%	0.454	79%	0.785	S	S	.	*			trans	-126.4	123.9	178.9	0	0	0	0	0	109.6	V78	V78-G80 PolarHBondContact O-N 2.98Å
81	N	26.6	Very low	27.7	Very low	155 Å²	155	141 Å²	141	83%	0.829	78%	0.782	S	S	*	*			trans	70.5	76.1	158.4	-52.8	-26	0	0	0	117
82	V	29	Very low	27.4	Very low	132 Å²	132	141.7 Å²	141.7	80%	0.8	79%	0.785	S	S	*	*			trans	-109	91.6	146.5	-175	0	0	0	0	107.8
83	V	26.6	Very low	27.2	Very low	107 Å²	107	145.4 Å²	145.4	65%	0.648	78%	0.781	S	S	*	*			trans	-88	112.7	168.2	173.7	0	0	0	0	107.1
84	W	30	Very low	27.1	Very low	242 Å²	242	148.7 Å²	148.7	92%	0.917	80%	0.801	S	S	*	*			trans	-145.7	115.6	168	-83.6	70.5	0	0	0	106.5
85	G	27.8	Very low	27.3	Very low	69 Å²	69	145.2 Å²	145.2	71%	0.711	80%	0.801	S	S	*	*			cis	-160.9	131.1	-7.6	0	0	0	0	0	106
86	N	28.8	Very low	27.5	Very low	149 Å²	149	148 Å²	148	80%	0.797	80%	0.804	S	S	*	*			trans	-77.5	128.7	-176.5	-69.2	-56.6	0	0	0	112.3
87	V	29.3	Very low	27.3	Very low	138 Å²	138	154 Å²	154	84%	0.836	81%	0.809	S	S	*	*			trans	-162.2	126.9	147.6	-123.3	0	0	0	0	105.5
88	V	28.6	Very low	27.2	Very low	122 Å²	122	154.5 Å²	154.5	74%	0.739	81%	0.812	S	S	*	*			cis	-152.6	132.8	23.6	168.6	0	0	0	0	109.2
89	W	24.5	Very low	26.9	Very low	254 Å²	254	160.5 Å²	160.5	96%	0.962	82%	0.821	S	S	*	*			trans	35.3	125.5	149.5	-75.4	39.4	0	0	0	122.5
90	G	25.8	Very low	26.9	Very low	72 Å²	72	154.1 Å²	154.1	74%	0.742	82%	0.815	S	S	*	*				137.4	106	128.4	0	0	0	0	0	116.2
91	A	27	Very low	27	Very low	88 Å²	88	155.1 Å²	155.1	73%	0.727	83%	0.826	S	S	*	*			trans	58.5	92.3	156.5	0	0	0	0	0	116.4
92	W	23.1	Very low	27	Very low	230 Å²	230	155.4 Å²	155.4	87%	0.871	83%	0.832	S	S	*	*				49.2	107	95.8	-67.3	79.1	0	0	0	112.4
93	W	26.9	Very low	26.5	Very low	243 Å²	243	160 Å²	160	92%	0.92	84%	0.836	S	S	*	*				171.6	128.2	111.5	-90	90.6	0	0	0	109.6
94	S	25.7	Very low	26.5	Very low	118 Å²	118	160.8 Å²	160.8	83%	0.825	84%	0.844	S	S	*	*			trans	-68.3	140.3	-171.2	-50.6	0	0	0	0	114.1
95	A	30.9	Very low	26.7	Very low	97 Å²	97	155.5 Å²	155.5	80%	0.802	84%	0.838	S	S	*	*			trans	-166.4	97.2	138.9	0	0	0	0	0	112.4
96	R	29.7	Very low	26.6	Very low	243 Å²	243	158.4 Å²	158.4	92%	0.917	84%	0.842	S	S	*	*			trans	62.3	94.6	134.6	-128.5	168.5	-167.6	163.2	2	119
97	F	23.4	Very low	26.7	Very low	202 Å²	202	154.7 Å²	154.7	89%	0.886	84%	0.839	S	S	*	*			trans	-62.5	141.6	157.2	-63.1	-89.9	0	0	0	112.2
98	V	27	Very low	26.9	Very low	144 Å²	144	153.2 Å²	153.2	87%	0.873	83%	0.834	S	S	*	*			trans	-139.6	125.1	139.8	177.8	0	0	0	0	108.1
99	W	22.5	Very low	27.1	Very low	256 Å²	256	150.6 Å²	150.6	97%	0.97	83%	0.831	S	S	*	*			trans	-93.2	129.7	-178.3	-145.5	40.9	0	0	0	108.4
100	C	26.5	Very low	27.8	Very low	131 Å²	131	144.4 Å²	144.4	89%	0.885	82%	0.821	S	S	*	*			trans	-158.9	152.5	160.8	-131.1	0	0	0	0	110.2
101	G	28.4	Very low	28	Very low	66 Å²	66	147.1 Å²	147.1	68%	0.68	82%	0.818	S	S	*	*			trans	-46.1	151.9	-165.2	0	0	0	0	0	117.7	R103	G101-R103 PolarHBondContact O-N 3.35Å
102	V	24.6	Very low	28.4	Very low	160 Å²	160	147.9 Å²	147.9	97%	0.97	82%	0.816	S	S	*	*	S	Bend	trans	-33.6	90.1	179.2	-168.9	0	0	0	0	114
103	R	20.6	Very low	29	Very low	230 Å²	230	148 Å²	148	87%	0.868	82%	0.817	S	S	*	*			trans	-167	101.1	156.3	-156.7	178.4	-166.2	166.2	3.6	109.5	G101	G101-R103 PolarHBondContact O-N 3.35Å
104	C	26.4	Very low	29.3	Very low	122 Å²	122	141.4 Å²	141.4	82%	0.824	81%	0.806	S	S	*	*			trans	-157.2	103.6	159.8	-87.2	0	0	0	0	106.4
105	V	32.4	Very low	29.8	Very low	132 Å²	132	139 Å²	139	80%	0.8	79%	0.789	S	S	*	*				62	108.9	92.1	-179.8	0	0	0	0	110.2	G107	V105-G107 VanDerWaalsContact C-N 3.34Å; V105-G107 PolarHBondContact O-N 3.42Å
106	V	27.4	Very low	30.3	Very low	129 Å²	129	141.9 Å²	141.9	78%	0.782	79%	0.791	S	S	*	*			trans	-53.4	94.9	168.5	175.6	0	0	0	0	108.5	C108	V106-C108 WeakPolarHBondContact CG1-SG 3.38Å
107	G	29.9	Very low	30.8	Very low	71 Å²	71	139.5 Å²	139.5	73%	0.732	79%	0.787	S	S	*	*			trans	-94.9	88.9	163.4	0	0	0	0	0	107.6	V105 G109	V105-G107 VanDerWaalsContact C-N 3.34Å; V105-G107 PolarHBondContact O-N 3.42Å; G107-G109 VanDerWaalsContact C-N 3.26Å; G107-G109 PolarHBondContact O-N 3.35Å
108	C	34.8	Very low	31.6	Very low	108 Å²	108	132.1 Å²	132.1	73%	0.73	76%	0.757	S	S	*	*			trans	-67.2	88.6	171.3	-66.2	0	0	0	0	109.3	V106	V106-C108 WeakPolarHBondContact CG1-SG 3.38Å
109	G	32.6	Very low	32.5	Very low	66 Å²	66	129.6 Å²	129.6	68%	0.68	74%	0.742	S	S	*	*			trans	-70.9	121.7	152.1	0	0	0	0	0	107.9	G107 D111	G107-G109 VanDerWaalsContact C-N 3.26Å; G107-G109 PolarHBondContact O-N 3.35Å; G109-D111 PolarHBondContact O-N 3.16Å
110	V	38	Very low	33.6	Very low	124 Å²	124	123.2 Å²	123.2	75%	0.752	73%	0.731	S	S	*	*			trans	-78.4	108.5	-170.8	-172.8	0	0	0	0	109.5	P112	V110-P112 WeakPolarHBondContact O-CD 3.5Å
111	D	30.7	Very low	34.5	Very low	129 Å²	129	120.2 Å²	120.2	69%	0.69	72%	0.716	S	S	*	*			trans	-68.5	125	167.3	-74.6	-57.4	0	0	0	110.1	G109 W113	G109-D111 PolarHBondContact O-N 3.16Å; D111-W113 PolarHBondContact O-N 2.88Å
112	P	34.8	Very low	35.4	Very low	104 Å²	104	121.8 Å²	121.8	68%	0.675	71%	0.706	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69.8	10.6	-172.4	-18.5	30	0	0	0	116.9	V110	V110-P112 WeakPolarHBondContact O-CD 3.5Å
113	W	35.9	Very low	36.1	Very low	234 Å²	234	122.7 Å²	122.7	89%	0.886	69%	0.692	S	S	*	*	T	Hydrogen-bonded Turn	trans	-127.4	2.6	-167.4	-58.9	68.2	0	0	0	113.9	D111	D111-W113 PolarHBondContact O-N 2.88Å
114	C	32.9	Very low	37.3	Very low	103 Å²	103	121 Å²	121	70%	0.696	69%	0.685	S	S	*	*			trans	-98.7	22.5	179.3	-97.2	0	0	0	0	114.6	D116	C114-D116 PolarHBondContact O-N 3.42Å
115	S	36.3	Very low	37.9	Very low	67 Å²	67	125.4 Å²	125.4	47%	0.469	69%	0.686	S	S	.	*	G	3₁₀ helix	trans	-78.4	-6.1	-172.3	-67.8	0	0	0	0	115.9
116	D	42	Very low	38.2	Very low	159 Å²	159	124.3 Å²	124.3	85%	0.85	67%	0.672	S	S	*	*	G	3₁₀ helix	trans	-98.6	7.8	-170	-69.7	-24.2	0	0	0	115.8	C114	C114-D116 PolarHBondContact O-N 3.42Å
117	K	40.3	Very low	38.8	Very low	193 Å²	193	126 Å²	126	84%	0.839	67%	0.669	S	S	*	*	G	3₁₀ helix	trans	-124.2	14	178.4	-65.3	-164.9	178	-177	0	115.4	T119	K117-T119 PolarHBondContact O-N 2.89Å
118	L	38.7	Very low	39.2	Very low	47 Å²	47	124.6 Å²	124.6	25%	0.246	65%	0.647	C	S	.	*			trans	-82.4	115.6	-177.1	-64.6	165.1	0	0	0	111	Q122 H126	L118-Q122 HydrophobicContact CB-CB 4.07Å; L118-Q122 HydrophobicContact CD2-CB 3.85Å; L118-Q122 VanDerWaalsContact CD2-CD 3.4Å; L118-Q122 HydrophobicContact CD2-CG 4.25Å; L118-Q122 HydrophobicContact CG-CB 4.49Å; L118-H126 WeakPolarHBondContact CD1-NE2 3.18Å
119	T	46.5	Very low	39.4	Very low	90 Å²	90	127.1 Å²	127.1	55%	0.552	64%	0.642	S	S	*	*			trans	-60.1	157.1	173.3	52.5	0	0	0	0	111	K117 A121 Q122	K117-T119 PolarHBondContact O-N 2.89Å; T119-A121 PolarHBondContact O-N 2.83Å; T119-Q122 PolarHBondContact O-N 2.9Å
120	T	45.9	Very low	39.9	Very low	122 Å²	122	133 Å²	133	75%	0.748	65%	0.648	S	S	*	*	T	Hydrogen-bonded Turn	trans	-53.8	-18.4	-176.6	-13.5	0	0	0	0	114
121	A	45.5	Very low	40.4	Very low	68 Å²	68	132.4 Å²	132.4	56%	0.562	64%	0.638	S	S	*	*	T	Hydrogen-bonded Turn	trans	-79	-29.6	173.9	0	0	0	0	0	114	T119	T119-A121 PolarHBondContact O-N 2.83Å
122	Q	46.3	Very low	41.3	Very low	100 Å²	100	132.2 Å²	132.2	47%	0.467	64%	0.635	S	S	.	*	G	3₁₀ helix	trans	-83.8	-18.5	-179.8	-70	-178.3	-65	0	0	113.6	L118 T119 R124 Y125	L118-Q122 HydrophobicContact CB-CB 4.07Å; L118-Q122 HydrophobicContact CD2-CB 3.85Å; L118-Q122 VanDerWaalsContact CD2-CD 3.4Å; L118-Q122 HydrophobicContact CD2-CG 4.25Å; L118-Q122 HydrophobicContact CG-CB 4.49Å; T119-Q122 PolarHBondContact O-N 2.9Å; Q122-R124 PolarHBondContact O-N 2.91Å; Q122-R124 VanDerWaalsContact O-N 3.16Å; Q122-Y125 PolarHBondContact O-N 3.06Å
123	R	40.4	Very low	41.9	Very low	179 Å²	179	134.6 Å²	134.6	68%	0.675	64%	0.635	S	S	*	*	G	3₁₀ helix	trans	-61.9	-20.5	173.7	-67.1	-174.2	-164.7	-135.7	0.6	113.2	Y125 H126	R123-Y125 PolarHBondContact O-N 2.84Å; R123-Y125 VanDerWaalsContact C-N 3.3Å; R123-H126 PolarHBondContact O-N 3.31Å
124	R	45.4	Very low	42.5	Very low	195 Å²	195	134.4 Å²	134.4	74%	0.736	63%	0.634	S	S	*	*	G	3₁₀ helix	trans	-75.1	-16.5	-177.2	-122.2	-179.9	-81.4	-176	-5.3	114.3	Q122	Q122-R124 PolarHBondContact O-N 2.91Å; Q122-R124 VanDerWaalsContact O-N 3.16Å
125	Y	39	Very low	43.1	Very low	213 Å²	213	139.5 Å²	139.5	84%	0.835	65%	0.652	S	S	*	*	G	3₁₀ helix	trans	-108.2	5.3	174.1	-66.8	-75.6	0	0	0	113.2	Q122 R123 F127	Q122-Y125 PolarHBondContact O-N 3.06Å; R123-Y125 PolarHBondContact O-N 2.84Å; R123-Y125 VanDerWaalsContact C-N 3.3Å; Y125-F127 PolarHBondContact O-N 3.04Å
126	H	38.1	Very low	43.5	Very low	109 Å²	109	143.2 Å²	143.2	51%	0.505	66%	0.662	S	S	.	*			trans	-80.4	46.4	170.2	-112.4	-90.1	0	0	0	111	L118 R123 T128	L118-H126 WeakPolarHBondContact CD1-NE2 3.18Å; R123-H126 PolarHBondContact O-N 3.31Å; H126-T128 VanDerWaalsContact C-N 3.27Å; H126-T128 PolarHBondContact O-N 2.85Å
127	F	41.7	Very low	43.6	Very low	164 Å²	164	142.3 Å²	142.3	72%	0.719	65%	0.652	S	S	*	*			trans	-80.6	85	166.1	-87.9	-84.9	0	0	0	108.8	Y125	Y125-F127 PolarHBondContact O-N 3.04Å
128	T	37	Very low	43.7	Very low	43 Å²	43	139.5 Å²	139.5	26%	0.264	64%	0.641	S	S	.	*			trans	59.8	63.8	130.3	61.9	0	0	0	0	119.2	H126 K130 E131 I132	H126-T128 VanDerWaalsContact C-N 3.27Å; H126-T128 PolarHBondContact O-N 2.85Å; T128-K130 PolarHBondContact O-N 2.94Å; T128-E131 WeakPolarHBondContact CG2-OE2 3.47Å; T128-E131 PolarHBondContact OG1-OE2 2.92Å; T128-E131 PolarHBondContact O-N 2.94Å; T128-E131 HydrophobicContact CG2-CG 3.77Å; T128-E131 VanDerWaalsContact CG2-CD 3.45Å; T128-E131 HydrophobicContact CG2-CB 4.33Å; T128-E131 WeakPolarHBondContact CB-OE2 3.24Å; T128-E131 VanDerWaalsContact CB-OE2 3.24Å; T128-I132 WeakPolarHBondContact O-CD1 3.42Å; T128-I132 WeakPolarHBondContact O-CG1 3.36Å; T128-I132 PolarHBondContact O-N 3.4Å
129	Y	38.8	Very low	44	Very low	161 Å²	161	144.9 Å²	144.9	63%	0.631	66%	0.664	S	S	*	*	T	Hydrogen-bonded Turn	trans	-58.6	-26	153.3	-174.3	-97.4	0	0	0	112.3	K133	Y129-K133 HydrophobicContact CE1-CD 4.3Å; Y129-K133 WeakPolarHBondContact OH-CE 3.38Å; Y129-K133 PolarHBondContact OH-NZ 3.06Å
130	K	44.5	Very low	43.9	Very low	188 Å²	188	148.4 Å²	148.4	82%	0.817	67%	0.671	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81.2	-11.8	177.3	-77	-173.1	177.6	178.9	0	114.9	T128	T128-K130 PolarHBondContact O-N 2.94Å
131	E	47.4	Very low	43.7	Very low	113 Å²	113	150.1 Å²	150.1	53%	0.528	67%	0.666	S	S	.	*	T	Hydrogen-bonded Turn	trans	-95	-31.7	170.4	-67.6	177	157.6	0	0	111.8	T128 K133 R134	T128-E131 WeakPolarHBondContact CG2-OE2 3.47Å; T128-E131 PolarHBondContact OG1-OE2 2.92Å; T128-E131 PolarHBondContact O-N 2.94Å; T128-E131 HydrophobicContact CG2-CG 3.77Å; T128-E131 VanDerWaalsContact CG2-CD 3.45Å; T128-E131 HydrophobicContact CG2-CB 4.33Å; T128-E131 WeakPolarHBondContact CB-OE2 3.24Å; T128-E131 VanDerWaalsContact CB-OE2 3.24Å; E131-K133 PolarHBondContact O-N 2.93Å; E131-K133 VanDerWaalsContact O-N 3.1Å; E131-R134 PolarHBondContact O-N 2.96Å
132	I	49.6	Very low	43.6	Very low	124 Å²	124	156 Å²	156	64%	0.636	67%	0.674	S	S	*	*	T	Hydrogen-bonded Turn	trans	-65.8	-15.4	-180	-63.8	165	0	0	0	112.9	T128	T128-I132 WeakPolarHBondContact O-CD1 3.42Å; T128-I132 WeakPolarHBondContact O-CG1 3.36Å; T128-I132 PolarHBondContact O-N 3.4Å
133	K	47.1	Very low	43.4	Very low	155 Å²	155	160.3 Å²	160.3	67%	0.674	69%	0.69	S	S	*	*	T	Hydrogen-bonded Turn	trans	-100.8	4.3	173.2	-88.4	-176.5	171.2	174.7	0	114.9	Y129 E131	Y129-K133 HydrophobicContact CE1-CD 4.3Å; Y129-K133 WeakPolarHBondContact OH-CE 3.38Å; Y129-K133 PolarHBondContact OH-NZ 3.06Å; E131-K133 PolarHBondContact O-N 2.93Å; E131-K133 VanDerWaalsContact O-N 3.1Å
134	R	49	Very low	43.7	Very low	230 Å²	230	158.8 Å²	158.8	87%	0.868	69%	0.691	S	S	*	*			trans	-117.9	6.9	177.4	-87.4	-174.7	175.1	-174	-1.6	113.9	E131	E131-R134 PolarHBondContact O-N 2.96Å
135	I	46.5	Very low	43.5	Very low	210 Å²	210	155.5 Å²	155.5	100%	1.077	69%	0.687	S	S	*	*			trans	-106.5	0	164.8	-46.7	174.3	0	0	0	107.4

Retrieved 135 of 135 residues in 32.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).