A0A077ZNR8_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZNR8, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 112 aa.

						>A0A077ZNR8_TRITR|A0A077ZNR8
MKTIELMTDSSTGYHWISDGLSGKARLRTKGAEEMLIRRWISTVLSLVEEYALQLSVTLVKSEDNQADSLTHVPQRWVTPSTGPSSPVCVAVADPGAMRLIAAVHHAAAILA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	82.2	Confident	92.5	Very high	177 Å²	177	90.5 Å²	90.5	87%	0.872	48%	0.475	S	S	*	.				0	121.5	0	-164.4	159.1	81.2	0	0	107.2	A52 Q54	M1-A52 WeakPolarHBondContact CG-O 3.37Å; M1-Q54 HydrophobicContact CE-CB 4.09Å; M1-Q54 HydrophobicContact CE-CG 4.43Å; M1-Q54 HydrophobicContact CG-CB 4.27Å; M1-Q54 HydrophobicContact SD-CB 4.49Å
2	K	92.7	Very high	92.1	Very high	158 Å²	158	88.6 Å²	88.6	69%	0.687	47%	0.47	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-92.4	128.9	177.5	-68.8	178.5	-178.5	173.4	0	108.1	L53 Q54	K2-L53 HydrophobicContact CB-CD2 3.89Å; K2-Q54 PolarHBondContact O-N 3.23Å
3	T	95.7	Very high	91.9	Very high	94 Å²	94	82.2 Å²	82.2	58%	0.577	44%	0.438	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-92.6	127.4	174.4	-52.9	0	0	0	0	108.2	Q54	T3-Q54 WeakPolarHBondContact CA-O 3.28Å; T3-Q54 HydrophobicContact CG2-CB 4.43Å; T3-Q54 HydrophobicContact CG2-CG 4.46Å; T3-Q54 PolarHBondContact OG1-OE1 2.97Å
4	I	96.3	Very high	91.9	Very high	74 Å²	74	80.9 Å²	80.9	38%	0.379	43%	0.425	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.8	136	178.2	-58.7	-171.8	0	0	0	107.9	L53 Q54 L55 S56	I4-L53 HydrophobicContact CD1-CD1 3.86Å; I4-L53 HydrophobicContact CD1-CD2 3.87Å; I4-L53 HydrophobicContact CD1-CG 4.39Å; I4-L53 HydrophobicContact CG1-CD2 4.37Å; I4-Q54 PolarHBondContact N-O 3.26Å; I4-L55 HydrophobicContact CB-CD1 4.13Å; I4-L55 HydrophobicContact CG2-CD1 4.03Å; I4-L55 WeakPolarHBondContact O-CA 3.5Å; I4-S56 PolarHBondContact O-N 2.8Å; I4-S56 PolarHBondContact O-OG 2.96Å
5	E	95.8	Very high	91.7	Very high	105 Å²	105	81.9 Å²	81.9	49%	0.491	43%	0.426	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.3	123.2	169.1	-175.4	176	-164.7	0	0	108.6	M7 T58	E5-M7 HydrophobicContact CG-CG 4.11Å; E5-T58 WeakPolarHBondContact OE1-CB 3.49Å; E5-T58 PolarHBondContact OE1-OG1 2.9Å
6	L	94.6	Very high	91.5	Very high	59 Å²	59	80.4 Å²	80.4	31%	0.309	41%	0.414	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.9	113.6	171.9	175.6	60.5	0	0	0	108.8	I17 L55 S56 V57 T58	L6-I17 HydrophobicContact CD2-CD1 3.47Å; L6-I17 VanDerWaalsContact CD2-CD1 3.47Å; L6-L55 HydrophobicContact CB-CD1 3.91Å; L6-S56 PolarHBondContact N-O 3.44Å; L6-V57 CarbonylContact O-C 3.5Å; L6-V57 VanDerWaalsContact O-CA 3.27Å; L6-V57 WeakPolarHBondContact O-CA 3.33Å; L6-T58 PolarHBondContact O-N 3.3Å
7	M	94.7	Very high	91.5	Very high	114 Å²	114	76 Å²	76	56%	0.562	39%	0.391	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-96.4	131.8	177.2	-59	-175.6	108.8	0	0	109.4	E5 T58 V60	E5-M7 HydrophobicContact CG-CG 4.11Å; M7-T58 WeakPolarHBondContact CA-O 3.43Å; M7-T58 HydrophobicContact CE-CG2 4.48Å; M7-V60 HydrophobicContact CB-CG2 3.85Å; M7-V60 HydrophobicContact CE-CG2 3.97Å; M7-V60 HydrophobicContact CG-CG2 4.38Å
8	T	93.2	Very high	91.5	Very high	28 Å²	28	74 Å²	74	17%	0.172	39%	0.385	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.9	143.8	175.9	-175.2	0	0	0	0	109.7	S10 V57 T58 L59 V60	T8-S10 PolarHBondContact OG1-N 3.16Å; T8-V57 HydrophobicContact CG2-CG1 4.24Å; T8-T58 PolarHBondContact N-O 3.47Å; T8-L59 CarbonylContact O-C 3.57Å; T8-L59 VanDerWaalsContact O-CA 3.27Å; T8-L59 WeakPolarHBondContact O-CA 3.35Å; T8-L59 WeakPolarHBondContact O-CD1 3.29Å; T8-V60 PolarHBondContact O-N 2.95Å
9	D	92	Very high	91.3	Very high	73 Å²	73	73.2 Å²	73.2	39%	0.39	38%	0.381	S	S	.	.	S	Bend	trans	-91.7	-12.6	171.5	58	-8.4	0	0	0	112.7	S11 V60 N65	D9-S11 PolarHBondContact O-N 3.18Å; D9-V60 WeakPolarHBondContact CA-O 3.44Å; D9-N65 PolarHBondContact OD2-ND2 2.75Å
10	S	89.5	Confident	91.1	Very high	50 Å²	50	70.3 Å²	70.3	35%	0.35	37%	0.37	S	S	.	.			trans	-78.9	107.7	175.6	-174.8	0	0	0	0	110.2	T8 T12 G13 Y14	T8-S10 PolarHBondContact OG1-N 3.16Å; S10-T12 PolarHBondContact O-N 2.83Å; S10-G13 PolarHBondContact O-N 2.92Å; S10-G13 PolarHBondContact OG-N 3.45Å; S10-G13 VanDerWaalsContact OG-N 3.1Å; S10-Y14 WeakPolarHBondContact O-CB 3.46Å; S10-Y14 PolarHBondContact O-N 3.48Å
11	S	90.7	Very high	90.9	Very high	63 Å²	63	69.9 Å²	69.9	44%	0.441	37%	0.367	S	S	.	.	H	α-helix	trans	-55.2	-41.8	172	57	0	0	0	0	112	D9 Y14 H15	D9-S11 PolarHBondContact O-N 3.18Å; S11-Y14 WeakPolarHBondContact O-CB 3.49Å; S11-Y14 PolarHBondContact O-N 3.45Å; S11-H15 PolarHBondContact O-CD2 2.92Å; S11-H15 PolarHBondContact O-N 3.33Å
12	T	88.2	Confident	91.2	Very high	68 Å²	68	64.6 Å²	64.6	42%	0.417	35%	0.348	S	S	.	.	H	α-helix	trans	-64.3	-46.9	176.7	-55.8	0	0	0	0	111.6	S10 Y14 H15 W16	S10-T12 PolarHBondContact O-N 2.83Å; T12-Y14 PolarHBondContact O-N 3.21Å; T12-H15 PolarHBondContact O-N 2.83Å; T12-W16 HydrophobicContact CG2-CD2 3.94Å; T12-W16 HydrophobicContact CG2-CE3 4.32Å; T12-W16 HydrophobicContact CG2-CH2 3.64Å; T12-W16 HydrophobicContact CG2-CZ2 3.19Å; T12-W16 HydrophobicContact CG2-CZ3 4.19Å; T12-W16 VanDerWaalsContact O-CG 3.24Å; T12-W16 PolarHBondContact O-N 3.3Å
13	G	88.6	Confident	90.5	Very high	5 Å²	5	59.7 Å²	59.7	5%	0.052	34%	0.342	C	S	.	.	H	α-helix	trans	-62.4	-41.2	176.9	0	0	0	0	0	112.7	S10 H15 W16 I17	S10-G13 PolarHBondContact O-N 2.92Å; S10-G13 PolarHBondContact OG-N 3.45Å; S10-G13 VanDerWaalsContact OG-N 3.1Å; G13-H15 PolarHBondContact O-N 2.91Å; G13-W16 PolarHBondContact O-N 3.16Å; G13-I17 WeakPolarHBondContact O-CG1 3.48Å; G13-I17 PolarHBondContact O-N 3.04Å; G13-I17 VanDerWaalsContact O-N 3.11Å
14	Y	92.2	Very high	89.3	Confident	64 Å²	64	62.2 Å²	62.2	25%	0.251	35%	0.345	S	S	.	.	H	α-helix	trans	-54.5	-52.8	172.9	169.9	-94.4	0	0	0	111.3	S10 S11 T12 W16 I17 S18 V57 L59	S10-Y14 WeakPolarHBondContact O-CB 3.46Å; S10-Y14 PolarHBondContact O-N 3.48Å; S11-Y14 WeakPolarHBondContact O-CB 3.49Å; S11-Y14 PolarHBondContact O-N 3.45Å; T12-Y14 PolarHBondContact O-N 3.21Å; Y14-W16 PolarHBondContact O-N 3.15Å; Y14-I17 PolarHBondContact O-N 3.33Å; Y14-S18 WeakPolarHBondContact O-CB 3.42Å; Y14-S18 PolarHBondContact O-N 3.16Å; Y14-V57 HydrophobicContact CD2-CB 4.33Å; Y14-V57 HydrophobicContact CD2-CG1 3.81Å; Y14-V57 HydrophobicContact CE2-CB 4.41Å; Y14-V57 HydrophobicContact CE2-CG1 4.36Å; Y14-V57 WeakPolarHBondContact CE2-O 3.4Å; Y14-L59 HydrophobicContact CD1-CB 4.48Å; Y14-L59 HydrophobicContact CD2-CB 3.74Å; Y14-L59 HydrophobicContact CE2-CB 4.19Å; Y14-L59 HydrophobicContact CG-CB 3.92Å
15	H	89.7	Confident	87.6	Confident	97 Å²	97	62.6 Å²	62.6	45%	0.449	36%	0.359	S	S	.	.	H	α-helix	trans	-63.6	-40.8	-179.4	-75.4	-56.8	0	0	0	112.4	S11 T12 G13 I17 S18 D19	S11-H15 PolarHBondContact O-CD2 2.92Å; S11-H15 PolarHBondContact O-N 3.33Å; T12-H15 PolarHBondContact O-N 2.83Å; G13-H15 PolarHBondContact O-N 2.91Å; H15-I17 PolarHBondContact O-N 3.5Å; H15-S18 PolarHBondContact O-N 2.92Å; H15-D19 WeakPolarHBondContact O-CB 3.33Å; H15-D19 PolarHBondContact O-N 2.92Å
16	W	88.2	Confident	86	Confident	58 Å²	58	66.9 Å²	66.9	22%	0.22	37%	0.371	C	S	.	.	H	α-helix	trans	-58.8	-47.3	178	-74.8	-8.9	0	0	0	113.7	T12 G13 Y14 G20 L27 T29 I37 W40 I41	T12-W16 HydrophobicContact CG2-CD2 3.94Å; T12-W16 HydrophobicContact CG2-CE3 4.32Å; T12-W16 HydrophobicContact CG2-CH2 3.64Å; T12-W16 HydrophobicContact CG2-CZ2 3.19Å; T12-W16 HydrophobicContact CG2-CZ3 4.19Å; T12-W16 VanDerWaalsContact O-CG 3.24Å; T12-W16 PolarHBondContact O-N 3.3Å; G13-W16 PolarHBondContact O-N 3.16Å; Y14-W16 PolarHBondContact O-N 3.15Å; W16-G20 PolarHBondContact O-N 2.72Å; W16-G20 VanDerWaalsContact O-N 3.11Å; W16-L27 HydrophobicContact CB-CD2 3.92Å; W16-L27 HydrophobicContact CD2-CD2 4.33Å; W16-L27 HydrophobicContact CG-CD2 3.58Å; W16-T29 VanDerWaalsContact CE2-CG2 3.46Å; W16-T29 HydrophobicContact CZ2-CG2 3.48Å; W16-T29 VanDerWaalsContact CZ2-CG2 3.48Å; W16-T29 VanDerWaalsContact NE1-CG2 3.25Å; W16-I37 HydrophobicContact CD2-CG2 3.56Å; W16-I37 HydrophobicContact CE3-CG1 4.4Å; W16-I37 HydrophobicContact CE3-CG2 3.43Å; W16-I37 VanDerWaalsContact CE3-CG2 3.43Å; W16-I37 HydrophobicContact CG-CG2 4.27Å; W16-I37 HydrophobicContact CH2-CB 4.42Å; W16-I37 HydrophobicContact CH2-CD1 3.25Å; W16-I37 HydrophobicContact CH2-CG1 3.63Å; W16-I37 HydrophobicContact CH2-CG2 3.91Å; W16-I37 HydrophobicContact CZ2-CD1 3.61Å; W16-I37 HydrophobicContact CZ2-CG1 4.27Å; W16-I37 HydrophobicContact CZ2-CG2 4Å; W16-I37 HydrophobicContact CZ3-CB 4.3Å; W16-I37 HydrophobicContact CZ3-CD1 3.89Å; W16-I37 HydrophobicContact CZ3-CG1 3.7Å; W16-I37 HydrophobicContact CZ3-CG2 3.62Å; W16-W40 HydrophobicContact CE3-CZ3 4.07Å; W16-I41 HydrophobicContact CB-CD1 3.65Å; W16-I41 HydrophobicContact CB-CG1 4.37Å; W16-I41 HydrophobicContact CG-CD1 4.13Å
17	I	90.6	Very high	84.6	Confident	5 Å²	5	65.1 Å²	65.1	3%	0.026	36%	0.362	C	S	.	.	H	α-helix	trans	-73.7	-43.1	179.5	-58.7	159.2	0	0	0	110.1	L6 G13 Y14 H15 D19 G20 L21 W40 V44 V57	L6-I17 HydrophobicContact CD2-CD1 3.47Å; L6-I17 VanDerWaalsContact CD2-CD1 3.47Å; G13-I17 WeakPolarHBondContact O-CG1 3.48Å; G13-I17 PolarHBondContact O-N 3.04Å; G13-I17 VanDerWaalsContact O-N 3.11Å; Y14-I17 PolarHBondContact O-N 3.33Å; H15-I17 PolarHBondContact O-N 3.5Å; I17-D19 PolarHBondContact O-N 3.29Å; I17-G20 PolarHBondContact O-N 3.46Å; I17-L21 HydrophobicContact CG2-CD1 3.85Å; I17-L21 HydrophobicContact CG2-CG 4.18Å; I17-L21 WeakPolarHBondContact O-CB 3.45Å; I17-L21 WeakPolarHBondContact O-CG 3.46Å; I17-L21 PolarHBondContact O-N 3.44Å; I17-W40 HydrophobicContact CD1-CH2 3.3Å; I17-W40 HydrophobicContact CD1-CZ2 3.8Å; I17-W40 HydrophobicContact CD1-CZ3 4.21Å; I17-W40 HydrophobicContact CG1-CH2 3.51Å; I17-W40 HydrophobicContact CG1-CZ2 4.24Å; I17-W40 HydrophobicContact CG1-CZ3 3.93Å; I17-V44 HydrophobicContact CG2-CG1 4.39Å; I17-V57 HydrophobicContact CB-CG2 4.24Å; I17-V57 HydrophobicContact CG2-CG2 3.61Å
18	S	91.6	Very high	83.2	Confident	40 Å²	40	70.1 Å²	70.1	28%	0.28	37%	0.374	S	S	.	.	H	α-helix	trans	-60.2	-45.5	179.4	-170.5	0	0	0	0	111.9	Y14 H15 L21 S22	Y14-S18 WeakPolarHBondContact O-CB 3.42Å; Y14-S18 PolarHBondContact O-N 3.16Å; H15-S18 PolarHBondContact O-N 2.92Å; S18-L21 PolarHBondContact O-N 2.64Å; S18-S22 WeakPolarHBondContact O-CB 3.38Å; S18-S22 PolarHBondContact O-N 2.82Å
19	D	88	Confident	81.8	Confident	59 Å²	59	69.7 Å²	69.7	32%	0.316	37%	0.372	S	S	.	.	H	α-helix	trans	-65.8	-39.5	176.5	-72.1	-18.8	0	0	0	111.6	H15 I17 S22 G23 K24	H15-D19 WeakPolarHBondContact O-CB 3.33Å; H15-D19 PolarHBondContact O-N 2.92Å; I17-D19 PolarHBondContact O-N 3.29Å; D19-S22 PolarHBondContact O-N 3.11Å; D19-G23 PolarHBondContact O-N 3.47Å; D19-K24 PolarHBondContact O-N 2.89Å; D19-K24 VanDerWaalsContact O-N 3.16Å
20	G	87.1	Confident	80.8	Confident	15 Å²	15	76.1 Å²	76.1	16%	0.155	40%	0.396	C	S	.	.	H	α-helix	trans	-60.6	-50.1	174.7	0	0	0	0	0	112.5	W16 I17 S22 G23	W16-G20 PolarHBondContact O-N 2.72Å; W16-G20 VanDerWaalsContact O-N 3.11Å; I17-G20 PolarHBondContact O-N 3.46Å; G20-S22 VanDerWaalsContact C-N 3.34Å; G20-S22 PolarHBondContact O-N 3.23Å; G20-G23 PolarHBondContact O-N 2.84Å; G20-G23 VanDerWaalsContact O-N 3.15Å
21	L	88.1	Confident	79.9	Confident	62 Å²	62	76.1 Å²	76.1	33%	0.325	40%	0.404	S	S	.	.	H	α-helix	trans	-64.8	-36.2	177.3	-72.2	171.5	0	0	0	112.4	I17 S18 G23 L45 V48 L55 V57	I17-L21 HydrophobicContact CG2-CD1 3.85Å; I17-L21 HydrophobicContact CG2-CG 4.18Å; I17-L21 WeakPolarHBondContact O-CB 3.45Å; I17-L21 WeakPolarHBondContact O-CG 3.46Å; I17-L21 PolarHBondContact O-N 3.44Å; S18-L21 PolarHBondContact O-N 2.64Å; L21-G23 PolarHBondContact O-N 3.44Å; L21-L45 HydrophobicContact CD2-CD2 3.64Å; L21-L45 HydrophobicContact CG-CD2 4.11Å; L21-V48 HydrophobicContact CD2-CG1 4.4Å; L21-V48 HydrophobicContact CD2-CG2 4.41Å; L21-L55 HydrophobicContact CD1-CB 4.37Å; L21-L55 HydrophobicContact CD1-CD2 3.99Å; L21-L55 HydrophobicContact CD1-CG 4.11Å; L21-L55 HydrophobicContact CD2-CB 4.49Å; L21-L55 HydrophobicContact CD2-CD2 4.3Å; L21-V57 HydrophobicContact CD1-CG2 3.77Å
22	S	87	Confident	79.1	Confident	65 Å²	65	78 Å²	78	46%	0.455	42%	0.424	S	S	.	.	T	Hydrogen-bonded Turn	trans	-69.9	-8.6	176.7	-178.3	0	0	0	0	113.1	S18 D19 G20 K24	S18-S22 WeakPolarHBondContact O-CB 3.38Å; S18-S22 PolarHBondContact O-N 2.82Å; D19-S22 PolarHBondContact O-N 3.11Å; G20-S22 VanDerWaalsContact C-N 3.34Å; G20-S22 PolarHBondContact O-N 3.23Å; S22-K24 PolarHBondContact O-N 2.99Å; S22-K24 WeakPolarHBondContact OG-CD 3.41Å; S22-K24 WeakPolarHBondContact OG-CE 3.36Å
23	G	78.7	Confident	78.5	Confident	55 Å²	55	81.6 Å²	81.6	57%	0.567	44%	0.436	S	S	*	.	T	Hydrogen-bonded Turn	trans	68	9.1	-173.3	0	0	0	0	0	113.7	D19 G20 L21 A25	D19-G23 PolarHBondContact O-N 3.47Å; G20-G23 PolarHBondContact O-N 2.84Å; G20-G23 VanDerWaalsContact O-N 3.15Å; L21-G23 PolarHBondContact O-N 3.44Å; G23-A25 PolarHBondContact O-N 3.44Å
24	K	71.5	Confident	78.1	Confident	147 Å²	147	84 Å²	84	64%	0.639	45%	0.446	S	S	*	.			trans	-78.2	62.9	172.5	-69.8	173	-176.1	164.8	0	107.9	D19 S22 R26	D19-K24 PolarHBondContact O-N 2.89Å; D19-K24 VanDerWaalsContact O-N 3.16Å; S22-K24 PolarHBondContact O-N 2.99Å; S22-K24 WeakPolarHBondContact OG-CD 3.41Å; S22-K24 WeakPolarHBondContact OG-CE 3.36Å; K24-R26 PolarHBondContact O-N 3.45Å
25	A	59.2	Low	77.8	Confident	83 Å²	83	87.8 Å²	87.8	69%	0.686	47%	0.467	S	S	*	.			trans	-64.1	17.3	-156.9	0	0	0	0	0	117.6	G23 L27	G23-A25 PolarHBondContact O-N 3.44Å; A25-L27 PolarHBondContact O-N 3.39Å
26	R	63.4	Low	77.7	Confident	195 Å²	195	88.2 Å²	88.2	74%	0.736	47%	0.472	S	S	*	.			trans	-100.8	80.6	174.9	-121.7	-179.5	110.1	-170.6	6.5	111.3	K24 R28	K24-R26 PolarHBondContact O-N 3.45Å; R26-R28 PolarHBondContact O-N 2.99Å
27	L	64.7	Low	77.5	Confident	21 Å²	21	86.5 Å²	86.5	11%	0.11	47%	0.467	C	S	.	.			trans	-50.4	103.6	156.6	-90.7	145.7	0	0	0	109.1	W16 A25 T29 I37 R38 I41	W16-L27 HydrophobicContact CB-CD2 3.92Å; W16-L27 HydrophobicContact CD2-CD2 4.33Å; W16-L27 HydrophobicContact CG-CD2 3.58Å; A25-L27 PolarHBondContact O-N 3.39Å; L27-T29 HydrophobicContact CD2-CG2 4.41Å; L27-T29 PolarHBondContact O-N 3.41Å; L27-T29 VanDerWaalsContact O-N 3.1Å; L27-I37 HydrophobicContact CD2-CG2 4.22Å; L27-R38 HydrophobicContact CD1-CG 4.32Å; L27-R38 PolarHBondContact O-NH2 3.28Å; L27-I41 HydrophobicContact CD1-CB 4.4Å; L27-I41 HydrophobicContact CD1-CD1 3.36Å; L27-I41 HydrophobicContact CD1-CG1 4.49Å; L27-I41 HydrophobicContact CD1-CG2 4.29Å; L27-I41 HydrophobicContact CD2-CD1 3.22Å; L27-I41 HydrophobicContact CG-CD1 3.82Å
28	R	65	Low	77.3	Confident	219 Å²	219	90.9 Å²	90.9	83%	0.826	48%	0.483	S	S	*	.			trans	-82	68.1	174.4	-76.1	-175.7	161.4	-174.7	-3.5	108.8	R26	R26-R28 PolarHBondContact O-N 2.99Å
29	T	64.2	Low	77.2	Confident	19 Å²	19	97.5 Å²	97.5	12%	0.117	50%	0.502	C	S	.	.			trans	-112.3	142.9	169.6	50	0	0	0	0	108.2	W16 L27 E34 I37	W16-T29 VanDerWaalsContact CE2-CG2 3.46Å; W16-T29 HydrophobicContact CZ2-CG2 3.48Å; W16-T29 VanDerWaalsContact CZ2-CG2 3.48Å; W16-T29 VanDerWaalsContact NE1-CG2 3.25Å; L27-T29 HydrophobicContact CD2-CG2 4.41Å; L27-T29 PolarHBondContact O-N 3.41Å; L27-T29 VanDerWaalsContact O-N 3.1Å; T29-E34 VanDerWaalsContact O-CD 3.27Å; T29-E34 VanDerWaalsContact O-OE2 3.05Å; T29-E34 WeakPolarHBondContact OG1-CG 3.13Å; T29-I37 HydrophobicContact CG2-CD1 4.28Å; T29-I37 HydrophobicContact CG2-CG2 4.41Å
30	K	69.9	Low	77.3	Confident	209 Å²	209	100.1 Å²	100.1	91%	0.909	51%	0.508	S	S	*	.			trans	-129.1	124.6	175.4	-71.3	-174.5	177.5	-177.8	0	106.6
31	G	72.2	Confident	77.5	Confident	50 Å²	50	99.6 Å²	99.6	52%	0.515	50%	0.501	S	S	.	.	S	Bend	trans	137.8	175.5	171.3	0	0	0	0	0	113.7	E33 E34	G31-E33 PolarHBondContact O-N 3.36Å; G31-E34 WeakPolarHBondContact O-CB 3.17Å; G31-E34 PolarHBondContact O-N 2.88Å; G31-E34 VanDerWaalsContact O-N 3.08Å
32	A	73.9	Confident	77.6	Confident	103 Å²	103	99.8 Å²	99.8	85%	0.851	51%	0.508	S	S	*	.	T	Hydrogen-bonded Turn	trans	-59.1	-31.8	-177.7	0	0	0	0	0	113.1	E34	A32-E34 VanDerWaalsContact C-N 3.28Å; A32-E34 PolarHBondContact O-N 3.2Å
33	E	75.8	Confident	78	Confident	143 Å²	143	100.2 Å²	100.2	67%	0.668	51%	0.508	S	S	*	.	T	Hydrogen-bonded Turn	trans	-78.4	-9.7	-179.5	-61.7	180	-179.6	0	0	113.6	G31 M35 L36 I37	G31-E33 PolarHBondContact O-N 3.36Å; E33-M35 PolarHBondContact O-N 2.99Å; E33-L36 PolarHBondContact O-N 3.45Å; E33-I37 HydrophobicContact CB-CD1 4.37Å; E33-I37 WeakPolarHBondContact O-CG1 3.39Å; E33-I37 PolarHBondContact O-N 3.39Å
34	E	79.3	Confident	78.6	Confident	55 Å²	55	98.8 Å²	98.8	26%	0.257	49%	0.488	S	S	.	.	H	α-helix	trans	-54.2	-41.8	178.8	169.7	171.4	-178.5	0	0	112	T29 G31 A32 L36 I37 R38	T29-E34 VanDerWaalsContact O-CD 3.27Å; T29-E34 VanDerWaalsContact O-OE2 3.05Å; T29-E34 WeakPolarHBondContact OG1-CG 3.13Å; G31-E34 WeakPolarHBondContact O-CB 3.17Å; G31-E34 PolarHBondContact O-N 2.88Å; G31-E34 VanDerWaalsContact O-N 3.08Å; A32-E34 VanDerWaalsContact C-N 3.28Å; A32-E34 PolarHBondContact O-N 3.2Å; E34-L36 VanDerWaalsContact C-N 3.31Å; E34-L36 PolarHBondContact O-N 2.9Å; E34-I37 PolarHBondContact O-N 3.01Å; E34-R38 HydrophobicContact CG-CG 4.31Å; E34-R38 WeakPolarHBondContact O-CB 3.37Å; E34-R38 VanDerWaalsContact O-CG 3.29Å; E34-R38 WeakPolarHBondContact O-CG 3.34Å; E34-R38 PolarHBondContact O-N 2.91Å; E34-R38 IonicContact OE1-CZ 3.16Å; E34-R38 IonicContact OE1-NE 2.8Å; E34-R38 PolarHBondContact OE1-NE 2.82Å; E34-R38 IonicContact OE1-NH2 2.9Å; E34-R38 PolarHBondContact OE1-NH2 3.1Å
35	M	85.6	Confident	79.6	Confident	143 Å²	143	94.5 Å²	94.5	70%	0.704	47%	0.472	S	S	*	.	H	α-helix	trans	-62	-39.9	179.8	-172.9	179.2	72.5	0	0	111.8	E33 R39	E33-M35 PolarHBondContact O-N 2.99Å; M35-R39 VanDerWaalsContact O-CB 3.32Å; M35-R39 WeakPolarHBondContact O-CB 3.34Å; M35-R39 PolarHBondContact O-N 3.44Å
36	L	87.8	Confident	81.4	Confident	106 Å²	106	93.3 Å²	93.3	56%	0.555	46%	0.458	S	S	*	.	H	α-helix	trans	-68.9	-42.9	178.9	-68	174.9	0	0	0	111.1	E33 E34 R39 W40	E33-L36 PolarHBondContact O-N 3.45Å; E34-L36 VanDerWaalsContact C-N 3.31Å; E34-L36 PolarHBondContact O-N 2.9Å; L36-R39 PolarHBondContact O-N 2.89Å; L36-W40 WeakPolarHBondContact O-CB 3.21Å; L36-W40 PolarHBondContact O-N 3.26Å
37	I	85	Confident	82.9	Confident	23 Å²	23	87.5 Å²	87.5	12%	0.118	44%	0.442	C	S	.	.	H	α-helix	trans	-62.2	-47	177.5	-65.3	157	0	0	0	110.4	W16 L27 T29 E33 E34 R39 W40 I41	W16-I37 HydrophobicContact CD2-CG2 3.56Å; W16-I37 HydrophobicContact CE3-CG1 4.4Å; W16-I37 HydrophobicContact CE3-CG2 3.43Å; W16-I37 VanDerWaalsContact CE3-CG2 3.43Å; W16-I37 HydrophobicContact CG-CG2 4.27Å; W16-I37 HydrophobicContact CH2-CB 4.42Å; W16-I37 HydrophobicContact CH2-CD1 3.25Å; W16-I37 HydrophobicContact CH2-CG1 3.63Å; W16-I37 HydrophobicContact CH2-CG2 3.91Å; W16-I37 HydrophobicContact CZ2-CD1 3.61Å; W16-I37 HydrophobicContact CZ2-CG1 4.27Å; W16-I37 HydrophobicContact CZ2-CG2 4Å; W16-I37 HydrophobicContact CZ3-CB 4.3Å; W16-I37 HydrophobicContact CZ3-CD1 3.89Å; W16-I37 HydrophobicContact CZ3-CG1 3.7Å; W16-I37 HydrophobicContact CZ3-CG2 3.62Å; L27-I37 HydrophobicContact CD2-CG2 4.22Å; T29-I37 HydrophobicContact CG2-CD1 4.28Å; T29-I37 HydrophobicContact CG2-CG2 4.41Å; E33-I37 HydrophobicContact CB-CD1 4.37Å; E33-I37 WeakPolarHBondContact O-CG1 3.39Å; E33-I37 PolarHBondContact O-N 3.39Å; E34-I37 PolarHBondContact O-N 3.01Å; I37-R39 VanDerWaalsContact C-N 3.34Å; I37-R39 PolarHBondContact O-N 3.41Å; I37-W40 PolarHBondContact O-N 2.91Å; I37-I41 HydrophobicContact CG2-CD1 3.69Å; I37-I41 WeakPolarHBondContact O-CD1 3.48Å; I37-I41 VanDerWaalsContact O-CG1 3.28Å; I37-I41 WeakPolarHBondContact O-CG1 3.45Å; I37-I41 PolarHBondContact O-N 2.9Å
38	R	84.6	Confident	84.3	Confident	96 Å²	96	87.7 Å²	87.7	36%	0.362	44%	0.444	S	S	.	.	H	α-helix	trans	-60	-43.7	176.2	-73.4	178.5	-178.6	-69.2	-8.5	111.9	L27 E34 I41 S42	L27-R38 HydrophobicContact CD1-CG 4.32Å; L27-R38 PolarHBondContact O-NH2 3.28Å; E34-R38 HydrophobicContact CG-CG 4.31Å; E34-R38 WeakPolarHBondContact O-CB 3.37Å; E34-R38 VanDerWaalsContact O-CG 3.29Å; E34-R38 WeakPolarHBondContact O-CG 3.34Å; E34-R38 PolarHBondContact O-N 2.91Å; E34-R38 IonicContact OE1-CZ 3.16Å; E34-R38 IonicContact OE1-NE 2.8Å; E34-R38 PolarHBondContact OE1-NE 2.82Å; E34-R38 IonicContact OE1-NH2 2.9Å; E34-R38 PolarHBondContact OE1-NH2 3.1Å; R38-I41 PolarHBondContact O-N 3.03Å; R38-S42 WeakPolarHBondContact O-CB 3.27Å; R38-S42 PolarHBondContact O-N 3.32Å
39	R	90	Very high	85.7	Confident	179 Å²	179	85 Å²	85	68%	0.675	44%	0.441	S	S	*	.	H	α-helix	trans	-61.2	-47.5	176.9	178.9	179.3	176.1	-176.9	-0.7	111.2	M35 L36 I37 S42 T43	M35-R39 VanDerWaalsContact O-CB 3.32Å; M35-R39 WeakPolarHBondContact O-CB 3.34Å; M35-R39 PolarHBondContact O-N 3.44Å; L36-R39 PolarHBondContact O-N 2.89Å; I37-R39 VanDerWaalsContact C-N 3.34Å; I37-R39 PolarHBondContact O-N 3.41Å; R39-S42 WeakPolarHBondContact O-CB 3.3Å; R39-S42 PolarHBondContact O-N 3.06Å; R39-T43 PolarHBondContact O-N 3.46Å; R39-T43 PolarHBondContact O-OG1 2.83Å
40	W	90.8	Very high	87.3	Confident	114 Å²	114	90.6 Å²	90.6	43%	0.432	47%	0.465	S	S	.	.	H	α-helix	trans	-59.9	-47.6	179	168.9	68	0	0	0	111.7	W16 I17 L36 I37 S42 T43 V44	W16-W40 HydrophobicContact CE3-CZ3 4.07Å; I17-W40 HydrophobicContact CD1-CH2 3.3Å; I17-W40 HydrophobicContact CD1-CZ2 3.8Å; I17-W40 HydrophobicContact CD1-CZ3 4.21Å; I17-W40 HydrophobicContact CG1-CH2 3.51Å; I17-W40 HydrophobicContact CG1-CZ2 4.24Å; I17-W40 HydrophobicContact CG1-CZ3 3.93Å; L36-W40 WeakPolarHBondContact O-CB 3.21Å; L36-W40 PolarHBondContact O-N 3.26Å; I37-W40 PolarHBondContact O-N 2.91Å; W40-S42 VanDerWaalsContact C-N 3.31Å; W40-S42 PolarHBondContact O-N 3.49Å; W40-T43 WeakPolarHBondContact O-CB 3.27Å; W40-T43 PolarHBondContact O-N 3.07Å; W40-T43 VanDerWaalsContact O-N 3.13Å; W40-V44 PolarHBondContact O-N 3.32Å
41	I	90.1	Very high	88.5	Confident	4 Å²	4	87.3 Å²	87.3	2%	0.021	45%	0.448	C	S	.	.	H	α-helix	trans	-62.8	-41.4	177.4	-64.3	160	0	0	0	110.6	W16 L27 I37 R38 T43 V44 L45	W16-I41 HydrophobicContact CB-CD1 3.65Å; W16-I41 HydrophobicContact CB-CG1 4.37Å; W16-I41 HydrophobicContact CG-CD1 4.13Å; L27-I41 HydrophobicContact CD1-CB 4.4Å; L27-I41 HydrophobicContact CD1-CD1 3.36Å; L27-I41 HydrophobicContact CD1-CG1 4.49Å; L27-I41 HydrophobicContact CD1-CG2 4.29Å; L27-I41 HydrophobicContact CD2-CD1 3.22Å; L27-I41 HydrophobicContact CG-CD1 3.82Å; I37-I41 HydrophobicContact CG2-CD1 3.69Å; I37-I41 WeakPolarHBondContact O-CD1 3.48Å; I37-I41 VanDerWaalsContact O-CG1 3.28Å; I37-I41 WeakPolarHBondContact O-CG1 3.45Å; I37-I41 PolarHBondContact O-N 2.9Å; R38-I41 PolarHBondContact O-N 3.03Å; I41-T43 VanDerWaalsContact C-N 3.29Å; I41-T43 PolarHBondContact O-N 3.02Å; I41-V44 PolarHBondContact O-N 3.34Å; I41-L45 HydrophobicContact CG2-CD1 3.91Å; I41-L45 HydrophobicContact CG2-CG 4.2Å; I41-L45 WeakPolarHBondContact O-CG 3.39Å; I41-L45 PolarHBondContact O-N 3.18Å
42	S	90.7	Very high	89.6	Confident	66 Å²	66	88.1 Å²	88.1	46%	0.462	45%	0.45	S	S	.	.	H	α-helix	trans	-57.5	-43.5	174.7	-172.2	0	0	0	0	111.5	R38 R39 W40 L45 S46	R38-S42 WeakPolarHBondContact O-CB 3.27Å; R38-S42 PolarHBondContact O-N 3.32Å; R39-S42 WeakPolarHBondContact O-CB 3.3Å; R39-S42 PolarHBondContact O-N 3.06Å; W40-S42 VanDerWaalsContact C-N 3.31Å; W40-S42 PolarHBondContact O-N 3.49Å; S42-L45 PolarHBondContact O-N 3.11Å; S42-S46 WeakPolarHBondContact O-CB 3.43Å; S42-S46 PolarHBondContact O-N 3.03Å; S42-S46 PolarHBondContact O-OG 3.5Å
43	T	94.7	Very high	90.6	Very high	74 Å²	74	84.8 Å²	84.8	45%	0.454	42%	0.418	S	S	.	.	H	α-helix	trans	-61	-46.4	175.5	-61.8	0	0	0	0	111.5	R39 W40 I41 L45 S46 L47	R39-T43 PolarHBondContact O-N 3.46Å; R39-T43 PolarHBondContact O-OG1 2.83Å; W40-T43 WeakPolarHBondContact O-CB 3.27Å; W40-T43 PolarHBondContact O-N 3.07Å; W40-T43 VanDerWaalsContact O-N 3.13Å; I41-T43 VanDerWaalsContact C-N 3.29Å; I41-T43 PolarHBondContact O-N 3.02Å; T43-L45 PolarHBondContact O-N 3.17Å; T43-S46 PolarHBondContact O-N 3.13Å; T43-L47 HydrophobicContact CG2-CD1 4.1Å; T43-L47 HydrophobicContact CG2-CG 4.48Å; T43-L47 VanDerWaalsContact O-CG 3.26Å; T43-L47 WeakPolarHBondContact O-CG 3.09Å; T43-L47 PolarHBondContact O-N 2.94Å
44	V	93.2	Very high	91.6	Very high	25 Å²	25	82.7 Å²	82.7	15%	0.152	41%	0.408	C	S	.	.	H	α-helix	trans	-59	-47.4	177.7	174.7	0	0	0	0	110.9	I17 W40 I41 L47 V48 L55	I17-V44 HydrophobicContact CG2-CG1 4.39Å; W40-V44 PolarHBondContact O-N 3.32Å; I41-V44 PolarHBondContact O-N 3.34Å; V44-L47 PolarHBondContact O-N 3.02Å; V44-V48 WeakPolarHBondContact O-CG2 3.4Å; V44-V48 PolarHBondContact O-N 3.1Å; V44-L55 HydrophobicContact CG1-CD2 3.92Å
45	L	92.5	Very high	92.3	Very high	57 Å²	57	81.6 Å²	81.6	30%	0.298	40%	0.404	S	S	.	.	H	α-helix	trans	-64.6	-42.2	179.7	-66.3	176.1	0	0	0	112.3	L21 I41 S42 T43 L47 V48 E49	L21-L45 HydrophobicContact CD2-CD2 3.64Å; L21-L45 HydrophobicContact CG-CD2 4.11Å; I41-L45 HydrophobicContact CG2-CD1 3.91Å; I41-L45 HydrophobicContact CG2-CG 4.2Å; I41-L45 WeakPolarHBondContact O-CG 3.39Å; I41-L45 PolarHBondContact O-N 3.18Å; S42-L45 PolarHBondContact O-N 3.11Å; T43-L45 PolarHBondContact O-N 3.17Å; L45-L47 VanDerWaalsContact C-N 3.31Å; L45-L47 PolarHBondContact O-N 3.28Å; L45-V48 PolarHBondContact O-N 3.39Å; L45-E49 PolarHBondContact O-N 2.8Å
46	S	95.2	Very high	92.8	Very high	58 Å²	58	77.3 Å²	77.3	41%	0.406	39%	0.388	S	S	.	.	H	α-helix	trans	-60.4	-39.9	175	-65.5	0	0	0	0	112	S42 T43 E49 E50	S42-S46 WeakPolarHBondContact O-CB 3.43Å; S42-S46 PolarHBondContact O-N 3.03Å; S42-S46 PolarHBondContact O-OG 3.5Å; T43-S46 PolarHBondContact O-N 3.13Å; S46-E49 PolarHBondContact O-N 2.96Å; S46-E50 WeakPolarHBondContact O-CB 3.34Å; S46-E50 PolarHBondContact O-N 3.29Å
47	L	95.7	Very high	93.1	Very high	73 Å²	73	73.3 Å²	73.3	38%	0.382	37%	0.367	S	S	.	.	H	α-helix	trans	-67	-39.7	176	-67.9	170.1	0	0	0	111.8	T43 V44 L45 E49 Y51	T43-L47 HydrophobicContact CG2-CD1 4.1Å; T43-L47 HydrophobicContact CG2-CG 4.48Å; T43-L47 VanDerWaalsContact O-CG 3.26Å; T43-L47 WeakPolarHBondContact O-CG 3.09Å; T43-L47 PolarHBondContact O-N 2.94Å; V44-L47 PolarHBondContact O-N 3.02Å; L45-L47 VanDerWaalsContact C-N 3.31Å; L45-L47 PolarHBondContact O-N 3.28Å; L47-E49 VanDerWaalsContact C-N 3.29Å; L47-E49 PolarHBondContact O-N 2.91Å; L47-Y51 HydrophobicContact CB-CD2 4.38Å; L47-Y51 HydrophobicContact CD2-CD2 4.12Å; L47-Y51 HydrophobicContact CD2-CE2 3.61Å; L47-Y51 WeakPolarHBondContact O-CB 3.47Å; L47-Y51 VanDerWaalsContact O-CD2 3.3Å; L47-Y51 WeakPolarHBondContact O-CD2 3.42Å; L47-Y51 PolarHBondContact O-N 3.3Å
48	V	94.6	Very high	93.6	Very high	25 Å²	25	74.6 Å²	74.6	15%	0.152	38%	0.376	C	S	.	.	H	α-helix	trans	-60.4	-43	175.9	171.1	0	0	0	0	110.9	L21 V44 L45 A52 L53 L55	L21-V48 HydrophobicContact CD2-CG1 4.4Å; L21-V48 HydrophobicContact CD2-CG2 4.41Å; V44-V48 WeakPolarHBondContact O-CG2 3.4Å; V44-V48 PolarHBondContact O-N 3.1Å; L45-V48 PolarHBondContact O-N 3.39Å; V48-A52 WeakPolarHBondContact O-CA 3.26Å; V48-A52 PolarHBondContact O-N 3.24Å; V48-A52 VanDerWaalsContact O-N 3.16Å; V48-L53 HydrophobicContact CG1-CB 4.41Å; V48-L53 WeakPolarHBondContact CG1-O 3.4Å; V48-L53 PolarHBondContact O-N 3.13Å; V48-L55 HydrophobicContact CG2-CB 3.81Å; V48-L55 HydrophobicContact CG2-CD2 3.54Å; V48-L55 HydrophobicContact CG2-CG 4.3Å
49	E	94.5	Very high	94.2	Very high	163 Å²	163	73.5 Å²	73.5	76%	0.762	38%	0.378	S	S	*	.	H	α-helix	trans	-68.7	-52.5	177.2	-174.5	173.8	-165.3	0	0	112.2	L45 S46 L47 Y51 A52	L45-E49 PolarHBondContact O-N 2.8Å; S46-E49 PolarHBondContact O-N 2.96Å; L47-E49 VanDerWaalsContact C-N 3.29Å; L47-E49 PolarHBondContact O-N 2.91Å; E49-Y51 VanDerWaalsContact C-N 3.32Å; E49-Y51 PolarHBondContact O-N 3.14Å; E49-A52 PolarHBondContact O-N 3.35Å; E49-A52 VanDerWaalsContact O-N 3.16Å
50	E	96.5	Very high	94.5	Very high	136 Å²	136	66.4 Å²	66.4	64%	0.636	35%	0.354	S	S	*	.	H	α-helix	trans	-57.8	-43.1	-177.2	-178	179.8	171	0	0	112.2	S46	S46-E50 WeakPolarHBondContact O-CB 3.34Å; S46-E50 PolarHBondContact O-N 3.29Å
51	Y	96.4	Very high	94.6	Very high	141 Å²	141	67 Å²	67	55%	0.553	36%	0.359	S	S	*	.	T	Hydrogen-bonded Turn	trans	-95.2	5.9	-177.7	-65.5	-72.7	0	0	0	113.7	L47 E49 L53	L47-Y51 HydrophobicContact CB-CD2 4.38Å; L47-Y51 HydrophobicContact CD2-CD2 4.12Å; L47-Y51 HydrophobicContact CD2-CE2 3.61Å; L47-Y51 WeakPolarHBondContact O-CB 3.47Å; L47-Y51 VanDerWaalsContact O-CD2 3.3Å; L47-Y51 WeakPolarHBondContact O-CD2 3.42Å; L47-Y51 PolarHBondContact O-N 3.3Å; E49-Y51 VanDerWaalsContact C-N 3.32Å; E49-Y51 PolarHBondContact O-N 3.14Å; Y51-L53 VanDerWaalsContact C-N 3.27Å; Y51-L53 PolarHBondContact O-N 2.85Å
52	A	95.1	Very high	94.4	Very high	67 Å²	67	69.4 Å²	69.4	55%	0.554	38%	0.377	S	S	*	.	T	Hydrogen-bonded Turn	trans	46.1	52.1	-176.4	0	0	0	0	0	112	M1 V48 E49	M1-A52 WeakPolarHBondContact CG-O 3.37Å; V48-A52 WeakPolarHBondContact O-CA 3.26Å; V48-A52 PolarHBondContact O-N 3.24Å; V48-A52 VanDerWaalsContact O-N 3.16Å; E49-A52 PolarHBondContact O-N 3.35Å; E49-A52 VanDerWaalsContact O-N 3.16Å
53	L	95.3	Very high	94.1	Very high	32 Å²	32	72.6 Å²	72.6	17%	0.168	38%	0.384	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-85.8	142.5	-175.9	-57.3	173.4	0	0	0	110.7	K2 I4 V48 Y51 L55	K2-L53 HydrophobicContact CB-CD2 3.89Å; I4-L53 HydrophobicContact CD1-CD1 3.86Å; I4-L53 HydrophobicContact CD1-CD2 3.87Å; I4-L53 HydrophobicContact CD1-CG 4.39Å; I4-L53 HydrophobicContact CG1-CD2 4.37Å; V48-L53 HydrophobicContact CG1-CB 4.41Å; V48-L53 WeakPolarHBondContact CG1-O 3.4Å; V48-L53 PolarHBondContact O-N 3.13Å; Y51-L53 VanDerWaalsContact C-N 3.27Å; Y51-L53 PolarHBondContact O-N 2.85Å; L53-L55 PolarHBondContact O-N 2.68Å
54	Q	95.5	Very high	93.8	Very high	99 Å²	99	74.2 Å²	74.2	46%	0.463	39%	0.391	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.2	95.4	161.6	-172.9	-177.7	35.3	0	0	107.8	M1 K2 T3 I4	M1-Q54 HydrophobicContact CE-CB 4.09Å; M1-Q54 HydrophobicContact CE-CG 4.43Å; M1-Q54 HydrophobicContact CG-CB 4.27Å; M1-Q54 HydrophobicContact SD-CB 4.49Å; K2-Q54 PolarHBondContact O-N 3.23Å; T3-Q54 WeakPolarHBondContact CA-O 3.28Å; T3-Q54 HydrophobicContact CG2-CB 4.43Å; T3-Q54 HydrophobicContact CG2-CG 4.46Å; T3-Q54 PolarHBondContact OG1-OE1 2.97Å; I4-Q54 PolarHBondContact N-O 3.26Å
55	L	95.3	Very high	93.7	Very high	33 Å²	33	74.6 Å²	74.6	17%	0.173	39%	0.392	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.6	127	179.8	-174.9	61.5	0	0	0	110.6	I4 L6 L21 V44 V48 L53	I4-L55 HydrophobicContact CB-CD1 4.13Å; I4-L55 HydrophobicContact CG2-CD1 4.03Å; I4-L55 WeakPolarHBondContact O-CA 3.5Å; L6-L55 HydrophobicContact CB-CD1 3.91Å; L21-L55 HydrophobicContact CD1-CB 4.37Å; L21-L55 HydrophobicContact CD1-CD2 3.99Å; L21-L55 HydrophobicContact CD1-CG 4.11Å; L21-L55 HydrophobicContact CD2-CB 4.49Å; L21-L55 HydrophobicContact CD2-CD2 4.3Å; V44-L55 HydrophobicContact CG1-CD2 3.92Å; V48-L55 HydrophobicContact CG2-CB 3.81Å; V48-L55 HydrophobicContact CG2-CD2 3.54Å; V48-L55 HydrophobicContact CG2-CG 4.3Å; L53-L55 PolarHBondContact O-N 2.68Å
56	S	94.8	Very high	93.5	Very high	52 Å²	52	78.9 Å²	78.9	36%	0.364	41%	0.41	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-112.7	150.8	165.7	57.6	0	0	0	0	109.2	I4 L6	I4-S56 PolarHBondContact O-N 2.8Å; I4-S56 PolarHBondContact O-OG 2.96Å; L6-S56 PolarHBondContact N-O 3.44Å
57	V	94.8	Very high	93.2	Very high	22 Å²	22	78.8 Å²	78.8	13%	0.133	41%	0.413	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.2	130.5	179.1	-166.6	0	0	0	0	108.6	L6 T8 Y14 I17 L21	L6-V57 CarbonylContact O-C 3.5Å; L6-V57 VanDerWaalsContact O-CA 3.27Å; L6-V57 WeakPolarHBondContact O-CA 3.33Å; T8-V57 HydrophobicContact CG2-CG1 4.24Å; Y14-V57 HydrophobicContact CD2-CB 4.33Å; Y14-V57 HydrophobicContact CD2-CG1 3.81Å; Y14-V57 HydrophobicContact CE2-CB 4.41Å; Y14-V57 HydrophobicContact CE2-CG1 4.36Å; Y14-V57 WeakPolarHBondContact CE2-O 3.4Å; I17-V57 HydrophobicContact CB-CG2 4.24Å; I17-V57 HydrophobicContact CG2-CG2 3.61Å; L21-V57 HydrophobicContact CD1-CG2 3.77Å
58	T	96.2	Very high	92.8	Very high	50 Å²	50	77 Å²	77	31%	0.307	40%	0.403	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.5	127.1	-179.2	-61.1	0	0	0	0	109.3	E5 L6 M7 T8	E5-T58 WeakPolarHBondContact OE1-CB 3.49Å; E5-T58 PolarHBondContact OE1-OG1 2.9Å; L6-T58 PolarHBondContact O-N 3.3Å; M7-T58 WeakPolarHBondContact CA-O 3.43Å; M7-T58 HydrophobicContact CE-CG2 4.48Å; T8-T58 PolarHBondContact N-O 3.47Å
59	L	96.7	Very high	92.4	Very high	74 Å²	74	79 Å²	79	39%	0.387	42%	0.419	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.3	114.2	171.7	-178.5	59.2	0	0	0	108.9	T8 Y14	T8-L59 CarbonylContact O-C 3.57Å; T8-L59 VanDerWaalsContact O-CA 3.27Å; T8-L59 WeakPolarHBondContact O-CA 3.35Å; T8-L59 WeakPolarHBondContact O-CD1 3.29Å; Y14-L59 HydrophobicContact CD1-CB 4.48Å; Y14-L59 HydrophobicContact CD2-CB 3.74Å; Y14-L59 HydrophobicContact CE2-CB 4.19Å; Y14-L59 HydrophobicContact CG-CB 3.92Å
60	V	95.9	Very high	92.1	Very high	29 Å²	29	77.8 Å²	77.8	18%	0.176	42%	0.417	C	S	.	.			trans	-92.6	132	177.6	-175.7	0	0	0	0	108.3	M7 T8 D9 D64 N65	M7-V60 HydrophobicContact CB-CG2 3.85Å; M7-V60 HydrophobicContact CE-CG2 3.97Å; M7-V60 HydrophobicContact CG-CG2 4.38Å; T8-V60 PolarHBondContact O-N 2.95Å; D9-V60 WeakPolarHBondContact CA-O 3.44Å; V60-D64 HydrophobicContact CG1-CB 4.04Å; V60-N65 HydrophobicContact CG1-CB 4.28Å
61	K	92.1	Very high	91.6	Very high	126 Å²	126	76 Å²	76	55%	0.548	42%	0.415	S	S	.	.			trans	-71.2	147.1	173.8	-60.7	177.7	-178.9	170.2	0	109.7	E63 D64 N65	K61-E63 HydrophobicContact CB-CG 3.89Å; K61-E63 HydrophobicContact CD-CG 4.08Å; K61-E63 WeakPolarHBondContact CD-OE1 3.09Å; K61-E63 IonicContact NZ-OE1 2.68Å; K61-E63 PolarHBondContact NZ-OE1 3.24Å; K61-E63 PolarHBondContact O-N 3.3Å; K61-E63 VanDerWaalsContact O-N 3.14Å; K61-D64 CarbonylContact O-C 3.5Å; K61-D64 WeakPolarHBondContact O-CA 3.43Å; K61-D64 PolarHBondContact O-N 2.97Å; K61-N65 PolarHBondContact O-N 3.33Å
62	S	86	Confident	91	Very high	56 Å²	56	75.6 Å²	75.6	39%	0.392	42%	0.418	S	S	.	.	T	Hydrogen-bonded Turn	trans	-56.7	-31.2	176.5	-72.4	0	0	0	0	114	D64 N65 D68	S62-D64 PolarHBondContact O-N 2.73Å; S62-N65 PolarHBondContact O-N 3.41Å; S62-D68 VanDerWaalsContact CA-OD2 3.28Å; S62-D68 WeakPolarHBondContact CA-OD2 3.28Å; S62-D68 WeakPolarHBondContact CB-OD2 3.32Å; S62-D68 WeakPolarHBondContact O-CB 3.42Å; S62-D68 PolarHBondContact OG-OD2 2.87Å
63	E	84.3	Confident	90.5	Very high	132 Å²	132	75.9 Å²	75.9	62%	0.617	41%	0.413	S	S	*	.	T	Hydrogen-bonded Turn	trans	-63.8	-29.2	174.9	66.6	-169.5	-178.9	0	0	113.3	K61	K61-E63 HydrophobicContact CB-CG 3.89Å; K61-E63 HydrophobicContact CD-CG 4.08Å; K61-E63 WeakPolarHBondContact CD-OE1 3.09Å; K61-E63 IonicContact NZ-OE1 2.68Å; K61-E63 PolarHBondContact NZ-OE1 3.24Å; K61-E63 PolarHBondContact O-N 3.3Å; K61-E63 VanDerWaalsContact O-N 3.14Å
64	D	90.2	Very high	89.9	Confident	109 Å²	109	76.3 Å²	76.3	58%	0.583	42%	0.418	S	S	*	.	T	Hydrogen-bonded Turn	trans	-96.8	-14.6	179.2	-58.2	-48.9	0	0	0	111.9	V60 K61 S62 Q66	V60-D64 HydrophobicContact CG1-CB 4.04Å; K61-D64 CarbonylContact O-C 3.5Å; K61-D64 WeakPolarHBondContact O-CA 3.43Å; K61-D64 PolarHBondContact O-N 2.97Å; S62-D64 PolarHBondContact O-N 2.73Å; D64-Q66 PolarHBondContact O-N 3.25Å
65	N	89.6	Confident	89.3	Confident	32 Å²	32	79.2 Å²	79.2	17%	0.171	43%	0.431	C	S	.	.			trans	-73.6	115.5	177.7	-178.1	11	0	0	0	109.6	D9 V60 K61 S62 A67 D68 S69	D9-N65 PolarHBondContact OD2-ND2 2.75Å; V60-N65 HydrophobicContact CG1-CB 4.28Å; K61-N65 PolarHBondContact O-N 3.33Å; S62-N65 PolarHBondContact O-N 3.41Å; N65-A67 PolarHBondContact O-N 3.09Å; N65-A67 PolarHBondContact OD1-N 3.1Å; N65-A67 VanDerWaalsContact OD1-N 3.13Å; N65-D68 HydrophobicContact CB-CB 4.07Å; N65-D68 PolarHBondContact ND2-OD1 3.08Å; N65-D68 PolarHBondContact ND2-OD2 3.23Å; N65-D68 VanDerWaalsContact ND2-OD2 3.09Å; N65-D68 PolarHBondContact O-N 3.49Å; N65-S69 WeakPolarHBondContact O-CB 3.24Å; N65-S69 PolarHBondContact O-N 2.93Å; N65-S69 PolarHBondContact O-OG 3.41Å
66	Q	89	Confident	88.7	Confident	148 Å²	148	86.4 Å²	86.4	69%	0.692	46%	0.456	S	S	*	.	H	α-helix	trans	-60.6	-34	179.8	-174.4	179	-35.7	0	0	111.9	D64 S69 L70	D64-Q66 PolarHBondContact O-N 3.25Å; Q66-S69 PolarHBondContact O-N 3.06Å; Q66-L70 HydrophobicContact CG-CD1 3.99Å; Q66-L70 HydrophobicContact CG-CG 4.35Å; Q66-L70 WeakPolarHBondContact O-CB 3.4Å; Q66-L70 WeakPolarHBondContact O-CG 3.12Å; Q66-L70 PolarHBondContact O-N 3.05Å
67	A	89	Confident	88.2	Confident	55 Å²	55	92.2 Å²	92.2	46%	0.455	47%	0.47	S	S	.	.	H	α-helix	trans	-64.7	-47.7	178.2	0	0	0	0	0	111.1	N65 L70 T71	N65-A67 PolarHBondContact O-N 3.09Å; N65-A67 PolarHBondContact OD1-N 3.1Å; N65-A67 VanDerWaalsContact OD1-N 3.13Å; A67-L70 PolarHBondContact O-N 3.44Å; A67-T71 WeakPolarHBondContact O-CB 3.38Å; A67-T71 WeakPolarHBondContact O-CG2 3.39Å; A67-T71 PolarHBondContact O-N 2.77Å; A67-T71 PolarHBondContact O-OG1 3.02Å
68	D	86.6	Confident	87.7	Confident	35 Å²	35	95.7 Å²	95.7	19%	0.187	49%	0.491	C	S	.	.	H	α-helix	trans	-64.4	-42.4	175.7	-68.6	-18.9	0	0	0	111	S62 N65 L70 T71 H72	S62-D68 VanDerWaalsContact CA-OD2 3.28Å; S62-D68 WeakPolarHBondContact CA-OD2 3.28Å; S62-D68 WeakPolarHBondContact CB-OD2 3.32Å; S62-D68 WeakPolarHBondContact O-CB 3.42Å; S62-D68 PolarHBondContact OG-OD2 2.87Å; N65-D68 HydrophobicContact CB-CB 4.07Å; N65-D68 PolarHBondContact ND2-OD1 3.08Å; N65-D68 PolarHBondContact ND2-OD2 3.23Å; N65-D68 VanDerWaalsContact ND2-OD2 3.09Å; N65-D68 PolarHBondContact O-N 3.49Å; D68-L70 PolarHBondContact O-N 3.28Å; D68-T71 CarbonylContact O-C 3.57Å; D68-T71 PolarHBondContact O-N 2.98Å; D68-T71 VanDerWaalsContact O-N 3.1Å; D68-H72 WeakPolarHBondContact O-CA 3.45Å; D68-H72 VanDerWaalsContact O-CB 3.24Å; D68-H72 WeakPolarHBondContact O-CB 3.19Å; D68-H72 PolarHBondContact O-CD2 3.38Å; D68-H72 PolarHBondContact O-N 3.21Å
69	S	86.3	Confident	86.9	Confident	69 Å²	69	97 Å²	97	48%	0.483	50%	0.499	S	S	.	.	H	α-helix	trans	-56.3	-39.1	175.9	-64.3	0	0	0	0	112.5	N65 Q66	N65-S69 WeakPolarHBondContact O-CB 3.24Å; N65-S69 PolarHBondContact O-N 2.93Å; N65-S69 PolarHBondContact O-OG 3.41Å; Q66-S69 PolarHBondContact O-N 3.06Å
70	L	87.7	Confident	85.7	Confident	136 Å²	136	98.8 Å²	98.8	71%	0.712	52%	0.515	S	S	*	.	H	α-helix	trans	-80.4	-22.6	179.6	-69.4	173.5	0	0	0	113.4	Q66 A67 D68	Q66-L70 HydrophobicContact CG-CD1 3.99Å; Q66-L70 HydrophobicContact CG-CG 4.35Å; Q66-L70 WeakPolarHBondContact O-CB 3.4Å; Q66-L70 WeakPolarHBondContact O-CG 3.12Å; Q66-L70 PolarHBondContact O-N 3.05Å; A67-L70 PolarHBondContact O-N 3.44Å; D68-L70 PolarHBondContact O-N 3.28Å
71	T	87	Confident	84.5	Confident	98 Å²	98	102.8 Å²	102.8	60%	0.601	54%	0.544	S	S	*	.	H	α-helix	trans	-109.6	1.2	-176.4	59.3	0	0	0	0	113.3	A67 D68 V73	A67-T71 WeakPolarHBondContact O-CB 3.38Å; A67-T71 WeakPolarHBondContact O-CG2 3.39Å; A67-T71 PolarHBondContact O-N 2.77Å; A67-T71 PolarHBondContact O-OG1 3.02Å; D68-T71 CarbonylContact O-C 3.57Å; D68-T71 PolarHBondContact O-N 2.98Å; D68-T71 VanDerWaalsContact O-N 3.1Å; T71-V73 PolarHBondContact O-N 2.99Å
72	H	82.9	Confident	83.3	Confident	134 Å²	134	103.6 Å²	103.6	62%	0.62	56%	0.56	S	S	*	*			trans	-61.8	109.7	-176.6	-127.3	-75.3	0	0	0	110.3	D68	D68-H72 WeakPolarHBondContact O-CA 3.45Å; D68-H72 VanDerWaalsContact O-CB 3.24Å; D68-H72 WeakPolarHBondContact O-CB 3.19Å; D68-H72 PolarHBondContact O-CD2 3.38Å; D68-H72 PolarHBondContact O-N 3.21Å
73	V	84.6	Confident	82.6	Confident	72 Å²	72	102.8 Å²	102.8	44%	0.436	56%	0.561	S	S	.	*			trans	-78.7	140.8	174	-69.6	0	0	0	0	109.6	T71 Q75 W77 V78	T71-V73 PolarHBondContact O-N 2.99Å; V73-Q75 PolarHBondContact O-N 3.42Å; V73-W77 HydrophobicContact CB-CE3 4.06Å; V73-W77 HydrophobicContact CG1-CE3 4.05Å; V73-W77 HydrophobicContact CG1-CZ3 4.41Å; V73-V78 HydrophobicContact CG2-CG2 3.44Å; V73-V78 VanDerWaalsContact CG2-CG2 3.44Å
74	P	83.6	Confident	81.5	Confident	42 Å²	42	103.1 Å²	103.1	27%	0.273	57%	0.574	S	S	.	*			trans	-55.5	136.2	173.4	-25.8	33.7	0	0	0	111.2	R76 W77	P74-R76 HydrophobicContact CB-CG 3.96Å; P74-R76 PolarHBondContact O-N 3.07Å; P74-W77 HydrophobicContact CB-CD2 4.49Å; P74-W77 HydrophobicContact CB-CG 4.35Å; P74-W77 HydrophobicContact CG-CD2 4.14Å; P74-W77 HydrophobicContact CG-CZ2 4.49Å; P74-W77 WeakPolarHBondContact O-CA 3.27Å; P74-W77 VanDerWaalsContact O-CB 3.27Å; P74-W77 WeakPolarHBondContact O-CB 3.48Å; P74-W77 PolarHBondContact O-N 3.06Å
75	Q	82.5	Confident	80.2	Confident	159 Å²	159	103.2 Å²	103.2	74%	0.743	58%	0.584	S	S	*	*	H	α-helix	trans	-59.7	-27.6	-176.2	-163.6	162.4	-14	0	0	113.2	V73 W77 V78 T79	V73-Q75 PolarHBondContact O-N 3.42Å; Q75-W77 PolarHBondContact O-N 3.1Å; Q75-V78 PolarHBondContact O-N 3.2Å; Q75-V78 VanDerWaalsContact O-N 3.07Å; Q75-T79 PolarHBondContact O-N 2.95Å; Q75-T79 PolarHBondContact O-OG1 2.79Å; Q75-T79 VanDerWaalsContact O-OG1 3.1Å
76	R	84.1	Confident	79	Confident	184 Å²	184	106.3 Å²	106.3	69%	0.694	61%	0.607	S	S	*	*	H	α-helix	trans	-61	-20.3	171.2	71.3	178.2	-170	-83.1	-5.1	114.3	P74	P74-R76 HydrophobicContact CB-CG 3.96Å; P74-R76 PolarHBondContact O-N 3.07Å
77	W	84	Confident	77.8	Confident	175 Å²	175	104.3 Å²	104.3	66%	0.663	61%	0.608	S	S	*	*	H	α-helix	trans	-85.1	-27.7	174.6	-66.2	-3.2	0	0	0	112.2	V73 P74 Q75	V73-W77 HydrophobicContact CB-CE3 4.06Å; V73-W77 HydrophobicContact CG1-CE3 4.05Å; V73-W77 HydrophobicContact CG1-CZ3 4.41Å; P74-W77 HydrophobicContact CB-CD2 4.49Å; P74-W77 HydrophobicContact CB-CG 4.35Å; P74-W77 HydrophobicContact CG-CD2 4.14Å; P74-W77 HydrophobicContact CG-CZ2 4.49Å; P74-W77 WeakPolarHBondContact O-CA 3.27Å; P74-W77 VanDerWaalsContact O-CB 3.27Å; P74-W77 WeakPolarHBondContact O-CB 3.48Å; P74-W77 PolarHBondContact O-N 3.06Å; Q75-W77 PolarHBondContact O-N 3.1Å
78	V	84	Confident	76.8	Confident	95 Å²	95	108.3 Å²	108.3	58%	0.576	63%	0.626	S	S	*	*	H	α-helix	trans	-86.8	-37	-178.4	-173.4	0	0	0	0	111	V73 Q75 P80	V73-V78 HydrophobicContact CG2-CG2 3.44Å; V73-V78 VanDerWaalsContact CG2-CG2 3.44Å; Q75-V78 PolarHBondContact O-N 3.2Å; Q75-V78 VanDerWaalsContact O-N 3.07Å; V78-P80 WeakPolarHBondContact O-CD 3.21Å
79	T	79.5	Confident	75.5	Confident	78 Å²	78	111.8 Å²	111.8	48%	0.479	65%	0.652	S	S	.	*	S	Bend	trans	-71	114.6	178.2	-52.5	0	0	0	0	109	Q75 S81	Q75-T79 PolarHBondContact O-N 2.95Å; Q75-T79 PolarHBondContact O-OG1 2.79Å; Q75-T79 VanDerWaalsContact O-OG1 3.1Å; T79-S81 PolarHBondContact O-N 3.03Å
80	P	71	Confident	74.6	Confident	111 Å²	111	114.8 Å²	114.8	72%	0.721	67%	0.667	S	S	*	*			trans	-58.2	126.8	172.5	23	-30.5	0	0	0	108.1	V78 T82	V78-P80 WeakPolarHBondContact O-CD 3.21Å; P80-T82 PolarHBondContact O-N 3.18Å
81	S	69.7	Low	73.5	Confident	112 Å²	112	112.6 Å²	112.6	78%	0.783	67%	0.669	S	S	*	*			trans	-57.2	116.1	177.8	-172.2	0	0	0	0	108.3	T79 G83	T79-S81 PolarHBondContact O-N 3.03Å; S81-G83 PolarHBondContact O-N 2.9Å
82	T	67.4	Low	72.3	Confident	143 Å²	143	114 Å²	114	88%	0.877	68%	0.677	S	S	*	*			trans	-67.4	13.8	-178.2	-34.6	0	0	0	0	113.2	P80	P80-T82 PolarHBondContact O-N 3.18Å
83	G	71.4	Confident	71.5	Confident	40 Å²	40	111.2 Å²	111.2	41%	0.412	68%	0.677	S	S	.	*	S	Bend	trans	-66.4	155.3	170.4	0	0	0	0	0	110.9	S81 S85	S81-G83 PolarHBondContact O-N 2.9Å; G83-S85 PolarHBondContact O-N 2.85Å
84	P	62.3	Low	71	Confident	138 Å²	138	112.2 Å²	112.2	90%	0.896	68%	0.68	S	S	*	*			trans	-54.6	111.5	176.8	23.2	-32.3	0	0	0	108.8	S86	P84-S86 PolarHBondContact O-N 2.9Å
85	S	61.6	Low	70.8	Confident	112 Å²	112	114.8 Å²	114.8	78%	0.783	70%	0.696	S	S	*	*			trans	-67.4	100.8	175.6	70.4	0	0	0	0	106.8	G83	G83-S85 PolarHBondContact O-N 2.85Å
86	S	65.4	Low	70.9	Confident	96 Å²	96	108.7 Å²	108.7	67%	0.671	68%	0.676	S	S	*	*			trans	-46.9	129.3	160.6	171.5	0	0	0	0	107.5	P84 V88	P84-S86 PolarHBondContact O-N 2.9Å; S86-V88 PolarHBondContact O-N 3.22Å
87	P	63.3	Low	70.7	Confident	107 Å²	107	101.9 Å²	101.9	70%	0.695	66%	0.66	S	S	*	*			trans	-55.4	117.1	-179.6	21.8	-31	0	0	0	108.5	C89	P87-C89 VanDerWaalsContact C-N 3.35Å; P87-C89 PolarHBondContact O-N 3.41Å
88	V	67.3	Low	70.4	Confident	138 Å²	138	99.1 Å²	99.1	84%	0.836	66%	0.655	S	S	*	*			trans	-68.3	98.4	173.9	177.2	0	0	0	0	106.1	S86 V90	S86-V88 PolarHBondContact O-N 3.22Å; V88-V90 PolarHBondContact O-N 3.48Å
89	C	60.7	Low	70.5	Confident	109 Å²	109	104 Å²	104	74%	0.736	66%	0.664	S	S	*	*			trans	-63.9	124.1	173	-73.4	0	0	0	0	108.6	P87 A91	P87-C89 VanDerWaalsContact C-N 3.35Å; P87-C89 PolarHBondContact O-N 3.41Å; C89-A91 PolarHBondContact O-N 2.94Å
90	V	67.7	Low	70.9	Confident	131 Å²	131	106.2 Å²	106.2	79%	0.794	67%	0.672	S	S	*	*			trans	-62.1	107.9	165.2	172.9	0	0	0	0	106.4	V88 V92	V88-V90 PolarHBondContact O-N 3.48Å; V90-V92 PolarHBondContact O-N 3.29Å
91	A	63.6	Low	71.5	Confident	91 Å²	91	105.1 Å²	105.1	75%	0.752	66%	0.659	S	S	*	*			trans	-61.4	109.4	165.4	0	0	0	0	0	106.4	C89 A93	C89-A91 PolarHBondContact O-N 2.94Å; A91-A93 PolarHBondContact O-N 2.98Å; A91-A93 VanDerWaalsContact O-N 3.16Å
92	V	61.2	Low	72.3	Confident	128 Å²	128	102.2 Å²	102.2	78%	0.776	64%	0.641	S	S	*	*			trans	-50.9	124.7	168.9	179.4	0	0	0	0	106	V90 D94	V90-V92 PolarHBondContact O-N 3.29Å; V92-D94 PolarHBondContact O-N 3.03Å
93	A	66.2	Low	73.4	Confident	75 Å²	75	98 Å²	98	62%	0.62	62%	0.622	S	S	*	*			trans	-46.8	103.1	-173.7	0	0	0	0	0	109.8	A91 P95	A91-A93 PolarHBondContact O-N 2.98Å; A91-A93 VanDerWaalsContact O-N 3.16Å; A93-P95 WeakPolarHBondContact O-CD 3.39Å
94	D	75	Confident	74.2	Confident	93 Å²	93	101 Å²	101	50%	0.497	63%	0.631	S	S	.	*			trans	-65.2	118.1	177.7	169.3	43	0	0	0	107	V92 G96 A97 M98	V92-D94 PolarHBondContact O-N 3.03Å; D94-G96 PolarHBondContact O-N 2.82Å; D94-G96 VanDerWaalsContact O-N 3.11Å; D94-G96 PolarHBondContact OD1-N 3.05Å; D94-G96 WeakPolarHBondContact OD2-CA 3.46Å; D94-G96 PolarHBondContact OD2-N 3.38Å; D94-A97 HydrophobicContact CB-CB 4.09Å; D94-A97 WeakPolarHBondContact O-CB 3.3Å; D94-A97 PolarHBondContact O-N 3.43Å; D94-A97 PolarHBondContact OD2-N 2.93Å; D94-M98 PolarHBondContact O-N 2.97Å; D94-M98 VanDerWaalsContact O-N 3.17Å
95	P	78.9	Confident	75.1	Confident	95 Å²	95	100.6 Å²	100.6	62%	0.617	62%	0.617	S	S	*	*	H	α-helix	trans	-57.6	-26.9	178.2	-23	33.9	0	0	0	112	A93 R99	A93-P95 WeakPolarHBondContact O-CD 3.39Å; P95-R99 WeakPolarHBondContact O-CG 3.47Å; P95-R99 PolarHBondContact O-N 3.36Å; P95-R99 VanDerWaalsContact O-N 3.12Å
96	G	84.2	Confident	76.2	Confident	31 Å²	31	101.7 Å²	101.7	32%	0.32	61%	0.61	S	S	.	*	H	α-helix	trans	-62.5	-51.5	172.7	0	0	0	0	0	112.6	D94 M98 R99 L100	D94-G96 PolarHBondContact O-N 2.82Å; D94-G96 VanDerWaalsContact O-N 3.11Å; D94-G96 PolarHBondContact OD1-N 3.05Å; D94-G96 WeakPolarHBondContact OD2-CA 3.46Å; D94-G96 PolarHBondContact OD2-N 3.38Å; G96-M98 VanDerWaalsContact C-N 3.34Å; G96-M98 PolarHBondContact O-N 3.33Å; G96-R99 WeakPolarHBondContact O-CB 3.43Å; G96-R99 PolarHBondContact O-N 3.37Å; G96-R99 VanDerWaalsContact O-N 3.14Å; G96-L100 PolarHBondContact O-N 3.48Å
97	A	79.2	Confident	77.1	Confident	42 Å²	42	99.8 Å²	99.8	35%	0.347	60%	0.6	S	S	.	*	H	α-helix	trans	-57.2	-44.1	176	0	0	0	0	0	112.4	D94 R99 L100 I101	D94-A97 HydrophobicContact CB-CB 4.09Å; D94-A97 WeakPolarHBondContact O-CB 3.3Å; D94-A97 PolarHBondContact O-N 3.43Å; D94-A97 PolarHBondContact OD2-N 2.93Å; A97-R99 VanDerWaalsContact C-N 3.31Å; A97-R99 PolarHBondContact O-N 3.01Å; A97-L100 PolarHBondContact O-N 3.34Å; A97-I101 WeakPolarHBondContact O-CG1 3.5Å; A97-I101 PolarHBondContact O-N 3.46Å
98	M	79.2	Confident	77.8	Confident	116 Å²	116	97.6 Å²	97.6	57%	0.571	59%	0.591	S	S	*	*	H	α-helix	trans	-61.8	-38.8	176.6	-72.9	-61.7	-67.5	0	0	112.4	D94 G96 I101 A102	D94-M98 PolarHBondContact O-N 2.97Å; D94-M98 VanDerWaalsContact O-N 3.17Å; G96-M98 VanDerWaalsContact C-N 3.34Å; G96-M98 PolarHBondContact O-N 3.33Å; M98-I101 HydrophobicContact SD-CD1 4.44Å; M98-A102 WeakPolarHBondContact O-CB 3.33Å; M98-A102 PolarHBondContact O-N 3.13Å
99	R	86.5	Confident	77.7	Confident	199 Å²	199	94.2 Å²	94.2	75%	0.751	58%	0.577	S	S	*	*	H	α-helix	trans	-65.9	-40.3	174.4	-77.8	176.9	163.4	-159.7	-4	112.5	P95 G96 A97 A102 A103	P95-R99 WeakPolarHBondContact O-CG 3.47Å; P95-R99 PolarHBondContact O-N 3.36Å; P95-R99 VanDerWaalsContact O-N 3.12Å; G96-R99 WeakPolarHBondContact O-CB 3.43Å; G96-R99 PolarHBondContact O-N 3.37Å; G96-R99 VanDerWaalsContact O-N 3.14Å; A97-R99 VanDerWaalsContact C-N 3.31Å; A97-R99 PolarHBondContact O-N 3.01Å; R99-A102 PolarHBondContact O-N 3.4Å; R99-A103 WeakPolarHBondContact O-CB 3.38Å; R99-A103 PolarHBondContact O-N 3.12Å
100	L	86.7	Confident	77.6	Confident	124 Å²	124	95.2 Å²	95.2	65%	0.649	57%	0.574	S	S	*	*	H	α-helix	trans	-64.2	-45	176	-73.8	171	0	0	0	111.5	G96 A97 A102 A103 V104	G96-L100 PolarHBondContact O-N 3.48Å; A97-L100 PolarHBondContact O-N 3.34Å; L100-A102 VanDerWaalsContact C-N 3.32Å; L100-A102 PolarHBondContact O-N 2.92Å; L100-A103 PolarHBondContact O-N 3Å; L100-V104 WeakPolarHBondContact O-CG2 3.39Å; L100-V104 PolarHBondContact O-N 3.16Å
101	I	84.4	Confident	77.2	Confident	87 Å²	87	96.6 Å²	96.6	45%	0.446	58%	0.576	S	S	.	*	H	α-helix	trans	-58.7	-45.6	175.2	-68.7	163.7	0	0	0	110.4	A97 M98 V104 H105	A97-I101 WeakPolarHBondContact O-CG1 3.5Å; A97-I101 PolarHBondContact O-N 3.46Å; M98-I101 HydrophobicContact SD-CD1 4.44Å; I101-V104 PolarHBondContact O-N 2.8Å; I101-H105 WeakPolarHBondContact CG2-ND1 3.43Å; I101-H105 PolarHBondContact O-N 3.17Å; I101-H105 PolarHBondContact O-ND1 3.2Å
102	A	86.4	Confident	76.6	Confident	51 Å²	51	99 Å²	99	42%	0.421	60%	0.596	S	S	.	*	H	α-helix	trans	-63	-42	177.4	0	0	0	0	0	112.1	M98 R99 L100 H105 H106	M98-A102 WeakPolarHBondContact O-CB 3.33Å; M98-A102 PolarHBondContact O-N 3.13Å; R99-A102 PolarHBondContact O-N 3.4Å; L100-A102 VanDerWaalsContact C-N 3.32Å; L100-A102 PolarHBondContact O-N 2.92Å; A102-H105 PolarHBondContact O-N 2.92Å; A102-H106 PolarHBondContact O-N 2.99Å
103	A	89.6	Confident	77.4	Confident	56 Å²	56	97.6 Å²	97.6	46%	0.463	59%	0.587	S	S	.	*	H	α-helix	trans	-63.3	-42.8	177.9	0	0	0	0	0	112.3	R99 L100 H106 A107	R99-A103 WeakPolarHBondContact O-CB 3.38Å; R99-A103 PolarHBondContact O-N 3.12Å; L100-A103 PolarHBondContact O-N 3Å; A103-H106 PolarHBondContact O-N 2.95Å; A103-A107 WeakPolarHBondContact O-CB 3.33Å; A103-A107 PolarHBondContact O-N 3.43Å
104	V	87.8	Confident	77.9	Confident	101 Å²	101	98.8 Å²	98.8	61%	0.612	59%	0.586	S	S	*	*	H	α-helix	trans	-62.5	-45.5	175.9	172.1	0	0	0	0	111	L100 I101 H106 A107 A108	L100-V104 WeakPolarHBondContact O-CG2 3.39Å; L100-V104 PolarHBondContact O-N 3.16Å; I101-V104 PolarHBondContact O-N 2.8Å; V104-H106 VanDerWaalsContact C-N 3.35Å; V104-H106 PolarHBondContact O-N 3.23Å; V104-A107 PolarHBondContact O-N 3.14Å; V104-A108 WeakPolarHBondContact O-CB 3.4Å; V104-A108 PolarHBondContact O-N 3.41Å
105	H	81.3	Confident	78.1	Confident	130 Å²	130	99.1 Å²	99.1	60%	0.602	59%	0.591	S	S	*	*	H	α-helix	trans	-61.7	-41.8	176.3	-76.9	100.8	0	0	0	112.2	I101 A102 A108 A109	I101-H105 WeakPolarHBondContact CG2-ND1 3.43Å; I101-H105 PolarHBondContact O-N 3.17Å; I101-H105 PolarHBondContact O-ND1 3.2Å; A102-H105 PolarHBondContact O-N 2.92Å; H105-A108 PolarHBondContact O-N 2.97Å; H105-A109 WeakPolarHBondContact O-CB 3.45Å; H105-A109 PolarHBondContact O-N 3.07Å
106	H	85.1	Confident	78.1	Confident	135 Å²	135	99.4 Å²	99.4	63%	0.625	59%	0.589	S	S	*	*	H	α-helix	trans	-64.7	-42.2	176.7	-113.1	-67.7	0	0	0	112.4	A102 A103 V104 A109 I110	A102-H106 PolarHBondContact O-N 2.99Å; A103-H106 PolarHBondContact O-N 2.95Å; V104-H106 VanDerWaalsContact C-N 3.35Å; V104-H106 PolarHBondContact O-N 3.23Å; H106-A109 PolarHBondContact O-N 3.39Å; H106-I110 VanDerWaalsContact O-CG1 3.3Å; H106-I110 WeakPolarHBondContact O-CG1 3.21Å; H106-I110 PolarHBondContact O-N 3.25Å; H106-I110 VanDerWaalsContact O-N 3.13Å
107	A	84.5	Confident	77.7	Confident	56 Å²	56	103.6 Å²	103.6	46%	0.463	61%	0.606	S	S	.	*	H	α-helix	trans	-65.7	-40.2	178.4	0	0	0	0	0	112.1	A103 V104 I110	A103-A107 WeakPolarHBondContact O-CB 3.33Å; A103-A107 PolarHBondContact O-N 3.43Å; V104-A107 PolarHBondContact O-N 3.14Å; A107-I110 PolarHBondContact O-N 3.11Å
108	A	77.4	Confident	77.6	Confident	62 Å²	62	107.7 Å²	107.7	51%	0.512	62%	0.623	S	S	.	*	H	α-helix	trans	-65.6	-39.4	175.6	0	0	0	0	0	112	V104 H105 I110 L111 A112	V104-A108 WeakPolarHBondContact O-CB 3.4Å; V104-A108 PolarHBondContact O-N 3.41Å; H105-A108 PolarHBondContact O-N 2.97Å; A108-I110 VanDerWaalsContact C-N 3.29Å; A108-I110 PolarHBondContact O-N 2.9Å; A108-L111 PolarHBondContact O-N 3.38Å; A108-A112 PolarHBondContact O-N 2.85Å
109	A	66.1	Low	77.5	Confident	66 Å²	66	107.1 Å²	107.1	55%	0.545	63%	0.627	S	S	.	*	H	α-helix	trans	-70.4	-21.2	177.9	0	0	0	0	0	113.8	H105 H106 L111	H105-A109 WeakPolarHBondContact O-CB 3.45Å; H105-A109 PolarHBondContact O-N 3.07Å; H106-A109 PolarHBondContact O-N 3.39Å; A109-L111 VanDerWaalsContact C-N 3.32Å
110	I	59.2	Low	76.8	Confident	131 Å²	131	100.1 Å²	100.1	67%	0.672	62%	0.617	S	S	*	*	H	α-helix	trans	-79.7	-17.5	174.6	-69.9	166.5	0	0	0	111.7	H106 A107 A108	H106-I110 VanDerWaalsContact O-CG1 3.3Å; H106-I110 WeakPolarHBondContact O-CG1 3.21Å; H106-I110 PolarHBondContact O-N 3.25Å; H106-I110 VanDerWaalsContact O-N 3.13Å; A107-I110 PolarHBondContact O-N 3.11Å; A108-I110 VanDerWaalsContact C-N 3.29Å; A108-I110 PolarHBondContact O-N 2.9Å
111	L	58.6	Low	75.9	Confident	159 Å²	159	98.1 Å²	98.1	83%	0.832	62%	0.615	S	S	*	*			trans	-101.6	3	179.6	-69.5	171.9	0	0	0	114	A108 A109	A108-L111 PolarHBondContact O-N 3.38Å; A109-L111 VanDerWaalsContact C-N 3.32Å
112	A	50.8	Low	75.2	Confident	143 Å²	143	99.1 Å²	99.1	100%	1.182	63%	0.63	S	S	*	*			trans	-100	0	171.6	0	0	0	0	0	110.3	A108	A108-A112 PolarHBondContact O-N 2.85Å

Retrieved 112 of 112 residues in 29 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).