A0A077ZP00_TRITR Loading...

U6 snRNA-associated Sm-like protein LSm6

Plays a role in pre-mRNA splicing as a core component of the spliceosomal U1, U2, U4 and U5 small nuclear ribonucleoproteins (snRNPs), the building blocks of the spliceosome. Plays a role in pre-mRNA splicing as component of the U4/U6-U5 tri-snRNP complex that is involved in spliceosome assembly, and as component of the precatalytic spliceosome (spliceosome B complex). The heptameric LSM2-8 complex binds specifically to the 3'-terminal U-tract of U6 snRNA. Component of LSm protein complexes, which are involved in RNA processing and may function in a chaperone-like manner, facilitating the efficient association of RNA processing factors with their substrates. Component of the cytoplasmic LSM1-LSM7 complex, which is thought to be involved in mRNA degradation by activating the decapping step in the 5'-to-3' mRNA decay pathway.

AlphaFold DB , UniProt , Accession A0A077ZP00, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 79 aa.

						>A0A077ZP00_TRITR|A0A077ZP00
MGRRQTPSEFLKQIIGKPVVVKLNNGTDYRGILACLDGYLNIAMEQTEEYSEGQLKSKYGDAFIRGNNVLYISAQKRRL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	45.4	Very low	79.6	Confident	242 Å²	242	116.8 Å²	116.8	100%	1.192	59%	0.594	S	S	*	*				0	123.3	0	-77	-176	-177.1	0	0	108.5	R3	M1-R3 PolarHBondContact O-N 3.03Å
2	G	61.4	Low	80.5	Confident	77 Å²	77	120.4 Å²	120.4	79%	0.794	60%	0.603	S	S	*	*	P	Polyproline II helix	trans	-63.9	126	173.2	0	0	0	0	0	109.7	R4	G2-R4 PolarHBondContact O-N 2.74Å; G2-R4 VanDerWaalsContact O-N 3.14Å
3	R	69.4	Low	81.4	Confident	228 Å²	228	119.3 Å²	119.3	86%	0.86	59%	0.594	S	S	*	*	P	Polyproline II helix	trans	-59.1	117.7	-179.6	-164.5	174.1	179.1	151.2	-0.4	108.3	M1 Q5	M1-R3 PolarHBondContact O-N 3.03Å; R3-Q5 PolarHBondContact O-N 2.85Å; R3-Q5 VanDerWaalsContact O-N 3.15Å
4	R	76.1	Confident	82.4	Confident	239 Å²	239	111.1 Å²	111.1	90%	0.902	55%	0.554	S	S	*	*	P	Polyproline II helix	trans	-62.6	116.5	175.6	-94.9	-178	174.5	146.2	-2	108.1	G2	G2-R4 PolarHBondContact O-N 2.74Å; G2-R4 VanDerWaalsContact O-N 3.14Å
5	Q	84.7	Confident	83.2	Confident	91 Å²	91	109.4 Å²	109.4	43%	0.425	55%	0.546	S	S	.	.	P	Polyproline II helix	trans	-77.9	129.2	175.3	-171.2	173.8	13.3	0	0	109.3	R3 E9 F10	R3-Q5 PolarHBondContact O-N 2.85Å; R3-Q5 VanDerWaalsContact O-N 3.15Å; Q5-E9 HydrophobicContact CG-CB 3.81Å; Q5-F10 HydrophobicContact CG-CB 4.38Å
6	T	89.4	Confident	84.1	Confident	66 Å²	66	105.9 Å²	105.9	41%	0.405	55%	0.546	S	S	.	.	P	Polyproline II helix	trans	-75.7	155.3	173	62.1	0	0	0	0	110.5	S8 E9 F10	T6-S8 PolarHBondContact O-N 2.77Å; T6-E9 PolarHBondContact N-OE2 2.88Å; T6-E9 PolarHBondContact O-N 3.08Å; T6-E9 VanDerWaalsContact O-N 3.11Å; T6-E9 WeakPolarHBondContact OG1-CB 3.27Å; T6-E9 VanDerWaalsContact OG1-CD 3.27Å; T6-E9 WeakPolarHBondContact OG1-CG 3.48Å; T6-E9 PolarHBondContact OG1-N 3.45Å; T6-E9 PolarHBondContact OG1-OE2 2.61Å; T6-F10 PolarHBondContact O-N 3.18Å
7	P	88.2	Confident	84.9	Confident	100 Å²	100	106.1 Å²	106.1	65%	0.649	54%	0.542	S	S	*	.	H	α-helix	trans	-53.3	-42.6	173.2	-27.6	35.7	0	0	0	112.4	E9 F10 L11	P7-E9 VanDerWaalsContact C-N 3.34Å; P7-E9 PolarHBondContact O-N 2.8Å; P7-F10 WeakPolarHBondContact O-CB 3.33Å; P7-F10 PolarHBondContact O-N 2.91Å; P7-F10 VanDerWaalsContact O-N 3.16Å; P7-L11 WeakPolarHBondContact O-CB 3.22Å; P7-L11 VanDerWaalsContact O-CG 3.23Å; P7-L11 WeakPolarHBondContact O-CG 3.43Å; P7-L11 PolarHBondContact O-N 3.25Å
8	S	87.5	Confident	85.6	Confident	76 Å²	76	103.6 Å²	103.6	53%	0.531	53%	0.533	S	S	.	.	H	α-helix	trans	-63.1	-37.4	178.5	-51.8	0	0	0	0	113.1	T6 K12	T6-S8 PolarHBondContact O-N 2.77Å; S8-K12 WeakPolarHBondContact O-CG 3.43Å; S8-K12 PolarHBondContact O-N 2.85Å; S8-K12 VanDerWaalsContact O-N 3.11Å
9	E	91.9	Very high	86.2	Confident	76 Å²	76	98.1 Å²	98.1	36%	0.355	51%	0.505	S	S	.	.	H	α-helix	trans	-69	-38.8	173.5	-74.1	165.7	147.5	0	0	111.8	Q5 T6 P7 Q13	Q5-E9 HydrophobicContact CG-CB 3.81Å; T6-E9 PolarHBondContact N-OE2 2.88Å; T6-E9 PolarHBondContact O-N 3.08Å; T6-E9 VanDerWaalsContact O-N 3.11Å; T6-E9 WeakPolarHBondContact OG1-CB 3.27Å; T6-E9 VanDerWaalsContact OG1-CD 3.27Å; T6-E9 WeakPolarHBondContact OG1-CG 3.48Å; T6-E9 PolarHBondContact OG1-N 3.45Å; T6-E9 PolarHBondContact OG1-OE2 2.61Å; P7-E9 VanDerWaalsContact C-N 3.34Å; P7-E9 PolarHBondContact O-N 2.8Å; E9-Q13 WeakPolarHBondContact O-CG 3.3Å; E9-Q13 PolarHBondContact O-N 3.26Å
10	F	91.3	Very high	86.7	Confident	60 Å²	60	94.2 Å²	94.2	26%	0.263	49%	0.486	S	S	.	.	H	α-helix	trans	-60.1	-49.8	174.1	170.2	-103.4	0	0	0	111.2	Q5 T6 P7 K12 Q13 I14 I72	Q5-F10 HydrophobicContact CG-CB 4.38Å; T6-F10 PolarHBondContact O-N 3.18Å; P7-F10 WeakPolarHBondContact O-CB 3.33Å; P7-F10 PolarHBondContact O-N 2.91Å; P7-F10 VanDerWaalsContact O-N 3.16Å; F10-K12 VanDerWaalsContact C-N 3.35Å; F10-K12 PolarHBondContact O-N 3.16Å; F10-Q13 WeakPolarHBondContact O-CB 3.19Å; F10-Q13 PolarHBondContact O-N 2.61Å; F10-I14 HydrophobicContact CD1-CD1 4.31Å; F10-I14 HydrophobicContact CD2-CG2 4.39Å; F10-I14 HydrophobicContact CE1-CD1 3.68Å; F10-I14 HydrophobicContact CE1-CG1 4.47Å; F10-I14 HydrophobicContact CE2-CG2 3.83Å; F10-I14 HydrophobicContact CZ-CD1 3.96Å; F10-I14 HydrophobicContact CZ-CG2 3.91Å; F10-I14 PolarHBondContact O-N 2.87Å; F10-I72 HydrophobicContact CE1-CG2 4.38Å
11	L	90.3	Very high	87.3	Confident	30 Å²	30	89.7 Å²	89.7	16%	0.157	46%	0.463	C	S	.	.	H	α-helix	trans	-56.3	-47.2	178.6	-73.9	174.3	0	0	0	112	P7 Q13 I14 I15 L36 L40 I72	P7-L11 WeakPolarHBondContact O-CB 3.22Å; P7-L11 VanDerWaalsContact O-CG 3.23Å; P7-L11 WeakPolarHBondContact O-CG 3.43Å; P7-L11 PolarHBondContact O-N 3.25Å; L11-Q13 PolarHBondContact O-N 3.34Å; L11-I14 HydrophobicContact CD2-CD1 4.25Å; L11-I14 WeakPolarHBondContact O-CG1 3.45Å; L11-I14 PolarHBondContact O-N 2.87Å; L11-I15 PolarHBondContact O-N 2.91Å; L11-L36 HydrophobicContact CB-CD2 4Å; L11-L36 HydrophobicContact CD1-CD1 3.77Å; L11-L36 HydrophobicContact CD1-CD2 4.44Å; L11-L36 HydrophobicContact CD2-CD1 3.58Å; L11-L36 HydrophobicContact CD2-CD2 3.79Å; L11-L36 HydrophobicContact CD2-CG 4.32Å; L11-L36 HydrophobicContact CG-CD1 4.18Å; L11-L36 HydrophobicContact CG-CD2 4.26Å; L11-L40 HydrophobicContact CD1-CD2 4.37Å; L11-I72 HydrophobicContact CD2-CG2 4.32Å
12	K	90.1	Very high	89.7	Confident	160 Å²	160	80.1 Å²	80.1	70%	0.696	41%	0.414	S	S	*	.	H	α-helix	trans	-59.1	-32.6	175.2	-74.3	177	-178.4	-176.8	0	113.2	S8 F10	S8-K12 WeakPolarHBondContact O-CG 3.43Å; S8-K12 PolarHBondContact O-N 2.85Å; S8-K12 VanDerWaalsContact O-N 3.11Å; F10-K12 VanDerWaalsContact C-N 3.35Å; F10-K12 PolarHBondContact O-N 3.16Å
13	Q	92.7	Very high	91.5	Very high	106 Å²	106	77.4 Å²	77.4	50%	0.495	38%	0.382	S	S	.	.	H	α-helix	trans	-76.9	-20.3	-178.7	-75.4	177.5	13.2	0	0	114.1	E9 F10 L11 K17	E9-Q13 WeakPolarHBondContact O-CG 3.3Å; E9-Q13 PolarHBondContact O-N 3.26Å; F10-Q13 WeakPolarHBondContact O-CB 3.19Å; F10-Q13 PolarHBondContact O-N 2.61Å; L11-Q13 PolarHBondContact O-N 3.34Å; Q13-K17 VanDerWaalsContact O-CD 3.28Å; Q13-K17 WeakPolarHBondContact O-CD 3.45Å; Q13-K17 WeakPolarHBondContact O-CE 3.43Å; Q13-K17 PolarHBondContact O-NZ 2.98Å
14	I	94.7	Very high	92.8	Very high	5 Å²	5	71.2 Å²	71.2	3%	0.026	37%	0.366	C	S	.	.	H	α-helix	trans	-100.8	-7.9	-176.8	59.1	164.2	0	0	0	113.5	F10 L11 G16 K17 V19 L33 I72 A74	F10-I14 HydrophobicContact CD1-CD1 4.31Å; F10-I14 HydrophobicContact CD2-CG2 4.39Å; F10-I14 HydrophobicContact CE1-CD1 3.68Å; F10-I14 HydrophobicContact CE1-CG1 4.47Å; F10-I14 HydrophobicContact CE2-CG2 3.83Å; F10-I14 HydrophobicContact CZ-CD1 3.96Å; F10-I14 HydrophobicContact CZ-CG2 3.91Å; F10-I14 PolarHBondContact O-N 2.87Å; L11-I14 HydrophobicContact CD2-CD1 4.25Å; L11-I14 WeakPolarHBondContact O-CG1 3.45Å; L11-I14 PolarHBondContact O-N 2.87Å; I14-G16 PolarHBondContact O-N 2.78Å; I14-K17 WeakPolarHBondContact O-CB 3.36Å; I14-K17 PolarHBondContact O-N 3.34Å; I14-V19 HydrophobicContact CB-CG1 4.06Å; I14-V19 HydrophobicContact CD1-CG1 4.08Å; I14-L33 HydrophobicContact CB-CD2 4.36Å; I14-L33 HydrophobicContact CD1-CD2 3.79Å; I14-L33 HydrophobicContact CG1-CD2 3.64Å; I14-I72 HydrophobicContact CD1-CD1 3.59Å; I14-I72 HydrophobicContact CD1-CG1 3.91Å; I14-A74 HydrophobicContact CG2-CB 3.95Å
15	I	95.7	Very high	93.7	Very high	85 Å²	85	65.5 Å²	65.5	44%	0.436	35%	0.353	S	S	.	.	T	Hydrogen-bonded Turn	trans	-58.5	135.5	171.8	-66.1	169.7	0	0	0	109.5	L11 K17 L33	L11-I15 PolarHBondContact O-N 2.91Å; I15-K17 PolarHBondContact O-N 2.83Å; I15-L33 HydrophobicContact CG1-CD2 4.09Å
16	G	96.9	Very high	94.3	Very high	53 Å²	53	62.9 Å²	62.9	55%	0.546	35%	0.35	S	S	.	.	T	Hydrogen-bonded Turn	trans	71.7	9.7	-176.1	0	0	0	0	0	114.4	I14 L33	I14-G16 PolarHBondContact O-N 2.78Å; G16-L33 WeakPolarHBondContact CA-O 3.31Å; G16-L33 PolarHBondContact N-O 2.82Å
17	K	97	Very high	94.7	Very high	110 Å²	110	60.3 Å²	60.3	48%	0.478	34%	0.335	S	S	.	.	S	Bend	trans	-115.9	157.4	-178	-60.7	-174.2	-175	163.4	0	112.1	Q13 I14 I15 V19 L33	Q13-K17 VanDerWaalsContact O-CD 3.28Å; Q13-K17 WeakPolarHBondContact O-CD 3.45Å; Q13-K17 WeakPolarHBondContact O-CE 3.43Å; Q13-K17 PolarHBondContact O-NZ 2.98Å; I14-K17 WeakPolarHBondContact O-CB 3.36Å; I14-K17 PolarHBondContact O-N 3.34Å; I15-K17 PolarHBondContact O-N 2.83Å; K17-V19 PolarHBondContact O-N 3.24Å; K17-L33 PolarHBondContact O-N 2.89Å
18	P	97.4	Very high	95.1	Very high	60 Å²	60	56.6 Å²	56.6	39%	0.39	31%	0.31	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-61.3	128.1	170.5	-19.8	30.7	0	0	0	111.7	G31 I32 Q75	P18-G31 CarbonylContact C-O 3.58Å; P18-G31 WeakPolarHBondContact CA-O 3.43Å; P18-I32 HydrophobicContact CB-CD1 4.11Å; P18-I32 HydrophobicContact CG-CD1 3.65Å; P18-Q75 HydrophobicContact CB-CB 3.95Å; P18-Q75 WeakPolarHBondContact O-CB 3.22Å; P18-Q75 PolarHBondContact O-N 2.75Å
19	V	97.5	Very high	95.6	Very high	0 Å²	0	55 Å²	55	0%	0	29%	0.292	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.8	160.6	-179.6	-64.6	0	0	0	0	111.1	I14 K17 V21 R30 G31 L33 M44 I72 S73	I14-V19 HydrophobicContact CB-CG1 4.06Å; I14-V19 HydrophobicContact CD1-CG1 4.08Å; K17-V19 PolarHBondContact O-N 3.24Å; V19-V21 HydrophobicContact CG2-CG2 4.37Å; V19-R30 WeakPolarHBondContact O-CA 3.33Å; V19-G31 PolarHBondContact N-O 2.87Å; V19-G31 PolarHBondContact O-N 2.9Å; V19-L33 HydrophobicContact CG1-CB 3.95Å; V19-L33 HydrophobicContact CG2-CB 3.93Å; V19-M44 HydrophobicContact CG2-CE 4.28Å; V19-M44 HydrophobicContact CG2-SD 4.3Å; V19-I72 HydrophobicContact CB-CD1 4.36Å; V19-I72 HydrophobicContact CB-CG1 4.31Å; V19-I72 HydrophobicContact CG1-CD1 4.37Å; V19-I72 HydrophobicContact CG2-CD1 4.4Å; V19-S73 CarbonylContact C-O 3.59Å; V19-S73 VanDerWaalsContact CA-O 3.3Å; V19-S73 WeakPolarHBondContact CA-O 3.43Å; V19-S73 WeakPolarHBondContact CB-O 3.38Å
20	V	97.4	Very high	95.9	Very high	19 Å²	19	54.3 Å²	54.3	12%	0.115	29%	0.286	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.5	125.1	166	-175.5	0	0	0	0	108.1	D28 Y29 R30 I72 S73 Q75	V20-D28 HydrophobicContact CG1-CB 4.34Å; V20-Y29 CarbonylContact C-O 3.6Å; V20-Y29 WeakPolarHBondContact CA-O 3.49Å; V20-R30 HydrophobicContact CG1-CG 4.33Å; V20-R30 HydrophobicContact CG2-CG 4.12Å; V20-I72 CarbonylContact O-C 3.54Å; V20-I72 WeakPolarHBondContact O-CA 3.41Å; V20-S73 PolarHBondContact N-O 2.92Å; V20-S73 PolarHBondContact O-N 2.89Å; V20-S73 PolarHBondContact O-OG 2.99Å; V20-Q75 HydrophobicContact CG2-CB 4.25Å; V20-Q75 HydrophobicContact CG2-CG 4.12Å
21	V	97.4	Very high	96.2	Very high	0 Å²	0	51.9 Å²	51.9	0%	0	28%	0.278	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.7	112.7	174.4	-180	0	0	0	0	107.8	V19 L23 Y29 I42 M44 I64 V69 Y71 I72	V19-V21 HydrophobicContact CG2-CG2 4.37Å; V21-L23 HydrophobicContact CG1-CD2 4.21Å; V21-Y29 PolarHBondContact N-O 3.37Å; V21-Y29 PolarHBondContact O-N 2.8Å; V21-I42 HydrophobicContact CB-CD1 4.48Å; V21-I42 HydrophobicContact CG1-CD1 3.8Å; V21-I42 HydrophobicContact CG2-CD1 3.77Å; V21-M44 HydrophobicContact CB-SD 4.39Å; V21-M44 HydrophobicContact CG2-SD 3.67Å; V21-I64 HydrophobicContact CB-CD1 4.27Å; V21-I64 HydrophobicContact CG1-CD1 4.04Å; V21-V69 HydrophobicContact CG1-CG1 3.95Å; V21-V69 HydrophobicContact CG1-CG2 3.97Å; V21-Y71 WeakPolarHBondContact CA-O 3.39Å; V21-I72 HydrophobicContact CG2-CB 4.42Å; V21-I72 HydrophobicContact CG2-CD1 4.1Å; V21-I72 HydrophobicContact CG2-CG1 4.06Å
22	K	97.5	Very high	96.6	Very high	41 Å²	41	52.1 Å²	52.1	18%	0.178	28%	0.279	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-92.4	130.3	173.6	-176.7	171.3	-72	-66.8	0	109.2	G26 D28 L70 Y71	K22-G26 PolarHBondContact NZ-O 3.03Å; K22-D28 WeakPolarHBondContact CB-OD1 3.16Å; K22-D28 WeakPolarHBondContact CE-OD1 3.38Å; K22-D28 WeakPolarHBondContact CG-OD1 3.46Å; K22-D28 IonicContact NZ-OD1 2.62Å; K22-D28 PolarHBondContact NZ-OD1 2.81Å; K22-D28 IonicContact NZ-OD2 3.07Å; K22-D28 PolarHBondContact NZ-OD2 2.89Å; K22-L70 HydrophobicContact CD-CD2 4.03Å; K22-L70 HydrophobicContact CG-CD2 4.29Å; K22-L70 WeakPolarHBondContact O-CB 3.45Å; K22-L70 PolarHBondContact O-N 3.07Å; K22-Y71 HydrophobicContact CB-CD1 4.01Å; K22-Y71 HydrophobicContact CB-CD2 4.34Å; K22-Y71 HydrophobicContact CB-CE1 3.65Å; K22-Y71 HydrophobicContact CB-CE2 3.97Å; K22-Y71 HydrophobicContact CB-CG 4.35Å; K22-Y71 HydrophobicContact CD-CD1 4.45Å; K22-Y71 HydrophobicContact CD-CE1 3.63Å; K22-Y71 WeakPolarHBondContact CE-OH 3.17Å; K22-Y71 HydrophobicContact CG-CE1 4.16Å; K22-Y71 PolarHBondContact N-O 3.27Å; K22-Y71 PolarHBondContact O-N 2.76Å
23	L	97.7	Very high	97	Very high	21 Å²	21	44.5 Å²	44.5	11%	0.11	25%	0.246	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-87.7	162.1	173.4	-58.5	-165.8	0	0	0	111.7	V21 N25 G26 T27 Y29 I64 N68 V69	V21-L23 HydrophobicContact CG1-CD2 4.21Å; L23-N25 WeakPolarHBondContact CB-OD1 3.3Å; L23-N25 PolarHBondContact O-N 3.44Å; L23-N25 VanDerWaalsContact O-N 3.13Å; L23-G26 PolarHBondContact O-N 3.36Å; L23-T27 PolarHBondContact N-O 3.38Å; L23-Y29 HydrophobicContact CD1-CD2 3.98Å; L23-Y29 HydrophobicContact CD1-CE2 3.45Å; L23-Y29 VanDerWaalsContact CD1-CE2 3.45Å; L23-Y29 HydrophobicContact CD2-CD2 4.44Å; L23-Y29 HydrophobicContact CG-CD2 3.91Å; L23-Y29 HydrophobicContact CG-CE2 3.89Å; L23-I64 HydrophobicContact CD2-CG2 3.73Å; L23-N68 CarbonylContact C-O 3.59Å; L23-N68 VanDerWaalsContact CA-O 3.24Å; L23-N68 WeakPolarHBondContact CA-O 3.23Å; L23-N68 HydrophobicContact CD2-CB 4.36Å; L23-V69 HydrophobicContact CD2-CG2 4.35Å
24	N	97.2	Very high	97.2	Very high	97 Å²	97	41.2 Å²	41.2	52%	0.519	24%	0.237	S	C	.	.	T	Hydrogen-bonded Turn	trans	-58.4	-25.1	179.4	-68.6	-32.3	0	0	0	114	G26 N67 N68	N24-G26 VanDerWaalsContact C-N 3.28Å; N24-N67 PolarHBondContact ND2-O 2.98Å; N24-N68 PolarHBondContact N-O 3.2Å; N24-N68 PolarHBondContact ND2-O 3.11Å
25	N	96.1	Very high	97.2	Very high	119 Å²	119	44.3 Å²	44.3	64%	0.636	26%	0.258	S	S	*	.	T	Hydrogen-bonded Turn	trans	-83.8	0.6	176.8	69.9	-10.1	0	0	0	113.6	L23 T27	L23-N25 WeakPolarHBondContact CB-OD1 3.3Å; L23-N25 PolarHBondContact O-N 3.44Å; L23-N25 VanDerWaalsContact O-N 3.13Å; N25-T27 PolarHBondContact ND2-OG1 2.97Å; N25-T27 WeakPolarHBondContact OD1-CB 3.39Å; N25-T27 PolarHBondContact OD1-N 2.83Å; N25-T27 PolarHBondContact OD1-OG1 2.95Å
26	G	96.3	Very high	97.1	Very high	36 Å²	36	42 Å²	42	37%	0.371	25%	0.247	S	C	.	.	S	Bend	trans	92.7	-11.3	180	0	0	0	0	0	115.4	K22 L23 N24	K22-G26 PolarHBondContact NZ-O 3.03Å; L23-G26 PolarHBondContact O-N 3.36Å; N24-G26 VanDerWaalsContact C-N 3.28Å
27	T	97.7	Very high	96.8	Very high	13 Å²	13	42.7 Å²	42.7	8%	0.08	24%	0.238	C	C	.	.			trans	-63.8	137.8	175.9	-55.6	0	0	0	0	110.9	L23 N25 Y29 E49	L23-T27 PolarHBondContact N-O 3.38Å; N25-T27 PolarHBondContact ND2-OG1 2.97Å; N25-T27 WeakPolarHBondContact OD1-CB 3.39Å; N25-T27 PolarHBondContact OD1-N 2.83Å; N25-T27 PolarHBondContact OD1-OG1 2.95Å; T27-Y29 HydrophobicContact CG2-CD2 4.17Å; T27-Y29 HydrophobicContact CG2-CE2 3.63Å; T27-E49 HydrophobicContact CG2-CG 3.51Å
28	D	97.4	Very high	96.3	Very high	22 Å²	22	41.3 Å²	41.3	12%	0.118	25%	0.254	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-105.8	127.2	175.8	-69.5	-35.2	0	0	0	110.6	V20 K22 Y50	V20-D28 HydrophobicContact CG1-CB 4.34Å; K22-D28 WeakPolarHBondContact CB-OD1 3.16Å; K22-D28 WeakPolarHBondContact CE-OD1 3.38Å; K22-D28 WeakPolarHBondContact CG-OD1 3.46Å; K22-D28 IonicContact NZ-OD1 2.62Å; K22-D28 PolarHBondContact NZ-OD1 2.81Å; K22-D28 IonicContact NZ-OD2 3.07Å; K22-D28 PolarHBondContact NZ-OD2 2.89Å; D28-Y50 PolarHBondContact N-O 2.8Å; D28-Y50 PolarHBondContact O-N 3.22Å
29	Y	98.2	Very high	96	Very high	41 Å²	41	47.6 Å²	47.6	16%	0.161	27%	0.271	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.9	132.7	167.3	-72.8	-94.4	0	0	0	109.3	V20 V21 L23 T27 T47 E48 E49 Y59 I64	V20-Y29 CarbonylContact C-O 3.6Å; V20-Y29 WeakPolarHBondContact CA-O 3.49Å; V21-Y29 PolarHBondContact N-O 3.37Å; V21-Y29 PolarHBondContact O-N 2.8Å; L23-Y29 HydrophobicContact CD1-CD2 3.98Å; L23-Y29 HydrophobicContact CD1-CE2 3.45Å; L23-Y29 VanDerWaalsContact CD1-CE2 3.45Å; L23-Y29 HydrophobicContact CD2-CD2 4.44Å; L23-Y29 HydrophobicContact CG-CD2 3.91Å; L23-Y29 HydrophobicContact CG-CE2 3.89Å; T27-Y29 HydrophobicContact CG2-CD2 4.17Å; T27-Y29 HydrophobicContact CG2-CE2 3.63Å; Y29-T47 HydrophobicContact CD1-CG2 3.64Å; Y29-T47 HydrophobicContact CE1-CG2 4.5Å; Y29-T47 HydrophobicContact CG-CG2 4.49Å; Y29-E48 CarbonylContact C-O 3.41Å; Y29-E48 WeakPolarHBondContact CA-O 3.36Å; Y29-E49 HydrophobicContact CD1-CB 4.36Å; Y29-E49 HydrophobicContact CE1-CB 4.01Å; Y29-E49 HydrophobicContact CE1-CG 4.2Å; Y29-Y59 HydrophobicContact CE1-CD2 4.01Å; Y29-Y59 AromaticContact CE1-CE2 3.77Å; Y29-Y59 HydrophobicContact CE1-CE2 3.77Å; Y29-I64 HydrophobicContact CD1-CD1 4.39Å; Y29-I64 HydrophobicContact CD2-CD1 4.23Å; Y29-I64 HydrophobicContact CG-CD1 3.89Å
30	R	97.8	Very high	95.6	Very high	63 Å²	63	51.3 Å²	51.3	24%	0.238	29%	0.291	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-124.4	139.4	177.9	-52.2	-172.7	-172.2	158.8	1.3	109.1	V19 V20 M44 T47 E48 Y50	V19-R30 WeakPolarHBondContact O-CA 3.33Å; V20-R30 HydrophobicContact CG1-CG 4.33Å; V20-R30 HydrophobicContact CG2-CG 4.12Å; R30-M44 VanDerWaalsContact C-CE 3.43Å; R30-T47 CarbonylContact O-C 3.57Å; R30-T47 VanDerWaalsContact O-CA 3.31Å; R30-T47 WeakPolarHBondContact O-CA 3.34Å; R30-E48 PolarHBondContact N-O 2.86Å; R30-E48 PolarHBondContact O-N 3.24Å; R30-Y50 HydrophobicContact CB-CD2 4.37Å; R30-Y50 HydrophobicContact CB-CE2 4.07Å; R30-Y50 VanDerWaalsContact CD-CE2 3.47Å; R30-Y50 HydrophobicContact CG-CD2 3.76Å; R30-Y50 HydrophobicContact CG-CE2 3.82Å; R30-Y50 VanDerWaalsContact NH1-CE1 3.27Å
31	G	97.8	Very high	95.6	Very high	8 Å²	8	52 Å²	52	8%	0.082	29%	0.294	C	S	.	.	E	Extended strand (participates in β ladder)	trans	169.9	-171.8	-177.4	0	0	0	0	0	111.4	P18 V19 M44 E45	P18-G31 CarbonylContact C-O 3.58Å; P18-G31 WeakPolarHBondContact CA-O 3.43Å; V19-G31 PolarHBondContact N-O 2.87Å; V19-G31 PolarHBondContact O-N 2.9Å; G31-M44 VanDerWaalsContact CA-CE 3.43Å; G31-E45 WeakPolarHBondContact CA-O 3.34Å
32	I	97.9	Very high	95.6	Very high	35 Å²	35	52 Å²	52	18%	0.179	29%	0.294	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.4	126.9	177.7	-52.2	-56.1	0	0	0	109	P18 A34 M44 E45	P18-I32 HydrophobicContact CB-CD1 4.11Å; P18-I32 HydrophobicContact CG-CD1 3.65Å; I32-A34 PolarHBondContact O-N 3.09Å; I32-M44 CarbonylContact O-C 3.56Å; I32-M44 WeakPolarHBondContact O-CA 3.2Å; I32-E45 HydrophobicContact CB-CB 4.33Å; I32-E45 PolarHBondContact N-O 3.39Å; I32-E45 PolarHBondContact O-N 3.18Å
33	L	97.9	Very high	95.6	Very high	0 Å²	0	51.3 Å²	51.3	0%	0	30%	0.296	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-71	109.6	175.2	178.1	63.1	0	0	0	110.1	I14 I15 G16 K17 V19 C35 L36 I42 I72	I14-L33 HydrophobicContact CB-CD2 4.36Å; I14-L33 HydrophobicContact CD1-CD2 3.79Å; I14-L33 HydrophobicContact CG1-CD2 3.64Å; I15-L33 HydrophobicContact CG1-CD2 4.09Å; G16-L33 WeakPolarHBondContact CA-O 3.31Å; G16-L33 PolarHBondContact N-O 2.82Å; K17-L33 PolarHBondContact O-N 2.89Å; V19-L33 HydrophobicContact CG1-CB 3.95Å; V19-L33 HydrophobicContact CG2-CB 3.93Å; L33-C35 WeakPolarHBondContact CD1-O 3.47Å; L33-L36 HydrophobicContact CD2-CD2 4.2Å; L33-I42 HydrophobicContact CD1-CG2 3.36Å; L33-I72 HydrophobicContact CD1-CD1 4.45Å; L33-I72 HydrophobicContact CD2-CD1 4.27Å
34	A	97.6	Very high	95.6	Very high	37 Å²	37	50.5 Å²	50.5	31%	0.306	29%	0.292	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.6	-53.1	176.1	0	0	0	0	0	110.8	I32 A43 E45	I32-A34 PolarHBondContact O-N 3.09Å; A34-A43 HydrophobicContact CB-CB 4.22Å; A34-A43 WeakPolarHBondContact CB-O 3.14Å; A34-A43 PolarHBondContact N-O 3.23Å; A34-E45 HydrophobicContact CB-CG 4.2Å
35	C	95.3	Very high	95.7	Very high	70 Å²	70	50.3 Å²	50.3	47%	0.473	29%	0.288	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-156.6	164.3	174.6	67	0	0	0	0	111.6	L33 A43	L33-C35 WeakPolarHBondContact CD1-O 3.47Å; C35-A43 PolarHBondContact N-O 3.14Å; C35-A43 PolarHBondContact O-N 3.2Å; C35-A43 VanDerWaalsContact SG-CB 3.52Å
36	L	93.3	Very high	95.7	Very high	38 Å²	38	51.4 Å²	51.4	20%	0.199	29%	0.289	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-142.9	163.2	162.8	86.3	142.7	0	0	0	111.1	L11 L33 L40 N41	L11-L36 HydrophobicContact CB-CD2 4Å; L11-L36 HydrophobicContact CD1-CD1 3.77Å; L11-L36 HydrophobicContact CD1-CD2 4.44Å; L11-L36 HydrophobicContact CD2-CD1 3.58Å; L11-L36 HydrophobicContact CD2-CD2 3.79Å; L11-L36 HydrophobicContact CD2-CG 4.32Å; L11-L36 HydrophobicContact CG-CD1 4.18Å; L11-L36 HydrophobicContact CG-CD2 4.26Å; L33-L36 HydrophobicContact CD2-CD2 4.2Å; L36-L40 HydrophobicContact CD1-CD2 3.6Å; L36-N41 WeakPolarHBondContact CA-O 3.49Å; L36-N41 VanDerWaalsContact CB-O 3.31Å; L36-N41 WeakPolarHBondContact CB-O 3.33Å
37	D	90.6	Very high	95.9	Very high	67 Å²	67	49.7 Å²	49.7	36%	0.358	27%	0.271	S	S	.	.			trans	-111.8	-178.1	175.5	71.3	12.7	0	0	0	113.3	Y39 L40 N41	D37-Y39 PolarHBondContact O-N 3.3Å; D37-Y39 WeakPolarHBondContact OD1-CA 3.15Å; D37-Y39 WeakPolarHBondContact OD1-CB 3.33Å; D37-Y39 PolarHBondContact OD1-N 3.19Å; D37-L40 PolarHBondContact O-N 3.24Å; D37-L40 VanDerWaalsContact O-N 3.15Å; D37-L40 PolarHBondContact OD1-N 2.99Å; D37-L40 VanDerWaalsContact OD1-N 3.07Å; D37-N41 PolarHBondContact N-O 3.25Å; D37-N41 PolarHBondContact OD1-N 2.77Å; D37-N41 PolarHBondContact OD1-ND2 3.05Å; D37-N41 WeakPolarHBondContact OD2-CB 3Å; D37-N41 PolarHBondContact OD2-ND2 2.92Å
38	G	86.6	Confident	95.9	Very high	80 Å²	80	51.2 Å²	51.2	83%	0.825	28%	0.277	S	S	*	.	T	Hydrogen-bonded Turn	trans	-68.4	-8.5	178	0	0	0	0	0	115
39	Y	90.7	Very high	95.9	Very high	192 Å²	192	51.7 Å²	51.7	75%	0.753	28%	0.279	S	S	*	.	T	Hydrogen-bonded Turn	trans	-102.6	6.8	175.4	-58.3	-74.5	0	0	0	112.3	D37 N41	D37-Y39 PolarHBondContact O-N 3.3Å; D37-Y39 WeakPolarHBondContact OD1-CA 3.15Å; D37-Y39 WeakPolarHBondContact OD1-CB 3.33Å; D37-Y39 PolarHBondContact OD1-N 3.19Å; Y39-N41 PolarHBondContact O-N 3.27Å
40	L	90.5	Very high	95.9	Very high	78 Å²	78	51.4 Å²	51.4	41%	0.408	28%	0.278	S	S	.	.			trans	60.7	26.5	-175.1	-53.6	176.1	0	0	0	113.4	L11 L36 D37 I42 G66	L11-L40 HydrophobicContact CD1-CD2 4.37Å; L36-L40 HydrophobicContact CD1-CD2 3.6Å; D37-L40 PolarHBondContact O-N 3.24Å; D37-L40 VanDerWaalsContact O-N 3.15Å; D37-L40 PolarHBondContact OD1-N 2.99Å; D37-L40 VanDerWaalsContact OD1-N 3.07Å; L40-I42 WeakPolarHBondContact O-CG1 3.44Å; L40-G66 VanDerWaalsContact C-CA 3.45Å; L40-G66 WeakPolarHBondContact O-CA 3.28Å
41	N	95.5	Very high	95.8	Very high	33 Å²	33	50.3 Å²	50.3	18%	0.176	28%	0.28	C	S	.	.			trans	-68.5	136.6	162.3	-60.8	-54.8	0	0	0	108.6	L36 D37 Y39 F63 I64 R65 G66	L36-N41 WeakPolarHBondContact CA-O 3.49Å; L36-N41 VanDerWaalsContact CB-O 3.31Å; L36-N41 WeakPolarHBondContact CB-O 3.33Å; D37-N41 PolarHBondContact N-O 3.25Å; D37-N41 PolarHBondContact OD1-N 2.77Å; D37-N41 PolarHBondContact OD1-ND2 3.05Å; D37-N41 WeakPolarHBondContact OD2-CB 3Å; D37-N41 PolarHBondContact OD2-ND2 2.92Å; Y39-N41 PolarHBondContact O-N 3.27Å; N41-F63 HydrophobicContact CB-CE2 3.88Å; N41-F63 HydrophobicContact CB-CZ 3.66Å; N41-I64 WeakPolarHBondContact CA-O 3.21Å; N41-R65 WeakPolarHBondContact OD1-CA 3.31Å; N41-G66 PolarHBondContact OD1-N 3.2Å
42	I	97.4	Very high	95.6	Very high	2 Å²	2	58.7 Å²	58.7	1%	0.01	32%	0.317	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.4	124.4	-168.1	-45.3	-178.4	0	0	0	109	V21 L33 L40 M44 F63 I64 V69 I72	V21-I42 HydrophobicContact CB-CD1 4.48Å; V21-I42 HydrophobicContact CG1-CD1 3.8Å; V21-I42 HydrophobicContact CG2-CD1 3.77Å; L33-I42 HydrophobicContact CD1-CG2 3.36Å; L40-I42 WeakPolarHBondContact O-CG1 3.44Å; I42-M44 HydrophobicContact CG2-CG 3.75Å; I42-M44 HydrophobicContact CG2-SD 4.25Å; I42-F63 CarbonylContact O-C 3.56Å; I42-F63 WeakPolarHBondContact O-CA 3.33Å; I42-I64 HydrophobicContact CB-CB 4.3Å; I42-I64 PolarHBondContact N-O 3.23Å; I42-I64 PolarHBondContact O-N 3.41Å; I42-V69 HydrophobicContact CD1-CG1 4.41Å; I42-V69 HydrophobicContact CD1-CG2 3.85Å; I42-I72 HydrophobicContact CD1-CD1 4.3Å
43	A	97.9	Very high	95.3	Very high	26 Å²	26	59.4 Å²	59.4	22%	0.215	33%	0.333	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-97.3	131	163.5	0	0	0	0	0	108.9	A34 C35	A34-A43 HydrophobicContact CB-CB 4.22Å; A34-A43 WeakPolarHBondContact CB-O 3.14Å; A34-A43 PolarHBondContact N-O 3.23Å; C35-A43 PolarHBondContact N-O 3.14Å; C35-A43 PolarHBondContact O-N 3.2Å; C35-A43 VanDerWaalsContact SG-CB 3.52Å
44	M	98.2	Very high	95.3	Very high	3 Å²	3	65.3 Å²	65.3	2%	0.015	36%	0.361	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-129.8	144.9	179.5	-70.3	178.3	49.2	0	0	111.2	V19 V21 R30 G31 I32 I42 T47 D61 A62 I64	V19-M44 HydrophobicContact CG2-CE 4.28Å; V19-M44 HydrophobicContact CG2-SD 4.3Å; V21-M44 HydrophobicContact CB-SD 4.39Å; V21-M44 HydrophobicContact CG2-SD 3.67Å; R30-M44 VanDerWaalsContact C-CE 3.43Å; G31-M44 VanDerWaalsContact CA-CE 3.43Å; I32-M44 CarbonylContact O-C 3.56Å; I32-M44 WeakPolarHBondContact O-CA 3.2Å; I42-M44 HydrophobicContact CG2-CG 3.75Å; I42-M44 HydrophobicContact CG2-SD 4.25Å; M44-T47 WeakPolarHBondContact CB-OG1 3.48Å; M44-T47 HydrophobicContact CE-CG2 4.07Å; M44-T47 PolarHBondContact O-OG1 3.11Å; M44-D61 WeakPolarHBondContact O-CA 3.24Å; M44-A62 PolarHBondContact N-O 3.09Å; M44-A62 PolarHBondContact O-N 3.02Å; M44-I64 HydrophobicContact SD-CD1 3.94Å
45	E	98.5	Very high	95.3	Very high	94 Å²	94	67.4 Å²	67.4	44%	0.439	37%	0.366	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.8	159.4	171.3	-65.2	168.7	-167.1	0	0	109.6	G31 I32 A34 T47 G60	G31-E45 WeakPolarHBondContact CA-O 3.34Å; I32-E45 HydrophobicContact CB-CB 4.33Å; I32-E45 PolarHBondContact N-O 3.39Å; I32-E45 PolarHBondContact O-N 3.18Å; A34-E45 HydrophobicContact CB-CG 4.2Å; E45-T47 PolarHBondContact O-N 3.4Å; E45-T47 VanDerWaalsContact O-N 3.16Å; E45-G60 CarbonylContact C-O 3.56Å
46	Q	97.8	Very high	95.4	Very high	141 Å²	141	69.6 Å²	69.6	66%	0.659	37%	0.368	S	S	*	.	E	Extended strand (participates in β ladder)	trans	51.8	38.1	179	-55.7	-179	-21.7	0	0	113	G60	Q46-G60 PolarHBondContact N-O 2.86Å
47	T	98.5	Very high	95.6	Very high	0 Å²	0	69.8 Å²	69.8	0%	0	37%	0.373	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-75.8	130.1	-169.9	-55.5	0	0	0	0	111.6	Y29 R30 M44 E45 Y59 G60 A62	Y29-T47 HydrophobicContact CD1-CG2 3.64Å; Y29-T47 HydrophobicContact CE1-CG2 4.5Å; Y29-T47 HydrophobicContact CG-CG2 4.49Å; R30-T47 CarbonylContact O-C 3.57Å; R30-T47 VanDerWaalsContact O-CA 3.31Å; R30-T47 WeakPolarHBondContact O-CA 3.34Å; M44-T47 WeakPolarHBondContact CB-OG1 3.48Å; M44-T47 HydrophobicContact CE-CG2 4.07Å; M44-T47 PolarHBondContact O-OG1 3.11Å; E45-T47 PolarHBondContact O-N 3.4Å; E45-T47 VanDerWaalsContact O-N 3.16Å; T47-Y59 PolarHBondContact O-N 2.83Å; T47-G60 VanDerWaalsContact CB-O 3.27Å; T47-G60 WeakPolarHBondContact CB-O 3.35Å; T47-G60 PolarHBondContact N-O 3Å; T47-G60 PolarHBondContact O-N 3.07Å; T47-G60 PolarHBondContact OG1-O 3.12Å; T47-G60 VanDerWaalsContact OG1-O 3.08Å; T47-A62 HydrophobicContact CG2-CB 3.78Å
48	E	98.4	Very high	96	Very high	45 Å²	45	73.4 Å²	73.4	21%	0.21	39%	0.385	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.6	138	175.8	-63.7	-172.7	154.6	0	0	110	Y29 R30 Y50 L55 S57 K58	Y29-E48 CarbonylContact C-O 3.41Å; Y29-E48 WeakPolarHBondContact CA-O 3.36Å; R30-E48 PolarHBondContact N-O 2.86Å; R30-E48 PolarHBondContact O-N 3.24Å; E48-Y50 HydrophobicContact CB-CD2 4.27Å; E48-Y50 HydrophobicContact CB-CE2 3.57Å; E48-Y50 WeakPolarHBondContact OE2-CE2 3.4Å; E48-Y50 PolarHBondContact OE2-OH 2.86Å; E48-L55 HydrophobicContact CB-CD1 3.85Å; E48-L55 HydrophobicContact CG-CD1 4.22Å; E48-S57 WeakPolarHBondContact CA-O 3.46Å; E48-K58 HydrophobicContact CG-CD 4.44Å; E48-K58 HydrophobicContact CG-CG 4.17Å; E48-K58 WeakPolarHBondContact OE1-CE 2.98Å; E48-K58 IonicContact OE1-NZ 2.74Å; E48-K58 PolarHBondContact OE1-NZ 3.5Å
49	E	98.2	Very high	96.5	Very high	32 Å²	32	75.1 Å²	75.1	15%	0.15	37%	0.367	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-99.4	133.2	175.6	-178.3	-172.9	161.5	0	0	110.8	T27 Y29 K56 S57 Y59	T27-E49 HydrophobicContact CG2-CG 3.51Å; Y29-E49 HydrophobicContact CD1-CB 4.36Å; Y29-E49 HydrophobicContact CE1-CB 4.01Å; Y29-E49 HydrophobicContact CE1-CG 4.2Å; E49-K56 HydrophobicContact CG-CB 4.42Å; E49-K56 PolarHBondContact O-N 3.5Å; E49-S57 PolarHBondContact N-O 3.35Å; E49-Y59 HydrophobicContact CB-CD2 4.45Å; E49-Y59 HydrophobicContact CB-CE2 3.75Å; E49-Y59 VanDerWaalsContact OE2-CE2 3.3Å; E49-Y59 WeakPolarHBondContact OE2-CE2 3.37Å; E49-Y59 PolarHBondContact OE2-OH 2.62Å
50	Y	98.1	Very high	96.8	Very high	35 Å²	35	67.4 Å²	67.4	14%	0.137	35%	0.346	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-122.8	128.9	175.9	-68	-102.7	0	0	0	109.9	D28 R30 E48 Q54 L55	D28-Y50 PolarHBondContact N-O 2.8Å; D28-Y50 PolarHBondContact O-N 3.22Å; R30-Y50 HydrophobicContact CB-CD2 4.37Å; R30-Y50 HydrophobicContact CB-CE2 4.07Å; R30-Y50 VanDerWaalsContact CD-CE2 3.47Å; R30-Y50 HydrophobicContact CG-CD2 3.76Å; R30-Y50 HydrophobicContact CG-CE2 3.82Å; R30-Y50 VanDerWaalsContact NH1-CE1 3.27Å; E48-Y50 HydrophobicContact CB-CD2 4.27Å; E48-Y50 HydrophobicContact CB-CE2 3.57Å; E48-Y50 WeakPolarHBondContact OE2-CE2 3.4Å; E48-Y50 PolarHBondContact OE2-OH 2.86Å; Y50-Q54 CarbonylContact C-O 3.51Å; Y50-Q54 VanDerWaalsContact CA-O 3.22Å; Y50-Q54 WeakPolarHBondContact CA-O 3.05Å; Y50-L55 HydrophobicContact CD1-CB 4.37Å; Y50-L55 HydrophobicContact CE1-CB 4Å; Y50-L55 HydrophobicContact CE1-CD1 4.39Å; Y50-L55 HydrophobicContact CE2-CD1 4.07Å
51	S	95.4	Very high	97.1	Very high	40 Å²	40	70 Å²	70	28%	0.28	36%	0.361	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-119.5	127.1	169.6	-173.7	0	0	0	0	108.2	G53 Q54	S51-G53 PolarHBondContact O-N 3.34Å; S51-Q54 PolarHBondContact N-O 3.15Å; S51-Q54 PolarHBondContact O-N 2.9Å
52	E	92.9	Very high	97.3	Very high	184 Å²	184	69.6 Å²	69.6	86%	0.86	36%	0.362	S	S	*	.	T	Hydrogen-bonded Turn	trans	53.7	35.6	-177.1	-55.7	-179	164.5	0	0	112.8	Q54	E52-Q54 PolarHBondContact O-N 3.07Å
53	G	92.1	Very high	97.3	Very high	51 Å²	51	76.4 Å²	76.4	53%	0.526	39%	0.391	S	S	.	.	T	Hydrogen-bonded Turn	trans	76.5	-3.9	-178.9	0	0	0	0	0	115.3	S51	S51-G53 PolarHBondContact O-N 3.34Å
54	Q	97	Very high	97.2	Very high	123 Å²	123	75.7 Å²	75.7	58%	0.575	38%	0.384	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-95.1	136.4	176.6	-61.9	-174.5	7.6	0	0	111.3	Y50 S51 E52 K56	Y50-Q54 CarbonylContact C-O 3.51Å; Y50-Q54 VanDerWaalsContact CA-O 3.22Å; Y50-Q54 WeakPolarHBondContact CA-O 3.05Å; S51-Q54 PolarHBondContact N-O 3.15Å; S51-Q54 PolarHBondContact O-N 2.9Å; E52-Q54 PolarHBondContact O-N 3.07Å; Q54-K56 PolarHBondContact O-N 2.96Å
55	L	97.7	Very high	97.2	Very high	81 Å²	81	83.2 Å²	83.2	42%	0.424	41%	0.412	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-62.4	124.7	171.9	178.7	68.4	0	0	0	109.5	E48 Y50 K58	E48-L55 HydrophobicContact CB-CD1 3.85Å; E48-L55 HydrophobicContact CG-CD1 4.22Å; Y50-L55 HydrophobicContact CD1-CB 4.37Å; Y50-L55 HydrophobicContact CE1-CB 4Å; Y50-L55 HydrophobicContact CE1-CD1 4.39Å; Y50-L55 HydrophobicContact CE2-CD1 4.07Å; L55-K58 HydrophobicContact CD1-CG 4.43Å
56	K	97.9	Very high	97.1	Very high	116 Å²	116	79 Å²	79	50%	0.504	40%	0.395	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-104.9	-47.5	177.4	-67.8	-59.4	-174.2	-175.6	0	112.2	E49 Q54	E49-K56 HydrophobicContact CG-CB 4.42Å; E49-K56 PolarHBondContact O-N 3.5Å; Q54-K56 PolarHBondContact O-N 2.96Å
57	S	98	Very high	97.1	Very high	43 Å²	43	76.9 Å²	76.9	30%	0.301	39%	0.388	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-148.4	156	-173.3	-66.6	0	0	0	0	111.8	E48 E49	E48-S57 WeakPolarHBondContact CA-O 3.46Å; E49-S57 PolarHBondContact N-O 3.35Å
58	K	98.3	Very high	97	Very high	143 Å²	143	80.3 Å²	80.3	62%	0.622	41%	0.406	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-119.5	125.6	167.5	-55.3	-162.9	-177.7	-141.3	0	108.7	E48 L55	E48-K58 HydrophobicContact CG-CD 4.44Å; E48-K58 HydrophobicContact CG-CG 4.17Å; E48-K58 WeakPolarHBondContact OE1-CE 2.98Å; E48-K58 IonicContact OE1-NZ 2.74Å; E48-K58 PolarHBondContact OE1-NZ 3.5Å; L55-K58 HydrophobicContact CD1-CG 4.43Å
59	Y	97.4	Very high	96.9	Very high	115 Å²	115	79.3 Å²	79.3	45%	0.451	40%	0.403	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107	-23.1	-176	-64	-65.1	0	0	0	113.3	Y29 T47 E49 D61	Y29-Y59 HydrophobicContact CE1-CD2 4.01Å; Y29-Y59 AromaticContact CE1-CE2 3.77Å; Y29-Y59 HydrophobicContact CE1-CE2 3.77Å; T47-Y59 PolarHBondContact O-N 2.83Å; E49-Y59 HydrophobicContact CB-CD2 4.45Å; E49-Y59 HydrophobicContact CB-CE2 3.75Å; E49-Y59 VanDerWaalsContact OE2-CE2 3.3Å; E49-Y59 WeakPolarHBondContact OE2-CE2 3.37Å; E49-Y59 PolarHBondContact OE2-OH 2.62Å; Y59-D61 PolarHBondContact O-N 3.19Å
60	G	97	Very high	96.9	Very high	30 Å²	30	82.7 Å²	82.7	31%	0.309	42%	0.421	S	S	.	.	E	Extended strand (participates in β ladder)	trans	72.2	-110.3	-169.5	0	0	0	0	0	109.5	E45 Q46 T47	E45-G60 CarbonylContact C-O 3.56Å; Q46-G60 PolarHBondContact N-O 2.86Å; T47-G60 VanDerWaalsContact CB-O 3.27Å; T47-G60 WeakPolarHBondContact CB-O 3.35Å; T47-G60 PolarHBondContact N-O 3Å; T47-G60 PolarHBondContact O-N 3.07Å; T47-G60 PolarHBondContact OG1-O 3.12Å; T47-G60 VanDerWaalsContact OG1-O 3.08Å
61	D	97.7	Very high	96.7	Very high	134 Å²	134	85.9 Å²	85.9	72%	0.717	43%	0.434	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-83.3	127	179.1	-62	-9.1	0	0	0	110.2	M44 Y59	M44-D61 WeakPolarHBondContact O-CA 3.24Å; Y59-D61 PolarHBondContact O-N 3.19Å
62	A	97.8	Very high	96.8	Very high	23 Å²	23	85.5 Å²	85.5	19%	0.19	43%	0.428	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.3	147	-176.6	0	0	0	0	0	111.7	M44 T47	M44-A62 PolarHBondContact N-O 3.09Å; M44-A62 PolarHBondContact O-N 3.02Å; T47-A62 HydrophobicContact CG2-CB 3.78Å
63	F	97.6	Very high	96.9	Very high	145 Å²	145	78.6 Å²	78.6	64%	0.636	40%	0.4	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-117.8	125.2	171.9	179.3	-96.5	0	0	0	109.9	N41 I42	N41-F63 HydrophobicContact CB-CE2 3.88Å; N41-F63 HydrophobicContact CB-CZ 3.66Å; I42-F63 CarbonylContact O-C 3.56Å; I42-F63 WeakPolarHBondContact O-CA 3.33Å
64	I	97.6	Very high	97	Very high	11 Å²	11	78.6 Å²	78.6	6%	0.056	40%	0.395	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.3	123.2	178.6	-59	174.5	0	0	0	108.5	V21 L23 Y29 N41 I42 M44 V69	V21-I64 HydrophobicContact CB-CD1 4.27Å; V21-I64 HydrophobicContact CG1-CD1 4.04Å; L23-I64 HydrophobicContact CD2-CG2 3.73Å; Y29-I64 HydrophobicContact CD1-CD1 4.39Å; Y29-I64 HydrophobicContact CD2-CD1 4.23Å; Y29-I64 HydrophobicContact CG-CD1 3.89Å; N41-I64 WeakPolarHBondContact CA-O 3.21Å; I42-I64 HydrophobicContact CB-CB 4.3Å; I42-I64 PolarHBondContact N-O 3.23Å; I42-I64 PolarHBondContact O-N 3.41Å; M44-I64 HydrophobicContact SD-CD1 3.94Å; I64-V69 HydrophobicContact CG2-CG2 3.79Å
65	R	97.5	Very high	96.7	Very high	161 Å²	161	76.9 Å²	76.9	61%	0.608	39%	0.387	S	S	*	.			trans	-72.5	128.8	174.6	-166	-174	172.8	173.2	-2.1	110.6	N41 N67 N68	N41-R65 WeakPolarHBondContact OD1-CA 3.31Å; R65-N67 VanDerWaalsContact C-N 3.34Å; R65-N67 WeakPolarHBondContact CD-OD1 3.43Å; R65-N67 WeakPolarHBondContact CG-OD1 3.35Å; R65-N67 PolarHBondContact NE-OD1 3.13Å; R65-N67 PolarHBondContact O-N 2.9Å; R65-N68 WeakPolarHBondContact O-CB 3.4Å; R65-N68 PolarHBondContact O-N 2.94Å; R65-N68 VanDerWaalsContact O-N 3.09Å
66	G	96.7	Very high	95.9	Very high	7 Å²	7	82.2 Å²	82.2	7%	0.072	41%	0.407	C	S	.	.	G	3₁₀ helix	trans	-63	-30.4	-167	0	0	0	0	0	115.9	L40 N41 N68 V69	L40-G66 VanDerWaalsContact C-CA 3.45Å; L40-G66 WeakPolarHBondContact O-CA 3.28Å; N41-G66 PolarHBondContact OD1-N 3.2Å; G66-N68 PolarHBondContact O-N 3.4Å; G66-N68 VanDerWaalsContact O-N 3.12Å; G66-V69 WeakPolarHBondContact O-CB 3.42Å; G66-V69 PolarHBondContact O-N 3.16Å
67	N	96.8	Very high	94.5	Very high	96 Å²	96	88 Å²	88	51%	0.513	43%	0.426	S	S	.	.	G	3₁₀ helix	trans	-68.2	-11.4	178	71.8	-79.5	0	0	0	113.8	N24 R65	N24-N67 PolarHBondContact ND2-O 2.98Å; R65-N67 VanDerWaalsContact C-N 3.34Å; R65-N67 WeakPolarHBondContact CD-OD1 3.43Å; R65-N67 WeakPolarHBondContact CG-OD1 3.35Å; R65-N67 PolarHBondContact NE-OD1 3.13Å; R65-N67 PolarHBondContact O-N 2.9Å
68	N	97	Very high	92.9	Very high	72 Å²	72	97.8 Å²	97.8	39%	0.385	46%	0.456	S	S	.	.	G	3₁₀ helix	trans	-90.9	-10.1	174.1	-62.6	-54.1	0	0	0	112.7	L23 N24 R65 G66	L23-N68 CarbonylContact C-O 3.59Å; L23-N68 VanDerWaalsContact CA-O 3.24Å; L23-N68 WeakPolarHBondContact CA-O 3.23Å; L23-N68 HydrophobicContact CD2-CB 4.36Å; N24-N68 PolarHBondContact N-O 3.2Å; N24-N68 PolarHBondContact ND2-O 3.11Å; R65-N68 WeakPolarHBondContact O-CB 3.4Å; R65-N68 PolarHBondContact O-N 2.94Å; R65-N68 VanDerWaalsContact O-N 3.09Å; G66-N68 PolarHBondContact O-N 3.4Å; G66-N68 VanDerWaalsContact O-N 3.12Å
69	V	96.8	Very high	90.4	Very high	23 Å²	23	102.3 Å²	102.3	14%	0.139	49%	0.486	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.1	125.2	-174.3	179.5	0	0	0	0	109.8	V21 L23 I42 I64 G66	V21-V69 HydrophobicContact CG1-CG1 3.95Å; V21-V69 HydrophobicContact CG1-CG2 3.97Å; L23-V69 HydrophobicContact CD2-CG2 4.35Å; I42-V69 HydrophobicContact CD1-CG1 4.41Å; I42-V69 HydrophobicContact CD1-CG2 3.85Å; I64-V69 HydrophobicContact CG2-CG2 3.79Å; G66-V69 WeakPolarHBondContact O-CB 3.42Å; G66-V69 PolarHBondContact O-N 3.16Å
70	L	96.9	Very high	90.1	Very high	103 Å²	103	101.7 Å²	101.7	54%	0.539	49%	0.488	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-84	-48.9	170.2	179	61.9	0	0	0	110.5	K22	K22-L70 HydrophobicContact CD-CD2 4.03Å; K22-L70 HydrophobicContact CG-CD2 4.29Å; K22-L70 WeakPolarHBondContact O-CB 3.45Å; K22-L70 PolarHBondContact O-N 3.07Å
71	Y	95.5	Very high	89.7	Confident	102 Å²	102	105.5 Å²	105.5	40%	0.4	50%	0.497	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-155.7	161.6	171.6	68.5	-105.8	0	0	0	112.3	V21 K22	V21-Y71 WeakPolarHBondContact CA-O 3.39Å; K22-Y71 HydrophobicContact CB-CD1 4.01Å; K22-Y71 HydrophobicContact CB-CD2 4.34Å; K22-Y71 HydrophobicContact CB-CE1 3.65Å; K22-Y71 HydrophobicContact CB-CE2 3.97Å; K22-Y71 HydrophobicContact CB-CG 4.35Å; K22-Y71 HydrophobicContact CD-CD1 4.45Å; K22-Y71 HydrophobicContact CD-CE1 3.63Å; K22-Y71 WeakPolarHBondContact CE-OH 3.17Å; K22-Y71 HydrophobicContact CG-CE1 4.16Å; K22-Y71 PolarHBondContact N-O 3.27Å; K22-Y71 PolarHBondContact O-N 2.76Å
72	I	95.9	Very high	89.3	Confident	32 Å²	32	103.9 Å²	103.9	16%	0.164	49%	0.485	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.6	139.8	165.1	-177.6	167.3	0	0	0	109.4	F10 L11 I14 V19 V20 V21 L33 I42	F10-I72 HydrophobicContact CE1-CG2 4.38Å; L11-I72 HydrophobicContact CD2-CG2 4.32Å; I14-I72 HydrophobicContact CD1-CD1 3.59Å; I14-I72 HydrophobicContact CD1-CG1 3.91Å; V19-I72 HydrophobicContact CB-CD1 4.36Å; V19-I72 HydrophobicContact CB-CG1 4.31Å; V19-I72 HydrophobicContact CG1-CD1 4.37Å; V19-I72 HydrophobicContact CG2-CD1 4.4Å; V20-I72 CarbonylContact O-C 3.54Å; V20-I72 WeakPolarHBondContact O-CA 3.41Å; V21-I72 HydrophobicContact CG2-CB 4.42Å; V21-I72 HydrophobicContact CG2-CD1 4.1Å; V21-I72 HydrophobicContact CG2-CG1 4.06Å; L33-I72 HydrophobicContact CD1-CD1 4.45Å; L33-I72 HydrophobicContact CD2-CD1 4.27Å; I42-I72 HydrophobicContact CD1-CD1 4.3Å
73	S	95.4	Very high	88.8	Confident	39 Å²	39	108.6 Å²	108.6	27%	0.273	50%	0.502	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.7	149.3	176.9	67.2	0	0	0	0	111.2	V19 V20	V19-S73 CarbonylContact C-O 3.59Å; V19-S73 VanDerWaalsContact CA-O 3.3Å; V19-S73 WeakPolarHBondContact CA-O 3.43Å; V19-S73 WeakPolarHBondContact CB-O 3.38Å; V20-S73 PolarHBondContact N-O 2.92Å; V20-S73 PolarHBondContact O-N 2.89Å; V20-S73 PolarHBondContact O-OG 2.99Å
74	A	94.8	Very high	88.2	Confident	51 Å²	51	106.4 Å²	106.4	42%	0.421	49%	0.494	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-66.3	133.1	168.6	0	0	0	0	0	109.4	I14 K76	I14-A74 HydrophobicContact CG2-CB 3.95Å; A74-K76 PolarHBondContact O-N 2.81Å
75	Q	91.6	Very high	87.6	Confident	87 Å²	87	112.7 Å²	112.7	41%	0.407	52%	0.523	S	S	.	.	P	Polyproline II helix	trans	-71.1	117	176.6	-165.6	176	21.7	0	0	109	P18 V20 R77	P18-Q75 HydrophobicContact CB-CB 3.95Å; P18-Q75 WeakPolarHBondContact O-CB 3.22Å; P18-Q75 PolarHBondContact O-N 2.75Å; V20-Q75 HydrophobicContact CG2-CB 4.25Å; V20-Q75 HydrophobicContact CG2-CG 4.12Å; Q75-R77 PolarHBondContact O-N 3.37Å
76	K	80.6	Confident	86.9	Confident	193 Å²	193	109.3 Å²	109.3	84%	0.839	52%	0.517	S	S	*	.	P	Polyproline II helix	trans	-63.9	123	172.4	-80.8	-174.8	177.3	179.2	0	108.6	A74 R78	A74-K76 PolarHBondContact O-N 2.81Å; K76-R78 PolarHBondContact O-N 3.15Å; K76-R78 VanDerWaalsContact O-N 3.09Å
77	R	68.3	Low	86.2	Confident	239 Å²	239	117.2 Å²	117.2	90%	0.902	55%	0.551	S	S	*	*	P	Polyproline II helix	trans	-55	116.3	164.1	-94.4	179.5	155	-173.4	-6.9	107.7	Q75 L79	Q75-R77 PolarHBondContact O-N 3.37Å; R77-L79 PolarHBondContact O-N 3.14Å
78	R	64.9	Low	85.3	Confident	248 Å²	248	118.9 Å²	118.9	94%	0.936	55%	0.554	S	S	*	*			trans	-69.2	114.4	159.8	-92.9	-179.7	140.3	-179.3	-6.3	106.3	K76	K76-R78 PolarHBondContact O-N 3.15Å; K76-R78 VanDerWaalsContact O-N 3.09Å
79	L	45.6	Very low	84.2	Confident	238 Å²	238	123.2 Å²	123.2	100%	1.246	57%	0.57	S	S	*	*			trans	-66.9	0	160	-70	168.2	0	0	0	108.9	R77	R77-L79 PolarHBondContact O-N 3.14Å

Retrieved 79 of 79 residues in 17.3 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).