A0A077ZP11_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZP11, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 106 aa.

						>A0A077ZP11_TRITR|A0A077ZP11
MQSDKASEENAITLRSGRLMRSRPWLSDHRQSPPRGGVGTVSYESNKATATEIAAAAPASVAALMVGMFESFLTQVRTDLQELKVSGRPGLSSLGSLNNGDALAGR
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	49.3	Very low	55.4	Low	247 Å²	247	137 Å²	137	100%	1.217	74%	0.742	S	S	*	*				0	110.6	0	-77.9	177.7	165	0	0	107.3
2	Q	41.1	Very low	56.9	Low	178 Å²	178	135.1 Å²	135.1	83%	0.832	73%	0.729	S	S	*	*			trans	-87.6	116.1	-178.5	-164.9	164	9.6	0	0	106.5
3	S	50.5	Low	58.7	Low	95 Å²	95	131.8 Å²	131.8	66%	0.664	72%	0.716	S	S	*	*			trans	-108.1	99.9	169.8	59.8	0	0	0	0	107.3	K5	S3-K5 VanDerWaalsContact C-N 3.31Å; S3-K5 PolarHBondContact O-N 2.82Å
4	D	52.8	Low	60.5	Low	141 Å²	141	127.5 Å²	127.5	75%	0.754	69%	0.692	S	S	*	*			trans	-61.1	93.2	170.6	-69.4	-42.4	0	0	0	108.5	A6	D4-A6 VanDerWaalsContact C-N 3.26Å; D4-A6 PolarHBondContact O-N 2.82Å
5	K	53.4	Low	62.2	Low	186 Å²	186	136.5 Å²	136.5	81%	0.809	71%	0.712	S	S	*	*			trans	-73.4	91.7	167.9	-71	-73.4	-176.8	173.6	0	106.1	S3 S7	S3-K5 VanDerWaalsContact C-N 3.31Å; S3-K5 PolarHBondContact O-N 2.82Å; K5-S7 PolarHBondContact O-N 2.76Å
6	A	51.8	Low	63.6	Low	92 Å²	92	133.1 Å²	133.1	76%	0.76	70%	0.703	S	S	*	*			trans	-45.2	108.4	163.7	0	0	0	0	0	107.9	D4 E8	D4-A6 VanDerWaalsContact C-N 3.26Å; D4-A6 PolarHBondContact O-N 2.82Å; A6-E8 PolarHBondContact O-N 3.09Å
7	S	58.6	Low	64.7	Low	109 Å²	109	128.8 Å²	128.8	76%	0.762	70%	0.698	S	S	*	*			trans	-66	102.5	174.6	178.1	0	0	0	0	106.6	K5 E9	K5-S7 PolarHBondContact O-N 2.76Å; S7-E9 PolarHBondContact O-N 3.37Å
8	E	56.5	Low	65.6	Low	184 Å²	184	131.9 Å²	131.9	86%	0.86	70%	0.698	S	S	*	*			trans	-61.8	92.5	163.8	-80.2	178.4	153.2	0	0	107.2	A6 N10	A6-E8 PolarHBondContact O-N 3.09Å; E8-N10 PolarHBondContact O-N 3.44Å
9	E	62.4	Low	66.3	Low	105 Å²	105	130 Å²	130	49%	0.491	69%	0.687	S	S	.	*			trans	-60.5	100.4	173.4	-173.4	-179	173.3	0	0	107.8	S7 A11 R21	S7-E9 PolarHBondContact O-N 3.37Å; E9-A11 PolarHBondContact O-N 2.85Å; E9-R21 WeakPolarHBondContact OE1-CD 3.24Å; E9-R21 VanDerWaalsContact OE1-CG 3.31Å; E9-R21 WeakPolarHBondContact OE1-CG 3.44Å; E9-R21 IonicContact OE1-CZ 3.61Å; E9-R21 IonicContact OE1-NE 3.55Å; E9-R21 IonicContact OE1-NH1 2.84Å; E9-R21 PolarHBondContact OE1-NH1 2.83Å; E9-R21 IonicContact OE2-CZ 2.88Å; E9-R21 IonicContact OE2-NH1 3.59Å; E9-R21 PolarHBondContact OE2-NH1 3.4Å
10	N	63.8	Low	66.6	Low	134 Å²	134	129.1 Å²	129.1	72%	0.717	68%	0.68	S	S	*	*			trans	-57	96.7	174.8	-93.9	-52.5	0	0	0	109.7	E8 S22	E8-N10 PolarHBondContact O-N 3.44Å; N10-S22 PolarHBondContact O-OG 2.76Å
11	A	69.2	Low	67	Low	36 Å²	36	129.6 Å²	129.6	30%	0.298	67%	0.673	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-111.1	124.3	176.7	0	0	0	0	0	109.3	E9 L19 R21	E9-A11 PolarHBondContact O-N 2.85Å; A11-L19 HydrophobicContact CB-CD2 3.33Å; A11-L19 HydrophobicContact CB-CG 3.72Å; A11-R21 HydrophobicContact CB-CG 3.89Å
12	I	73.2	Confident	67.9	Low	114 Å²	114	121.8 Å²	121.8	59%	0.585	64%	0.643	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-96.2	124.6	-179.4	-57.4	171.9	0	0	0	107.7	M20	I12-M20 PolarHBondContact N-O 3.04Å; I12-M20 WeakPolarHBondContact O-CB 3.16Å; I12-M20 PolarHBondContact O-N 3.01Å
13	T	81.1	Confident	69.1	Low	92 Å²	92	123.9 Å²	123.9	56%	0.564	64%	0.643	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-81.2	122.3	177.5	-59.3	0	0	0	0	109.8
14	L	83.7	Confident	69.6	Low	72 Å²	72	124.8 Å²	124.8	38%	0.377	65%	0.647	S	S	.	*	P	Polyproline II helix	trans	-80.1	157.6	177.8	-57.3	179.1	0	0	0	110.8	S16 G17 R18 M20	L14-S16 PolarHBondContact O-N 2.83Å; L14-G17 WeakPolarHBondContact O-CA 3.36Å; L14-G17 PolarHBondContact O-N 3.47Å; L14-R18 WeakPolarHBondContact CB-O 2.92Å; L14-R18 PolarHBondContact N-O 3.12Å; L14-M20 HydrophobicContact CD1-CB 4.05Å; L14-M20 HydrophobicContact CD1-SD 4.22Å; L14-M20 HydrophobicContact CD2-CB 4.06Å; L14-M20 HydrophobicContact CD2-SD 4.11Å; L14-M20 HydrophobicContact CG-CB 3.95Å
15	R	85.3	Confident	69.8	Low	263 Å²	263	129.3 Å²	129.3	99%	0.992	65%	0.654	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.6	-19	177.8	-166	173.4	174.5	160.1	-1	113.8	G17	R15-G17 PolarHBondContact O-N 3.49Å
16	S	85.6	Confident	70.1	Confident	82 Å²	82	128.1 Å²	128.1	57%	0.573	66%	0.655	S	S	*	*	T	Hydrogen-bonded Turn	trans	-78.2	-0.9	172.7	58.4	0	0	0	0	114.4	L14 R18	L14-S16 PolarHBondContact O-N 2.83Å; S16-R18 PolarHBondContact O-N 3.47Å
17	G	81.5	Confident	69.8	Low	59 Å²	59	128.4 Å²	128.4	61%	0.608	65%	0.652	S	S	*	*	S	Bend	trans	78.6	0.7	-172.5	0	0	0	0	0	114.1	L14 R15	L14-G17 WeakPolarHBondContact O-CA 3.36Å; L14-G17 PolarHBondContact O-N 3.47Å; R15-G17 PolarHBondContact O-N 3.49Å
18	R	81.3	Confident	69.4	Low	186 Å²	186	128.9 Å²	128.9	70%	0.702	65%	0.646	S	S	*	*			trans	-84.2	137.3	179.9	-63.5	-174.8	179.6	-167.5	-0.7	111	L14 S16	L14-R18 WeakPolarHBondContact CB-O 2.92Å; L14-R18 PolarHBondContact N-O 3.12Å; S16-R18 PolarHBondContact O-N 3.47Å
19	L	79.3	Confident	69.1	Low	95 Å²	95	127.8 Å²	127.8	50%	0.497	64%	0.64	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-80.7	118.4	175.8	-136	89.5	0	0	0	109.8	A11 R21	A11-L19 HydrophobicContact CB-CD2 3.33Å; A11-L19 HydrophobicContact CB-CG 3.72Å; L19-R21 HydrophobicContact CD2-CG 4.25Å
20	M	71.3	Confident	68.5	Low	111 Å²	111	135 Å²	135	55%	0.547	66%	0.663	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-96.8	106.5	172.8	-161.3	170.9	104.5	0	0	109.1	I12 L14	I12-M20 PolarHBondContact N-O 3.04Å; I12-M20 WeakPolarHBondContact O-CB 3.16Å; I12-M20 PolarHBondContact O-N 3.01Å; L14-M20 HydrophobicContact CD1-CB 4.05Å; L14-M20 HydrophobicContact CD1-SD 4.22Å; L14-M20 HydrophobicContact CD2-CB 4.06Å; L14-M20 HydrophobicContact CD2-SD 4.11Å; L14-M20 HydrophobicContact CG-CB 3.95Å
21	R	74.3	Confident	67.9	Low	141 Å²	141	137.6 Å²	137.6	53%	0.532	67%	0.671	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-91.4	118.1	176.3	-69.3	160.1	174.6	-128.5	7.6	108.6	E9 A11 L19 R23	E9-R21 WeakPolarHBondContact OE1-CD 3.24Å; E9-R21 VanDerWaalsContact OE1-CG 3.31Å; E9-R21 WeakPolarHBondContact OE1-CG 3.44Å; E9-R21 IonicContact OE1-CZ 3.61Å; E9-R21 IonicContact OE1-NE 3.55Å; E9-R21 IonicContact OE1-NH1 2.84Å; E9-R21 PolarHBondContact OE1-NH1 2.83Å; E9-R21 IonicContact OE2-CZ 2.88Å; E9-R21 IonicContact OE2-NH1 3.59Å; E9-R21 PolarHBondContact OE2-NH1 3.4Å; A11-R21 HydrophobicContact CB-CG 3.89Å; L19-R21 HydrophobicContact CD2-CG 4.25Å; R21-R23 PolarHBondContact O-N 3.46Å; R21-R23 VanDerWaalsContact O-N 3.11Å
22	S	68.6	Low	67.4	Low	82 Å²	82	140.7 Å²	140.7	57%	0.573	69%	0.69	S	S	*	*			trans	-66.8	107.2	170.9	35.6	0	0	0	0	108.6	N10	N10-S22 PolarHBondContact O-OG 2.76Å
23	R	67.5	Low	66.8	Low	222 Å²	222	140.7 Å²	140.7	84%	0.838	70%	0.697	S	S	*	*			trans	-61.5	131.1	174.4	-72.1	-174.8	-177.9	-150.3	-0.4	108.5	R21 W25	R21-R23 PolarHBondContact O-N 3.46Å; R21-R23 VanDerWaalsContact O-N 3.11Å; R23-W25 PolarHBondContact O-N 3.22Å
24	P	60.5	Low	65.7	Low	115 Å²	115	142.1 Å²	142.1	75%	0.747	71%	0.709	S	S	*	*			trans	-55.8	116.5	167.7	-18	29.5	0	0	0	107	L26	P24-L26 PolarHBondContact O-N 2.96Å
25	W	57.5	Low	64.3	Low	236 Å²	236	150.5 Å²	150.5	89%	0.894	74%	0.735	S	S	*	*			trans	-58.8	105.5	169.5	-92.2	44.1	0	0	0	106.2	R23 S27	R23-W25 PolarHBondContact O-N 3.22Å; W25-S27 PolarHBondContact O-N 2.94Å
26	L	58	Low	62.7	Low	160 Å²	160	141.1 Å²	141.1	84%	0.838	72%	0.72	S	S	*	*			trans	-63.3	94.8	161.3	-90.4	98.9	0	0	0	105.8	P24 D28	P24-L26 PolarHBondContact O-N 2.96Å; L26-D28 PolarHBondContact O-N 3.02Å
27	S	46	Very low	61	Low	99 Å²	99	140.7 Å²	140.7	69%	0.692	73%	0.729	S	S	*	*			trans	-67.6	76.4	167.9	-63.9	0	0	0	0	108.1	W25	W25-S27 PolarHBondContact O-N 2.94Å
28	D	49.7	Very low	60	Low	119 Å²	119	144.1 Å²	144.1	64%	0.636	74%	0.738	S	S	*	*			trans	-144.1	116.3	166.7	-91.5	-41.1	0	0	0	113.1	L26	L26-D28 PolarHBondContact O-N 3.02Å
29	H	51.2	Low	59	Low	160 Å²	160	138.2 Å²	138.2	74%	0.741	74%	0.735	S	S	*	*			trans	74.2	90.4	148.9	-56.6	-7	0	0	0	117.1	Q31	H29-Q31 VanDerWaalsContact C-N 3.27Å; H29-Q31 PolarHBondContact O-N 3.33Å
30	R	49.3	Very low	58	Low	258 Å²	258	139.8 Å²	139.8	97%	0.974	75%	0.748	S	S	*	*			trans	30.3	55.6	140.2	-68.7	-169.9	176.5	-175.5	0.5	115.2	S32	R30-S32 PolarHBondContact O-N 2.78Å
31	Q	52.2	Low	57.6	Low	187 Å²	187	140.8 Å²	140.8	87%	0.874	76%	0.76	S	S	*	*			trans	-90.8	98.8	164.6	-158.6	166.1	8.2	0	0	106.2	H29	H29-Q31 VanDerWaalsContact C-N 3.27Å; H29-Q31 PolarHBondContact O-N 3.33Å
32	S	58.1	Low	56.9	Low	102 Å²	102	139 Å²	139	71%	0.713	77%	0.77	S	S	*	*	P	Polyproline II helix	trans	-48.1	134.1	173.7	-62.7	0	0	0	0	109.2	R30	R30-S32 PolarHBondContact O-N 2.78Å
33	P	59.8	Low	56.8	Low	113 Å²	113	144.2 Å²	144.2	73%	0.734	78%	0.778	S	S	*	*	P	Polyproline II helix	trans	-54.5	136.9	-174.7	19.5	-30.7	0	0	0	109.6	R35	P33-R35 PolarHBondContact O-N 2.84Å
34	P	57.9	Low	56.4	Low	123 Å²	123	142.2 Å²	142.2	80%	0.799	78%	0.778	S	S	*	*	P	Polyproline II helix	trans	-55.5	122.3	177.3	23.3	-31.7	0	0	0	107.1	G36	P34-G36 PolarHBondContact O-N 3.43Å
35	R	54.7	Low	56.4	Low	248 Å²	248	139 Å²	139	94%	0.936	76%	0.758	S	S	*	*			trans	-58.3	92.7	179	-160	177.7	-171.3	-161.1	3.2	106.2	P33 G37	P33-R35 PolarHBondContact O-N 2.84Å; R35-G37 PolarHBondContact O-N 3.49Å
36	G	52.7	Low	56.7	Low	65 Å²	65	135.3 Å²	135.3	67%	0.67	76%	0.756	S	S	*	*			trans	-53.9	111.2	-178.9	0	0	0	0	0	107	P34 V38	P34-G36 PolarHBondContact O-N 3.43Å; G36-V38 PolarHBondContact O-N 2.96Å
37	G	50.3	Low	56.9	Low	74 Å²	74	135.3 Å²	135.3	76%	0.763	75%	0.75	S	S	*	*			trans	-54.3	117.2	170.5	0	0	0	0	0	106.3	R35 G39	R35-G37 PolarHBondContact O-N 3.49Å; G37-G39 PolarHBondContact O-N 3.31Å
38	V	59	Low	57.8	Low	131 Å²	131	132.6 Å²	132.6	79%	0.794	73%	0.733	S	S	*	*			trans	-64.5	91.3	167.9	179.5	0	0	0	0	104.4	G36 T40	G36-V38 PolarHBondContact O-N 2.96Å; V38-T40 PolarHBondContact O-N 3.03Å
39	G	61.8	Low	58.7	Low	62 Å²	62	130.8 Å²	130.8	64%	0.639	73%	0.726	S	S	*	*			trans	-61.4	97.7	166.2	0	0	0	0	0	105.6	G37 V41	G37-G39 PolarHBondContact O-N 3.31Å; G39-V41 PolarHBondContact O-N 2.99Å
40	T	57.2	Low	59.5	Low	127 Å²	127	127 Å²	127	78%	0.779	72%	0.722	S	S	*	*			trans	-61.2	97.8	164.3	42.3	0	0	0	0	105.8	V38 S42	V38-T40 PolarHBondContact O-N 3.03Å; T40-S42 VanDerWaalsContact C-N 3.31Å; T40-S42 PolarHBondContact O-N 3.07Å
41	V	63.6	Low	60.5	Low	132 Å²	132	119.4 Å²	119.4	80%	0.8	71%	0.705	S	S	*	*			trans	-63.1	101.6	165.4	178.3	0	0	0	0	104.8	G39 Y43	G39-V41 PolarHBondContact O-N 2.99Å; V41-Y43 VanDerWaalsContact C-N 3.25Å; V41-Y43 PolarHBondContact O-N 3.3Å
42	S	59.2	Low	61.2	Low	104 Å²	104	116.2 Å²	116.2	73%	0.727	69%	0.69	S	S	*	*			trans	-65.4	95.1	169.4	-177.4	0	0	0	0	106.4	T40 E44	T40-S42 VanDerWaalsContact C-N 3.31Å; T40-S42 PolarHBondContact O-N 3.07Å; S42-E44 PolarHBondContact O-N 3.29Å
43	Y	65.6	Low	61.6	Low	192 Å²	192	116.4 Å²	116.4	75%	0.753	68%	0.682	S	S	*	*			trans	-72.8	90.6	166.3	-173.9	-107.6	0	0	0	106	V41 S45	V41-Y43 VanDerWaalsContact C-N 3.25Å; V41-Y43 PolarHBondContact O-N 3.3Å; Y43-S45 VanDerWaalsContact CD1-CB 3.48Å; Y43-S45 VanDerWaalsContact CE1-OG 3.28Å; Y43-S45 WeakPolarHBondContact CE1-OG 3.33Å; Y43-S45 PolarHBondContact O-N 2.96Å
44	E	59.3	Low	62	Low	179 Å²	179	114 Å²	114	84%	0.836	67%	0.672	S	S	*	*			trans	-68	79.1	165.9	-143.6	168.4	-160.6	0	0	106.2	S42 N46	S42-E44 PolarHBondContact O-N 3.29Å; E44-N46 VanDerWaalsContact C-N 3.29Å; E44-N46 PolarHBondContact O-N 2.92Å
45	S	61	Low	62.8	Low	48 Å²	48	111.7 Å²	111.7	34%	0.336	66%	0.663	S	S	.	*			trans	-64.8	98.4	174.3	-165.8	0	0	0	0	105.5	Y43 K47	Y43-S45 VanDerWaalsContact CD1-CB 3.48Å; Y43-S45 VanDerWaalsContact CE1-OG 3.28Å; Y43-S45 WeakPolarHBondContact CE1-OG 3.33Å; Y43-S45 PolarHBondContact O-N 2.96Å; S45-K47 PolarHBondContact O-N 2.94Å; S45-K47 WeakPolarHBondContact OG-CE 3.31Å; S45-K47 WeakPolarHBondContact OG-CG 3.44Å
46	N	63.7	Low	63.8	Low	159 Å²	159	102.5 Å²	102.5	85%	0.85	64%	0.641	S	S	*	*			trans	-68.4	71.7	169.8	-153.5	2.3	0	0	0	107.7	E44 A48	E44-N46 VanDerWaalsContact C-N 3.29Å; E44-N46 PolarHBondContact O-N 2.92Å; N46-A48 PolarHBondContact O-N 2.98Å
47	K	62.3	Low	64.9	Low	160 Å²	160	101.6 Å²	101.6	70%	0.696	63%	0.626	S	S	*	*			trans	-76.9	79	173.2	-65.4	-176.8	-177.1	178.4	0	105.2	S45 T49	S45-K47 PolarHBondContact O-N 2.94Å; S45-K47 WeakPolarHBondContact OG-CE 3.31Å; S45-K47 WeakPolarHBondContact OG-CG 3.44Å; K47-T49 VanDerWaalsContact C-N 3.29Å; K47-T49 PolarHBondContact O-N 2.9Å
48	A	64.7	Low	66.5	Low	42 Å²	42	102 Å²	102	35%	0.347	62%	0.615	S	S	.	*			trans	-49.3	109.8	153.7	0	0	0	0	0	105	N46 A50 E52 I53	N46-A48 PolarHBondContact O-N 2.98Å; A48-A50 PolarHBondContact O-N 3.37Å; A48-E52 WeakPolarHBondContact CA-OE2 3.43Å; A48-I53 HydrophobicContact CB-CD1 4.3Å; A48-I53 HydrophobicContact CB-CG1 4.07Å
49	T	69.8	Low	67.7	Low	80 Å²	80	98.9 Å²	98.9	49%	0.491	60%	0.604	S	S	.	*			trans	-63.8	145.1	-171.7	-54.4	0	0	0	0	106	K47 T51 E52 I53	K47-T49 VanDerWaalsContact C-N 3.29Å; K47-T49 PolarHBondContact O-N 2.9Å; T49-T51 WeakPolarHBondContact CB-OG1 3.49Å; T49-T51 WeakPolarHBondContact CG2-OG1 3.28Å; T49-T51 CarbonylContact O-C 3.58Å; T49-T51 PolarHBondContact O-N 3.21Å; T49-E52 WeakPolarHBondContact O-CA 3.48Å; T49-E52 WeakPolarHBondContact O-CB 3.26Å; T49-E52 PolarHBondContact O-N 3.38Å; T49-I53 PolarHBondContact O-N 2.9Å
50	A	67.4	Low	68.8	Low	80 Å²	80	99.4 Å²	99.4	66%	0.661	60%	0.598	S	S	*	*	H	α-helix	trans	-51.1	-28.3	179.8	0	0	0	0	0	112.2	A48 A54	A48-A50 PolarHBondContact O-N 3.37Å; A50-A54 VanDerWaalsContact O-CB 3.24Å; A50-A54 WeakPolarHBondContact O-CB 3.46Å; A50-A54 PolarHBondContact O-N 3.48Å
51	T	70.5	Confident	70.3	Confident	100 Å²	100	97.3 Å²	97.3	61%	0.613	58%	0.584	S	S	*	*	H	α-helix	trans	-64.1	-39.6	171	49.2	0	0	0	0	114.4	T49 A54 A55	T49-T51 WeakPolarHBondContact CB-OG1 3.49Å; T49-T51 WeakPolarHBondContact CG2-OG1 3.28Å; T49-T51 CarbonylContact O-C 3.58Å; T49-T51 PolarHBondContact O-N 3.21Å; T51-A54 PolarHBondContact O-N 3.19Å; T51-A55 WeakPolarHBondContact O-CB 3.42Å; T51-A55 PolarHBondContact O-N 3.45Å
52	E	65.8	Low	71.6	Confident	119 Å²	119	93.5 Å²	93.5	56%	0.556	57%	0.567	S	S	*	*	H	α-helix	trans	-68.6	-42.9	177.1	-170.5	179.1	-177	0	0	111	A48 T49 A54 A55 A56	A48-E52 WeakPolarHBondContact CA-OE2 3.43Å; T49-E52 WeakPolarHBondContact O-CA 3.48Å; T49-E52 WeakPolarHBondContact O-CB 3.26Å; T49-E52 PolarHBondContact O-N 3.38Å; E52-A54 VanDerWaalsContact C-N 3.34Å; E52-A55 PolarHBondContact O-N 2.94Å; E52-A56 WeakPolarHBondContact O-CB 3.35Å; E52-A56 PolarHBondContact O-N 2.81Å
53	I	66.9	Low	73.2	Confident	106 Å²	106	91.7 Å²	91.7	54%	0.544	56%	0.558	S	S	.	*	H	α-helix	trans	-62.7	-44.3	173.4	-59.1	175.9	0	0	0	110.1	A48 T49 A55 A56 A57	A48-I53 HydrophobicContact CB-CD1 4.3Å; A48-I53 HydrophobicContact CB-CG1 4.07Å; T49-I53 PolarHBondContact O-N 2.9Å; I53-A55 VanDerWaalsContact C-N 3.27Å; I53-A55 PolarHBondContact O-N 3.44Å; I53-A56 PolarHBondContact O-N 2.79Å; I53-A57 PolarHBondContact O-N 2.93Å
54	A	69.6	Low	74.5	Confident	64 Å²	64	87.9 Å²	87.9	53%	0.529	55%	0.55	S	S	.	*	H	α-helix	trans	-64.2	-31.2	176.8	0	0	0	0	0	112.7	A50 T51 E52 P58	A50-A54 VanDerWaalsContact O-CB 3.24Å; A50-A54 WeakPolarHBondContact O-CB 3.46Å; A50-A54 PolarHBondContact O-N 3.48Å; T51-A54 PolarHBondContact O-N 3.19Å; E52-A54 VanDerWaalsContact C-N 3.34Å; A54-P58 WeakPolarHBondContact O-CD 3.38Å
55	A	74.6	Confident	76.2	Confident	73 Å²	73	84.7 Å²	84.7	60%	0.603	54%	0.536	S	S	*	.	H	α-helix	trans	-76.6	-33.7	175.1	0	0	0	0	0	112.7	T51 E52 I53 P58	T51-A55 WeakPolarHBondContact O-CB 3.42Å; T51-A55 PolarHBondContact O-N 3.45Å; E52-A55 PolarHBondContact O-N 2.94Å; I53-A55 VanDerWaalsContact C-N 3.27Å; I53-A55 PolarHBondContact O-N 3.44Å; A55-P58 WeakPolarHBondContact O-CD 3.35Å
56	A	74.1	Confident	77.8	Confident	56 Å²	56	86.1 Å²	86.1	46%	0.463	54%	0.543	S	S	.	.	H	α-helix	trans	-77.2	-30.6	178.9	0	0	0	0	0	113.2	E52 I53 A59 S60	E52-A56 WeakPolarHBondContact O-CB 3.35Å; E52-A56 PolarHBondContact O-N 2.81Å; I53-A56 PolarHBondContact O-N 2.79Å; A56-A59 PolarHBondContact O-N 3.43Å; A56-S60 PolarHBondContact O-N 3Å
57	A	77.1	Confident	79.3	Confident	45 Å²	45	80.2 Å²	80.2	37%	0.372	52%	0.52	S	S	.	.	H	α-helix	trans	-56.4	-49.6	-178	0	0	0	0	0	113.1	I53 A59 S60 V61	I53-A57 PolarHBondContact O-N 2.93Å; A57-A59 VanDerWaalsContact C-N 3.33Å; A57-A59 PolarHBondContact O-N 3.23Å; A57-S60 PolarHBondContact O-N 3.43Å; A57-S60 PolarHBondContact O-OG 3.48Å; A57-V61 WeakPolarHBondContact O-CG2 3.26Å; A57-V61 PolarHBondContact O-N 2.96Å
58	P	83.2	Confident	80.9	Confident	82 Å²	82	77.3 Å²	77.3	53%	0.532	51%	0.51	S	S	.	.	H	α-helix	trans	-57.1	-41.6	176	-25.7	33.1	0	0	0	113.7	A54 A55 V61 A62	A54-P58 WeakPolarHBondContact O-CD 3.38Å; A55-P58 WeakPolarHBondContact O-CD 3.35Å; P58-V61 PolarHBondContact O-N 3.14Å; P58-A62 VanDerWaalsContact O-CB 3.27Å; P58-A62 WeakPolarHBondContact O-CB 3.38Å; P58-A62 PolarHBondContact O-N 3.42Å
59	A	84.4	Confident	82.4	Confident	66 Å²	66	81 Å²	81	55%	0.545	52%	0.518	S	S	.	.	H	α-helix	trans	-65.9	-42.2	179.6	0	0	0	0	0	111.6	A56 A57 A62 A63	A56-A59 PolarHBondContact O-N 3.43Å; A57-A59 VanDerWaalsContact C-N 3.33Å; A57-A59 PolarHBondContact O-N 3.23Å; A59-A62 PolarHBondContact O-N 3.4Å; A59-A63 WeakPolarHBondContact O-CB 3.45Å; A59-A63 PolarHBondContact O-N 2.98Å
60	S	85.2	Confident	83.7	Confident	74 Å²	74	82.8 Å²	82.8	52%	0.517	52%	0.521	S	S	.	.	H	α-helix	trans	-64.9	-41.9	177	70	0	0	0	0	112.5	A56 A57 A63 L64	A56-S60 PolarHBondContact O-N 3Å; A57-S60 PolarHBondContact O-N 3.43Å; A57-S60 PolarHBondContact O-OG 3.48Å; S60-A63 PolarHBondContact O-N 3.5Å; S60-L64 WeakPolarHBondContact O-CB 3.45Å; S60-L64 PolarHBondContact O-N 2.97Å
61	V	89.1	Confident	85.1	Confident	82 Å²	82	82.8 Å²	82.8	50%	0.497	52%	0.516	S	S	.	.	H	α-helix	trans	-65.6	-44.3	176.4	172.9	0	0	0	0	110.3	A57 P58 A63 L64 M65	A57-V61 WeakPolarHBondContact O-CG2 3.26Å; A57-V61 PolarHBondContact O-N 2.96Å; P58-V61 PolarHBondContact O-N 3.14Å; V61-A63 PolarHBondContact O-N 2.87Å; V61-L64 PolarHBondContact O-N 2.84Å; V61-M65 HydrophobicContact CG1-CG 4.22Å; V61-M65 WeakPolarHBondContact O-CG 3.47Å; V61-M65 PolarHBondContact O-N 3.22Å
62	A	89.8	Confident	86.4	Confident	52 Å²	52	83.9 Å²	83.9	43%	0.43	51%	0.513	S	S	.	.	H	α-helix	trans	-60.2	-45.7	177	0	0	0	0	0	111.8	P58 A59 L64 M65 V66	P58-A62 VanDerWaalsContact O-CB 3.27Å; P58-A62 WeakPolarHBondContact O-CB 3.38Å; P58-A62 PolarHBondContact O-N 3.42Å; A59-A62 PolarHBondContact O-N 3.4Å; A62-L64 VanDerWaalsContact C-N 3.32Å; A62-L64 PolarHBondContact O-N 2.88Å; A62-M65 PolarHBondContact O-N 3.36Å; A62-V66 VanDerWaalsContact O-CG2 3.3Å; A62-V66 WeakPolarHBondContact O-CG2 3.49Å; A62-V66 PolarHBondContact O-N 3.25Å
63	A	92.3	Very high	87.8	Confident	66 Å²	66	82.2 Å²	82.2	55%	0.545	51%	0.507	S	S	.	.	H	α-helix	trans	-60.2	-41.6	176.4	0	0	0	0	0	112.1	A59 S60 V61 V66 G67	A59-A63 WeakPolarHBondContact O-CB 3.45Å; A59-A63 PolarHBondContact O-N 2.98Å; S60-A63 PolarHBondContact O-N 3.5Å; V61-A63 PolarHBondContact O-N 2.87Å; A63-V66 PolarHBondContact O-N 2.87Å; A63-G67 PolarHBondContact O-N 2.98Å
64	L	94.8	Very high	89.2	Confident	112 Å²	112	81.4 Å²	81.4	59%	0.586	51%	0.507	S	S	*	.	H	α-helix	trans	-65.2	-42.3	175.6	-175.1	131.5	0	0	0	111.8	S60 V61 A62 G67 M68	S60-L64 WeakPolarHBondContact O-CB 3.45Å; S60-L64 PolarHBondContact O-N 2.97Å; V61-L64 PolarHBondContact O-N 2.84Å; A62-L64 VanDerWaalsContact C-N 3.32Å; A62-L64 PolarHBondContact O-N 2.88Å; L64-G67 PolarHBondContact O-N 2.86Å; L64-M68 HydrophobicContact CD2-CE 3.61Å; L64-M68 HydrophobicContact CD2-SD 4.02Å; L64-M68 WeakPolarHBondContact O-CG 3.42Å; L64-M68 PolarHBondContact O-N 3.05Å
65	M	94.5	Very high	90.5	Very high	112 Å²	112	83.3 Å²	83.3	55%	0.552	51%	0.505	S	S	*	.	H	α-helix	trans	-63.1	-41.1	175.9	-65.2	-131.3	77.8	0	0	112.3	V61 A62 M68 F69	V61-M65 HydrophobicContact CG1-CG 4.22Å; V61-M65 WeakPolarHBondContact O-CG 3.47Å; V61-M65 PolarHBondContact O-N 3.22Å; A62-M65 PolarHBondContact O-N 3.36Å; M65-M68 HydrophobicContact CB-CE 4.48Å; M65-M68 HydrophobicContact CE-CE 3.76Å; M65-M68 HydrophobicContact CG-CE 4.22Å; M65-M68 PolarHBondContact O-N 3.41Å; M65-F69 WeakPolarHBondContact O-CB 3.49Å; M65-F69 PolarHBondContact O-N 3.43Å
66	V	94.6	Very high	91.5	Very high	79 Å²	79	82.3 Å²	82.3	48%	0.479	49%	0.491	S	S	.	.	H	α-helix	trans	-62.4	-47.4	175.4	171.3	0	0	0	0	110.5	A62 A63 M68 F69 E70	A62-V66 VanDerWaalsContact O-CG2 3.3Å; A62-V66 WeakPolarHBondContact O-CG2 3.49Å; A62-V66 PolarHBondContact O-N 3.25Å; A63-V66 PolarHBondContact O-N 2.87Å; V66-M68 PolarHBondContact O-N 3.01Å; V66-F69 PolarHBondContact O-N 2.88Å; V66-F69 VanDerWaalsContact O-N 3.14Å; V66-E70 HydrophobicContact CG1-CG 4.38Å; V66-E70 WeakPolarHBondContact O-CG 3.11Å; V66-E70 PolarHBondContact O-N 2.96Å
67	G	95.4	Very high	92.5	Very high	35 Å²	35	87.7 Å²	87.7	36%	0.361	50%	0.5	S	S	.	.	H	α-helix	trans	-60.8	-41	177.5	0	0	0	0	0	113.4	A63 L64 E70 S71	A63-G67 PolarHBondContact O-N 2.98Å; L64-G67 PolarHBondContact O-N 2.86Å; G67-E70 PolarHBondContact O-N 2.82Å; G67-S71 WeakPolarHBondContact O-CB 3.31Å; G67-S71 PolarHBondContact O-N 2.9Å
68	M	95.5	Very high	93.3	Very high	98 Å²	98	87.9 Å²	87.9	48%	0.483	50%	0.496	S	S	.	.	H	α-helix	trans	-63.6	-41	174.2	-71	-171.9	-58.4	0	0	112	L64 M65 V66 S71 F72	L64-M68 HydrophobicContact CD2-CE 3.61Å; L64-M68 HydrophobicContact CD2-SD 4.02Å; L64-M68 WeakPolarHBondContact O-CG 3.42Å; L64-M68 PolarHBondContact O-N 3.05Å; M65-M68 HydrophobicContact CB-CE 4.48Å; M65-M68 HydrophobicContact CE-CE 3.76Å; M65-M68 HydrophobicContact CG-CE 4.22Å; M65-M68 PolarHBondContact O-N 3.41Å; V66-M68 PolarHBondContact O-N 3.01Å; M68-S71 PolarHBondContact O-N 3.01Å; M68-F72 WeakPolarHBondContact O-CB 3.42Å; M68-F72 PolarHBondContact O-N 2.84Å
69	F	96.8	Very high	93.7	Very high	120 Å²	120	87.7 Å²	87.7	53%	0.526	49%	0.491	S	S	.	.	H	α-helix	trans	-67.3	-42.6	178.8	-176.3	-104.9	0	0	0	112.1	M65 V66 S71 F72 L73	M65-F69 WeakPolarHBondContact O-CB 3.49Å; M65-F69 PolarHBondContact O-N 3.43Å; V66-F69 PolarHBondContact O-N 2.88Å; V66-F69 VanDerWaalsContact O-N 3.14Å; F69-S71 VanDerWaalsContact C-N 3.34Å; F69-S71 PolarHBondContact O-N 2.94Å; F69-F72 WeakPolarHBondContact O-CB 3.48Å; F69-F72 PolarHBondContact O-N 3.33Å; F69-L73 HydrophobicContact CD1-CD1 3.89Å; F69-L73 HydrophobicContact CD1-CG 4.31Å; F69-L73 HydrophobicContact CE1-CD1 3.31Å; F69-L73 HydrophobicContact CE1-CG 3.93Å; F69-L73 HydrophobicContact CE2-CG 4.41Å; F69-L73 HydrophobicContact CZ-CD1 3.72Å; F69-L73 HydrophobicContact CZ-CD2 4.13Å; F69-L73 HydrophobicContact CZ-CG 3.98Å; F69-L73 WeakPolarHBondContact O-CG 3.37Å; F69-L73 PolarHBondContact O-N 3.11Å
70	E	96.2	Very high	94.1	Very high	118 Å²	118	89.2 Å²	89.2	55%	0.551	49%	0.489	S	S	*	.	H	α-helix	trans	-61.4	-42.1	174.1	-73	179.7	172.2	0	0	111.8	V66 G67 L73 T74	V66-E70 HydrophobicContact CG1-CG 4.38Å; V66-E70 WeakPolarHBondContact O-CG 3.11Å; V66-E70 PolarHBondContact O-N 2.96Å; G67-E70 PolarHBondContact O-N 2.82Å; E70-L73 PolarHBondContact O-N 2.74Å; E70-T74 WeakPolarHBondContact O-CB 3.38Å; E70-T74 PolarHBondContact O-N 3.48Å; E70-T74 PolarHBondContact O-OG1 2.94Å
71	S	96.8	Very high	94.4	Very high	79 Å²	79	90.3 Å²	90.3	55%	0.552	49%	0.486	S	S	*	.	H	α-helix	trans	-61.4	-43.9	174	-173.5	0	0	0	0	111.5	G67 M68 F69 T74 Q75	G67-S71 WeakPolarHBondContact O-CB 3.31Å; G67-S71 PolarHBondContact O-N 2.9Å; M68-S71 PolarHBondContact O-N 3.01Å; F69-S71 VanDerWaalsContact C-N 3.34Å; F69-S71 PolarHBondContact O-N 2.94Å; S71-T74 PolarHBondContact O-N 2.85Å; S71-Q75 PolarHBondContact O-N 2.97Å
72	F	97.1	Very high	94.3	Very high	124 Å²	124	92.2 Å²	92.2	54%	0.544	49%	0.49	S	S	.	.	H	α-helix	trans	-62.2	-47.9	177.4	171.9	-100	0	0	0	111.8	M68 F69 T74 Q75 V76	M68-F72 WeakPolarHBondContact O-CB 3.42Å; M68-F72 PolarHBondContact O-N 2.84Å; F69-F72 WeakPolarHBondContact O-CB 3.48Å; F69-F72 PolarHBondContact O-N 3.33Å; F72-T74 VanDerWaalsContact C-N 3.28Å; F72-T74 PolarHBondContact O-N 3.45Å; F72-Q75 PolarHBondContact O-N 2.87Å; F72-V76 HydrophobicContact CD1-CG2 4.31Å; F72-V76 HydrophobicContact CD2-CG2 4.27Å; F72-V76 HydrophobicContact CE1-CG2 3.85Å; F72-V76 HydrophobicContact CE2-CG2 3.81Å; F72-V76 HydrophobicContact CZ-CG2 3.58Å; F72-V76 WeakPolarHBondContact O-CG2 3.45Å; F72-V76 PolarHBondContact O-N 3.45Å
73	L	96.9	Very high	94.2	Very high	84 Å²	84	94.7 Å²	94.7	44%	0.44	50%	0.495	S	S	.	.	H	α-helix	trans	-62.8	-37	177.7	-71.9	-176.7	0	0	0	112.3	F69 E70 R77	F69-L73 HydrophobicContact CD1-CD1 3.89Å; F69-L73 HydrophobicContact CD1-CG 4.31Å; F69-L73 HydrophobicContact CE1-CD1 3.31Å; F69-L73 HydrophobicContact CE1-CG 3.93Å; F69-L73 HydrophobicContact CE2-CG 4.41Å; F69-L73 HydrophobicContact CZ-CD1 3.72Å; F69-L73 HydrophobicContact CZ-CD2 4.13Å; F69-L73 HydrophobicContact CZ-CG 3.98Å; F69-L73 WeakPolarHBondContact O-CG 3.37Å; F69-L73 PolarHBondContact O-N 3.11Å; E70-L73 PolarHBondContact O-N 2.74Å; L73-R77 WeakPolarHBondContact O-CB 3.5Å; L73-R77 PolarHBondContact O-N 2.98Å
74	T	96.1	Very high	93.7	Very high	88 Å²	88	100 Å²	100	54%	0.54	51%	0.506	S	S	.	.	H	α-helix	trans	-63.3	-46.5	174.8	-58.9	0	0	0	0	110.7	E70 S71 F72 R77 T78	E70-T74 WeakPolarHBondContact O-CB 3.38Å; E70-T74 PolarHBondContact O-N 3.48Å; E70-T74 PolarHBondContact O-OG1 2.94Å; S71-T74 PolarHBondContact O-N 2.85Å; F72-T74 VanDerWaalsContact C-N 3.28Å; F72-T74 PolarHBondContact O-N 3.45Å; T74-R77 PolarHBondContact O-N 3.01Å; T74-T78 PolarHBondContact O-N 3.24Å; T74-T78 PolarHBondContact O-OG1 2.91Å
75	Q	96.3	Very high	92.7	Very high	105 Å²	105	100.8 Å²	100.8	49%	0.491	52%	0.515	S	S	.	.	H	α-helix	trans	-60	-49.7	176.3	-173.2	64.1	41.2	0	0	111.5	S71 F72 R77 T78 D79	S71-Q75 PolarHBondContact O-N 2.97Å; F72-Q75 PolarHBondContact O-N 2.87Å; Q75-R77 VanDerWaalsContact C-N 3.26Å; Q75-R77 PolarHBondContact O-N 3.01Å; Q75-T78 WeakPolarHBondContact O-CB 3.18Å; Q75-T78 PolarHBondContact O-N 3.33Å; Q75-D79 PolarHBondContact NE2-OD1 3.41Å; Q75-D79 VanDerWaalsContact O-CG 3.27Å; Q75-D79 PolarHBondContact O-N 3.2Å
76	V	95.6	Very high	91.4	Very high	51 Å²	51	99.2 Å²	99.2	31%	0.309	52%	0.515	S	S	.	.	H	α-helix	trans	-58.4	-40.4	178.8	170	0	0	0	0	111.3	F72 D79 L80	F72-V76 HydrophobicContact CD1-CG2 4.31Å; F72-V76 HydrophobicContact CD2-CG2 4.27Å; F72-V76 HydrophobicContact CE1-CG2 3.85Å; F72-V76 HydrophobicContact CE2-CG2 3.81Å; F72-V76 HydrophobicContact CZ-CG2 3.58Å; F72-V76 WeakPolarHBondContact O-CG2 3.45Å; F72-V76 PolarHBondContact O-N 3.45Å; V76-D79 PolarHBondContact O-N 2.91Å; V76-L80 HydrophobicContact CG1-CD1 4Å; V76-L80 HydrophobicContact CG1-CG 4.45Å; V76-L80 WeakPolarHBondContact O-CB 3.35Å; V76-L80 VanDerWaalsContact O-CG 3.26Å; V76-L80 WeakPolarHBondContact O-CG 3.43Å; V76-L80 PolarHBondContact O-N 3.38Å
77	R	94.4	Very high	89.6	Confident	170 Å²	170	97.6 Å²	97.6	64%	0.642	51%	0.514	S	S	*	.	H	α-helix	trans	-63.3	-44.7	176	-178.5	179.5	179.6	174.1	1.8	111.4	L73 T74 Q75 L80 Q81	L73-R77 WeakPolarHBondContact O-CB 3.5Å; L73-R77 PolarHBondContact O-N 2.98Å; T74-R77 PolarHBondContact O-N 3.01Å; Q75-R77 VanDerWaalsContact C-N 3.26Å; Q75-R77 PolarHBondContact O-N 3.01Å; R77-L80 PolarHBondContact O-N 3.26Å; R77-Q81 WeakPolarHBondContact O-CB 3.24Å; R77-Q81 VanDerWaalsContact O-CG 3.28Å; R77-Q81 WeakPolarHBondContact O-CG 3.28Å; R77-Q81 PolarHBondContact O-N 2.9Å
78	T	93.4	Very high	87.4	Confident	48 Å²	48	106.1 Å²	106.1	29%	0.294	54%	0.536	S	S	.	.	H	α-helix	trans	-61.1	-49.5	176.5	-57.6	0	0	0	0	110.6	T74 Q75 L80 Q81 E82	T74-T78 PolarHBondContact O-N 3.24Å; T74-T78 PolarHBondContact O-OG1 2.91Å; Q75-T78 WeakPolarHBondContact O-CB 3.18Å; Q75-T78 PolarHBondContact O-N 3.33Å; T78-L80 VanDerWaalsContact C-N 3.3Å; T78-L80 PolarHBondContact O-N 2.84Å; T78-Q81 CarbonylContact O-C 3.59Å; T78-Q81 WeakPolarHBondContact O-CA 3.27Å; T78-Q81 WeakPolarHBondContact O-CB 3.3Å; T78-Q81 PolarHBondContact O-N 2.98Å; T78-E82 HydrophobicContact CG2-CG 4.47Å; T78-E82 WeakPolarHBondContact O-CG 3.42Å; T78-E82 PolarHBondContact O-N 2.69Å
79	D	92.7	Very high	85.4	Confident	78 Å²	78	107.5 Å²	107.5	42%	0.417	55%	0.552	S	S	.	*	H	α-helix	trans	-58.8	-41.3	178.8	-64.9	-7.1	0	0	0	111.6	Q75 V76 E82 L83	Q75-D79 PolarHBondContact NE2-OD1 3.41Å; Q75-D79 VanDerWaalsContact O-CG 3.27Å; Q75-D79 PolarHBondContact O-N 3.2Å; V76-D79 PolarHBondContact O-N 2.91Å; D79-E82 PolarHBondContact O-N 2.97Å; D79-L83 VanDerWaalsContact O-CB 3.31Å; D79-L83 WeakPolarHBondContact O-CB 3.36Å; D79-L83 PolarHBondContact O-N 2.87Å
80	L	93.4	Very high	83.3	Confident	98 Å²	98	104 Å²	104	51%	0.513	55%	0.55	S	S	.	.	H	α-helix	trans	-68	-36.2	175.6	-74.4	173.2	0	0	0	112.5	V76 R77 T78 L83 K84	V76-L80 HydrophobicContact CG1-CD1 4Å; V76-L80 HydrophobicContact CG1-CG 4.45Å; V76-L80 WeakPolarHBondContact O-CB 3.35Å; V76-L80 VanDerWaalsContact O-CG 3.26Å; V76-L80 WeakPolarHBondContact O-CG 3.43Å; V76-L80 PolarHBondContact O-N 3.38Å; R77-L80 PolarHBondContact O-N 3.26Å; T78-L80 VanDerWaalsContact C-N 3.3Å; T78-L80 PolarHBondContact O-N 2.84Å; L80-L83 PolarHBondContact O-N 3.48Å; L80-K84 WeakPolarHBondContact O-CB 3.03Å; L80-K84 VanDerWaalsContact O-CG 3.26Å; L80-K84 WeakPolarHBondContact O-CG 3.49Å; L80-K84 PolarHBondContact O-N 3.22Å
81	Q	90.6	Very high	81.3	Confident	98 Å²	98	104.8 Å²	104.8	46%	0.458	56%	0.557	S	S	.	*	H	α-helix	trans	-67.2	-44.4	174.7	-76	176.8	-20.9	0	0	110.8	R77 T78 L83 K84 V85	R77-Q81 WeakPolarHBondContact O-CB 3.24Å; R77-Q81 VanDerWaalsContact O-CG 3.28Å; R77-Q81 WeakPolarHBondContact O-CG 3.28Å; R77-Q81 PolarHBondContact O-N 2.9Å; T78-Q81 CarbonylContact O-C 3.59Å; T78-Q81 WeakPolarHBondContact O-CA 3.27Å; T78-Q81 WeakPolarHBondContact O-CB 3.3Å; T78-Q81 PolarHBondContact O-N 2.98Å; Q81-L83 VanDerWaalsContact C-N 3.32Å; Q81-L83 PolarHBondContact O-N 3.21Å; Q81-K84 PolarHBondContact O-N 2.74Å; Q81-V85 WeakPolarHBondContact O-CB 3.45Å; Q81-V85 VanDerWaalsContact O-CG2 3.24Å; Q81-V85 WeakPolarHBondContact O-CG2 3.32Å; Q81-V85 PolarHBondContact O-N 2.9Å
82	E	87.4	Confident	79.2	Confident	122 Å²	122	106.4 Å²	106.4	57%	0.57	57%	0.568	S	S	*	*	H	α-helix	trans	-61.9	-39.7	173.7	-70.8	-177.7	-171.7	0	0	111.7	T78 D79 K84 V85 S86	T78-E82 HydrophobicContact CG2-CG 4.47Å; T78-E82 WeakPolarHBondContact O-CG 3.42Å; T78-E82 PolarHBondContact O-N 2.69Å; D79-E82 PolarHBondContact O-N 2.97Å; E82-K84 PolarHBondContact O-N 2.87Å; E82-V85 PolarHBondContact O-N 2.87Å; E82-S86 WeakPolarHBondContact O-CB 3.37Å; E82-S86 PolarHBondContact O-N 2.92Å; E82-S86 PolarHBondContact O-OG 2.87Å
83	L	86.9	Confident	77.1	Confident	103 Å²	103	105.6 Å²	105.6	54%	0.539	58%	0.578	S	S	.	*	H	α-helix	trans	-64.8	-39.3	175.2	-172.9	64.6	0	0	0	112	D79 L80 Q81 S86 G87	D79-L83 VanDerWaalsContact O-CB 3.31Å; D79-L83 WeakPolarHBondContact O-CB 3.36Å; D79-L83 PolarHBondContact O-N 2.87Å; L80-L83 PolarHBondContact O-N 3.48Å; Q81-L83 VanDerWaalsContact C-N 3.32Å; Q81-L83 PolarHBondContact O-N 3.21Å; L83-S86 WeakPolarHBondContact CA-OG 3.21Å; L83-S86 PolarHBondContact O-OG 2.95Å; L83-G87 PolarHBondContact O-N 2.89Å
84	K	81.8	Confident	75.1	Confident	178 Å²	178	108.5 Å²	108.5	77%	0.774	59%	0.593	S	S	*	*	H	α-helix	trans	-68.8	-40.3	175.6	-73.9	176.8	75.2	178	0	112.1	L80 Q81 E82 G87	L80-K84 WeakPolarHBondContact O-CB 3.03Å; L80-K84 VanDerWaalsContact O-CG 3.26Å; L80-K84 WeakPolarHBondContact O-CG 3.49Å; L80-K84 PolarHBondContact O-N 3.22Å; Q81-K84 PolarHBondContact O-N 2.74Å; E82-K84 PolarHBondContact O-N 2.87Å; K84-G87 PolarHBondContact O-N 2.98Å
85	V	75.3	Confident	73	Confident	128 Å²	128	108 Å²	108	78%	0.776	61%	0.606	S	S	*	*	H	α-helix	trans	-73.1	-39.8	179.8	171.9	0	0	0	0	111.4	Q81 E82 G87	Q81-V85 WeakPolarHBondContact O-CB 3.45Å; Q81-V85 VanDerWaalsContact O-CG2 3.24Å; Q81-V85 WeakPolarHBondContact O-CG2 3.32Å; Q81-V85 PolarHBondContact O-N 2.9Å; E82-V85 PolarHBondContact O-N 2.87Å; V85-G87 PolarHBondContact O-N 3.43Å; V85-G87 VanDerWaalsContact O-N 3.09Å
86	S	66.2	Low	70.8	Confident	80 Å²	80	107.8 Å²	107.8	56%	0.559	62%	0.616	S	S	*	*	S	Bend	trans	-65.1	-10.9	175.8	59.4	0	0	0	0	112.6	E82 L83 R88	E82-S86 WeakPolarHBondContact O-CB 3.37Å; E82-S86 PolarHBondContact O-N 2.92Å; E82-S86 PolarHBondContact O-OG 2.87Å; L83-S86 WeakPolarHBondContact CA-OG 3.21Å; L83-S86 PolarHBondContact O-OG 2.95Å; S86-R88 PolarHBondContact O-N 2.76Å
87	G	56	Low	68.6	Low	45 Å²	45	111.9 Å²	111.9	46%	0.464	64%	0.635	S	S	.	*			trans	53.6	31.1	150.8	0	0	0	0	0	113.7	L83 K84 V85 P89	L83-G87 PolarHBondContact O-N 2.89Å; K84-G87 PolarHBondContact O-N 2.98Å; V85-G87 PolarHBondContact O-N 3.43Å; V85-G87 VanDerWaalsContact O-N 3.09Å; G87-P89 WeakPolarHBondContact O-CD 3.33Å; G87-P89 WeakPolarHBondContact O-CG 3.17Å
88	R	51	Low	66.6	Low	214 Å²	214	109.8 Å²	109.8	81%	0.808	64%	0.636	S	S	*	*			trans	-64.6	102.6	179.5	-167.8	167.2	-175	-173.7	0.2	106.8	S86 G90	S86-R88 PolarHBondContact O-N 2.76Å; R88-G90 PolarHBondContact O-N 2.72Å
89	P	52.3	Low	64.6	Low	127 Å²	127	114 Å²	114	83%	0.825	66%	0.657	S	S	*	*	T	Hydrogen-bonded Turn	trans	-81	79.4	-178	11.8	8.1	0	0	0	105.5	G87	G87-P89 WeakPolarHBondContact O-CD 3.33Å; G87-P89 WeakPolarHBondContact O-CG 3.17Å
90	G	52.7	Low	62.8	Low	46 Å²	46	112.9 Å²	112.9	47%	0.474	66%	0.664	S	S	.	*	T	Hydrogen-bonded Turn	trans	-153.2	-10.9	-177.8	0	0	0	0	0	114.3	R88	R88-G90 PolarHBondContact O-N 2.72Å
91	L	53.8	Low	61.1	Low	134 Å²	134	114.7 Å²	114.7	70%	0.702	68%	0.675	S	S	*	*	G	3₁₀ helix	trans	-95.3	-0.8	178.7	-63	-179	0	0	0	114.1	S93 L94	L91-S93 PolarHBondContact O-N 3.03Å; L91-L94 PolarHBondContact O-N 2.78Å; L91-L94 VanDerWaalsContact O-N 3.12Å
92	S	52.3	Low	59.5	Low	114 Å²	114	114.4 Å²	114.4	80%	0.797	69%	0.689	S	S	*	*	G	3₁₀ helix	trans	-58.9	-13.6	167.8	-31.7	0	0	0	0	112.7	L94	S92-L94 VanDerWaalsContact C-N 3.33Å
93	S	53.7	Low	58.1	Low	106 Å²	106	116.8 Å²	116.8	74%	0.741	70%	0.704	S	S	*	*	G	3₁₀ helix	trans	-82.2	-2.5	177.2	-152.7	0	0	0	0	114.6	L91	L91-S93 PolarHBondContact O-N 3.03Å
94	L	55.8	Low	56.5	Low	146 Å²	146	116.2 Å²	116.2	76%	0.764	72%	0.715	S	S	*	*	G	3₁₀ helix	trans	-92.4	3.2	173.9	-148.7	75.4	0	0	0	113.3	L91 S92 S96	L91-L94 PolarHBondContact O-N 2.78Å; L91-L94 VanDerWaalsContact O-N 3.12Å; S92-L94 VanDerWaalsContact C-N 3.33Å; L94-S96 VanDerWaalsContact C-N 3.3Å
95	G	51.8	Low	54.9	Low	78 Å²	78	110.9 Å²	110.9	80%	0.804	71%	0.71	S	S	*	*	T	Hydrogen-bonded Turn	trans	-82.7	1.7	175.7	0	0	0	0	0	114.9
96	S	48.8	Very low	53.5	Low	100 Å²	100	120.1 Å²	120.1	70%	0.699	73%	0.731	S	S	*	*	T	Hydrogen-bonded Turn	trans	-130	45.1	-179.6	-173.7	0	0	0	0	112.1	L94 N98	L94-S96 VanDerWaalsContact C-N 3.3Å; S96-N98 VanDerWaalsContact C-N 3.27Å; S96-N98 PolarHBondContact O-N 2.86Å
97	L	51.1	Low	52.8	Low	136 Å²	136	122.2 Å²	122.2	71%	0.712	74%	0.74	S	S	*	*			trans	-88.1	82.9	154.2	-141.2	92	0	0	0	107.2	N99	L97-N99 VanDerWaalsContact C-N 3.33Å; L97-N99 PolarHBondContact O-N 2.8Å
98	N	50.7	Low	52.7	Low	126 Å²	126	126.2 Å²	126.2	67%	0.674	75%	0.754	S	S	*	*			trans	-60.1	95.2	170.1	-178.8	14.3	0	0	0	108.1	S96 G100	S96-N98 VanDerWaalsContact C-N 3.27Å; S96-N98 PolarHBondContact O-N 2.86Å; N98-G100 PolarHBondContact O-N 3.39Å; N98-G100 PolarHBondContact OD1-N 3.04Å
99	N	53	Low	52.8	Low	137 Å²	137	121.3 Å²	121.3	73%	0.733	75%	0.751	S	S	*	*	T	Hydrogen-bonded Turn	trans	-69	13.1	174.2	-71.1	-35.3	0	0	0	112.9	L97	L97-N99 VanDerWaalsContact C-N 3.33Å; L97-N99 PolarHBondContact O-N 2.8Å
100	G	55.1	Low	52.8	Low	55 Å²	55	121 Å²	121	57%	0.567	75%	0.747	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.6	-17.3	179.6	0	0	0	0	0	115.6	N98	N98-G100 PolarHBondContact O-N 3.39Å; N98-G100 PolarHBondContact OD1-N 3.04Å
101	D	56.5	Low	52.8	Low	136 Å²	136	125.7 Å²	125.7	73%	0.727	76%	0.764	S	S	*	*	S	Bend	trans	-106.1	2.5	-171	-112.5	-8.6	0	0	0	115.4	L103	D101-L103 PolarHBondContact O-N 2.94Å
102	A	56.2	Low	52.7	Low	91 Å²	91	125.1 Å²	125.1	75%	0.752	77%	0.768	S	S	*	*	T	Hydrogen-bonded Turn	trans	-85.2	-1.1	-177.7	0	0	0	0	0	114.9
103	L	58.5	Low	52.8	Low	172 Å²	172	125.9 Å²	125.9	90%	0.901	77%	0.766	S	S	*	*	T	Hydrogen-bonded Turn	trans	-118.2	7.7	-176.4	-67.6	179.1	0	0	0	115.4	D101	D101-L103 PolarHBondContact O-N 2.94Å
104	A	53.6	Low	52.7	Low	91 Å²	91	127.5 Å²	127.5	75%	0.752	77%	0.768	S	S	*	*	S	Bend	trans	-111.3	68	174.9	0	0	0	0	0	110.9
105	G	49.2	Very low	52.4	Low	66 Å²	66	125.9 Å²	125.9	68%	0.68	77%	0.768	S	S	*	*			trans	176	51.6	178.6	0	0	0	0	0	117.4
106	R	44.8	Very low	52.5	Low	323 Å²	323	130.3 Å²	130.3	100%	1.219	77%	0.765	S	S	*	*			trans	174.4	0	146.1	-100.1	162.5	-179.2	-102.3	0.4	110.4

Retrieved 106 of 106 residues in 16.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).