A0A077ZP42_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZP42, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 99 aa.

						>A0A077ZP42_TRITR|A0A077ZP42
MGALTRKIVSKAYTAAQKVKKKVVQPDGATTNQEVIECQTRTEEPNGEEIKDAAESRVACSTGEEAVAVQEPPGENVTIEMEVETISCTDSSVIAKEMD
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	40.4	Very low	42.2	Very low	248 Å²	248	85.7 Å²	85.7	100%	1.222	49%	0.492	S	S	*	.				0	101.5	0	-64.3	-177.9	-147.1	0	0	106.7
2	G	40.4	Very low	42.3	Very low	72 Å²	72	80.3 Å²	80.3	74%	0.742	47%	0.465	S	S	*	.			trans	-69.1	134.2	175.9	0	0	0	0	0	109	L4	G2-L4 PolarHBondContact O-N 3.34Å
3	A	39.6	Very low	42.5	Very low	93 Å²	93	80.2 Å²	80.2	77%	0.769	45%	0.453	S	S	*	.			trans	-62.6	118	171.4	0	0	0	0	0	107.8	T5	A3-T5 PolarHBondContact O-N 3.02Å; A3-T5 PolarHBondContact O-OG1 3.23Å
4	L	40.6	Very low	42.8	Very low	115 Å²	115	75.1 Å²	75.1	60%	0.602	43%	0.425	S	S	*	.			trans	-67.5	97.6	171	-87.1	111	0	0	0	108.2	G2 R6 E97	G2-L4 PolarHBondContact O-N 3.34Å; L4-R6 PolarHBondContact O-N 3.29Å; L4-E97 HydrophobicContact CD2-CG 4.43Å
5	T	42.5	Very low	43.2	Very low	76 Å²	76	72.7 Å²	72.7	47%	0.466	42%	0.418	S	S	.	.			trans	-78.8	107.3	173.8	-39.2	0	0	0	0	108.3	A3 E49	A3-T5 PolarHBondContact O-N 3.02Å; A3-T5 PolarHBondContact O-OG1 3.23Å; T5-E49 VanDerWaalsContact CG2-OE1 3.26Å; T5-E49 WeakPolarHBondContact CG2-OE1 3.15Å
6	R	45.2	Very low	43.7	Very low	96 Å²	96	68.4 Å²	68.4	36%	0.362	39%	0.394	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.2	125.4	177.3	-64.4	173.5	170.7	-162.4	1.8	108.4	L4 A95	L4-R6 PolarHBondContact O-N 3.29Å; R6-A95 HydrophobicContact CB-CB 3.72Å; R6-A95 VanDerWaalsContact CD-CB 3.46Å; R6-A95 HydrophobicContact CG-CB 3.64Å
7	K	43	Very low	44.2	Very low	107 Å²	107	67.9 Å²	67.9	47%	0.465	39%	0.387	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-88.2	136.1	170.3	-74.2	-176.6	176.2	-178.2	0	109.5	V9 E49 I94 M98	K7-V9 PolarHBondContact O-N 2.86Å; K7-E49 HydrophobicContact CG-CG 4.38Å; K7-I94 VanDerWaalsContact O-O 3.13Å; K7-M98 HydrophobicContact CD-CE 4.31Å
8	I	45.3	Very low	45	Very low	7 Å²	7	66.4 Å²	66.4	4%	0.036	38%	0.376	C	S	.	.	B	Isolated β-bridge	trans	-70.9	126.2	165	-42.8	174.3	0	0	0	107.7	S10 K11 P45 E48 I50 V93	I8-S10 WeakPolarHBondContact CG2-O 3.5Å; I8-K11 VanDerWaalsContact CD1-CE 3.49Å; I8-K11 HydrophobicContact CD1-CG 4.45Å; I8-K11 HydrophobicContact CG2-CG 4.19Å; I8-P45 HydrophobicContact CB-CB 4.1Å; I8-P45 HydrophobicContact CB-CG 3.79Å; I8-P45 HydrophobicContact CD1-CB 4.42Å; I8-P45 HydrophobicContact CG2-CB 4.02Å; I8-P45 HydrophobicContact CG2-CG 3.62Å; I8-P45 VanDerWaalsContact O-CG 3.31Å; I8-P45 WeakPolarHBondContact O-CG 3.32Å; I8-E48 HydrophobicContact CD1-CB 4.13Å; I8-E48 VanDerWaalsContact CG1-O 3.27Å; I8-E48 WeakPolarHBondContact CG1-O 3.22Å; I8-I50 HydrophobicContact CD1-CD1 3.35Å; I8-I50 HydrophobicContact CD1-CG1 3.37Å; I8-I50 HydrophobicContact CG1-CD1 3.29Å; I8-I50 HydrophobicContact CG1-CG1 3.11Å; I8-V93 HydrophobicContact CB-CG1 4.24Å; I8-V93 HydrophobicContact CG1-CG1 3.93Å; I8-V93 HydrophobicContact CG1-CG2 4.28Å; I8-V93 HydrophobicContact CG2-CB 4.39Å; I8-V93 HydrophobicContact CG2-CG1 4.13Å; I8-V93 HydrophobicContact CG2-CG2 4.13Å
9	V	43.7	Very low	45.8	Very low	78 Å²	78	63.3 Å²	63.3	47%	0.473	36%	0.358	S	S	.	.			trans	-100.2	-21.2	174.6	-168.3	0	0	0	0	112.1	K7 P45	K7-V9 PolarHBondContact O-N 2.86Å; V9-P45 VanDerWaalsContact O-CD 3.31Å; V9-P45 WeakPolarHBondContact O-CD 3.4Å
10	S	40.5	Very low	46.8	Very low	22 Å²	22	63.1 Å²	63.1	15%	0.154	35%	0.353	C	S	.	.			trans	-150	143.6	176.2	47.9	0	0	0	0	110.9	I8 I94	I8-S10 WeakPolarHBondContact CG2-O 3.5Å; S10-I94 VanDerWaalsContact OG-CD1 3.3Å; S10-I94 WeakPolarHBondContact OG-CD1 3.26Å
11	K	43.5	Very low	47.5	Very low	29 Å²	29	62.4 Å²	62.4	13%	0.126	35%	0.346	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.9	104.7	164.5	-84.2	-178.1	-174.2	170.3	0	105.4	I8 Y13 E43 P45 E48	I8-K11 VanDerWaalsContact CD1-CE 3.49Å; I8-K11 HydrophobicContact CD1-CG 4.45Å; I8-K11 HydrophobicContact CG2-CG 4.19Å; K11-Y13 HydrophobicContact CB-CD2 4.33Å; K11-Y13 HydrophobicContact CB-CE2 3.85Å; K11-Y13 HydrophobicContact CD-CE2 4.35Å; K11-Y13 PolarHBondContact O-N 3.17Å; K11-E43 CarbonylContact C-O 3.51Å; K11-E43 PolarHBondContact N-O 3.34Å; K11-E43 CarbonylContact O-C 3.58Å; K11-E43 PolarHBondContact O-N 2.99Å; K11-P45 HydrophobicContact CD-CB 4.45Å; K11-P45 HydrophobicContact CG-CB 4.23Å; K11-E48 IonicContact NZ-OE1 2.89Å; K11-E48 PolarHBondContact NZ-OE1 2.79Å; K11-E48 IonicContact NZ-OE2 3.57Å; K11-E48 PolarHBondContact NZ-OE2 2.79Å
12	A	43.5	Very low	48.8	Very low	20 Å²	20	54.1 Å²	54.1	17%	0.165	30%	0.304	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-83.6	97	176.6	0	0	0	0	0	109.8	T14 D90	A12-T14 PolarHBondContact O-N 2.82Å; A12-D90 CarbonylContact C-O 3.6Å; A12-D90 CarbonylContact O-C 3.49Å; A12-D90 VanDerWaalsContact O-C 3.24Å; A12-D90 VanDerWaalsContact O-CB 3.25Å; A12-D90 WeakPolarHBondContact O-CB 3.31Å
13	Y	44	Very low	49.9	Very low	79 Å²	79	50.9 Å²	50.9	31%	0.31	27%	0.269	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-77.7	117.9	173.4	-68.9	-87	0	0	0	109.4	K11 R41 E43 T89	K11-Y13 HydrophobicContact CB-CD2 4.33Å; K11-Y13 HydrophobicContact CB-CE2 3.85Å; K11-Y13 HydrophobicContact CD-CE2 4.35Å; K11-Y13 PolarHBondContact O-N 3.17Å; Y13-R41 PolarHBondContact N-O 2.79Å; Y13-R41 CarbonylContact O-C 3.51Å; Y13-R41 WeakPolarHBondContact O-CA 3.44Å; Y13-R41 PolarHBondContact O-N 2.97Å; Y13-E43 HydrophobicContact CD2-CB 3.77Å; Y13-E43 HydrophobicContact CE2-CB 3.94Å; Y13-T89 HydrophobicContact CD1-CG2 4.4Å
14	T	46.7	Very low	51.1	Low	10 Å²	10	48.4 Å²	48.4	6%	0.061	24%	0.244	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-104.8	91	173.6	-51.4	0	0	0	0	110.2	A12 A16 Q39 T40 C60 C88	A12-T14 PolarHBondContact O-N 2.82Å; T14-A16 PolarHBondContact O-N 3.15Å; T14-Q39 CarbonylContact C-O 3.45Å; T14-T40 HydrophobicContact CG2-CG2 3.5Å; T14-C60 HydrophobicContact CG2-CB 3.62Å; T14-C60 WeakPolarHBondContact CG2-SG 3.4Å; T14-C88 CarbonylContact C-O 3.6Å; T14-C88 VanDerWaalsContact C-O 3.29Å; T14-C88 PolarHBondContact N-O 3.43Å; T14-C88 CarbonylContact O-C 3.24Å; T14-C88 VanDerWaalsContact O-C 3.24Å; T14-C88 WeakPolarHBondContact O-CA 3.1Å; T14-C88 WeakPolarHBondContact O-CB 3.31Å; T14-C88 PolarHBondContact O-N 3.47Å; T14-C88 VanDerWaalsContact O-N 3.17Å
15	A	49.8	Very low	52.4	Low	38 Å²	38	45.8 Å²	45.8	31%	0.314	23%	0.229	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-78.8	116	172.5	0	0	0	0	0	108.6	Q39	A15-Q39 PolarHBondContact N-O 2.9Å; A15-Q39 WeakPolarHBondContact O-CA 3.46Å; A15-Q39 PolarHBondContact O-N 2.79Å
16	A	50.7	Low	53.4	Low	5 Å²	5	46.9 Å²	46.9	4%	0.041	24%	0.238	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-85.7	134.9	162.8	0	0	0	0	0	108.7	T14 I36 E37 T85 I86	T14-A16 PolarHBondContact O-N 3.15Å; A16-I36 HydrophobicContact CB-CG2 4.4Å; A16-E37 CarbonylContact C-O 3.48Å; A16-T85 CarbonylContact O-C 3.51Å; A16-I86 CarbonylContact C-O 3.53Å; A16-I86 WeakPolarHBondContact CA-O 3.3Å; A16-I86 HydrophobicContact CB-CB 4.08Å; A16-I86 WeakPolarHBondContact CB-O 3.47Å; A16-I86 PolarHBondContact N-O 3.28Å; A16-I86 CarbonylContact O-C 3.24Å; A16-I86 VanDerWaalsContact O-C 3.24Å; A16-I86 WeakPolarHBondContact O-CA 3.4Å; A16-I86 PolarHBondContact O-N 3.05Å
17	Q	52.5	Low	54.9	Low	59 Å²	59	48 Å²	48	28%	0.276	25%	0.251	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.6	114.8	170.5	-75.2	-175.1	79.2	0	0	107.4	I36 E37 V83 T85	Q17-I36 CarbonylContact O-C 3.29Å; Q17-E37 PolarHBondContact N-O 3.5Å; Q17-E37 PolarHBondContact O-N 3.03Å; Q17-V83 HydrophobicContact CB-CG1 4.31Å; Q17-V83 HydrophobicContact CG-CG1 4.49Å; Q17-T85 HydrophobicContact CG-CG2 4.45Å
18	K	58.6	Low	56	Low	42 Å²	42	45.6 Å²	45.6	18%	0.183	26%	0.256	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.4	108.9	170.9	178.9	172.7	-175.2	-178.8	0	108.7	K20 E34 V35 I36 E84 I86	K18-K20 VanDerWaalsContact CE-CE 3.44Å; K18-K20 HydrophobicContact CG-CG 4.4Å; K18-E34 WeakPolarHBondContact CE-OE1 3.49Å; K18-E34 IonicContact NZ-OE1 2.95Å; K18-E34 PolarHBondContact NZ-OE1 2.75Å; K18-V35 CarbonylContact C-O 3.53Å; K18-I36 HydrophobicContact CB-CG1 4.26Å; K18-I36 HydrophobicContact CD-CG1 4.45Å; K18-I36 HydrophobicContact CG-CG1 4.05Å; K18-E84 HydrophobicContact CB-CB 4.35Å; K18-E84 PolarHBondContact N-O 2.71Å; K18-E84 PolarHBondContact O-N 2.79Å; K18-I86 HydrophobicContact CB-CD1 3.64Å; K18-I86 HydrophobicContact CB-CG1 4.06Å; K18-I86 HydrophobicContact CD-CD1 4.13Å; K18-I86 HydrophobicContact CG-CD1 4.47Å
19	V	60.1	Low	57.3	Low	6 Å²	6	46.9 Å²	46.9	4%	0.036	27%	0.268	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.7	107.4	176.2	-173.9	0	0	0	0	109.2	K21 V35 M81 E82 V83	V19-K21 HydrophobicContact CG1-CG 3.93Å; V19-V35 WeakPolarHBondContact CA-O 3.37Å; V19-V35 HydrophobicContact CB-CB 4.49Å; V19-V35 PolarHBondContact N-O 2.8Å; V19-V35 PolarHBondContact O-N 2.75Å; V19-M81 HydrophobicContact CG1-CE 3.98Å; V19-E82 CarbonylContact C-O 3.6Å; V19-E82 WeakPolarHBondContact CA-O 3.46Å; V19-V83 HydrophobicContact CG1-CG2 4.15Å; V19-V83 HydrophobicContact CG2-CG1 4.28Å; V19-V83 HydrophobicContact CG2-CG2 4.14Å
20	K	64.9	Low	58.4	Low	59 Å²	59	46.8 Å²	46.8	26%	0.257	27%	0.267	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.8	116.5	169.5	-50.5	-179.2	-174.5	152.6	0	108.4	K18 Q33 E34 M81 E82 E84	K18-K20 VanDerWaalsContact CE-CE 3.44Å; K18-K20 HydrophobicContact CG-CG 4.4Å; K20-Q33 CarbonylContact C-O 3.5Å; K20-Q33 WeakPolarHBondContact CA-O 3.3Å; K20-E34 HydrophobicContact CB-CG 4.34Å; K20-E34 VanDerWaalsContact CE-OE1 3.3Å; K20-E34 WeakPolarHBondContact CE-OE1 3.37Å; K20-E34 HydrophobicContact CG-CG 3.98Å; K20-M81 CarbonylContact O-C 3.57Å; K20-M81 WeakPolarHBondContact O-CA 3.32Å; K20-E82 HydrophobicContact CB-CB 4.31Å; K20-E82 PolarHBondContact N-O 2.75Å; K20-E82 PolarHBondContact O-N 2.79Å; K20-E84 IonicContact NZ-OE2 2.72Å
21	K	63.1	Low	59.7	Low	49 Å²	49	48.7 Å²	48.7	21%	0.213	28%	0.278	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.4	112.9	173.8	-48.3	-173.4	173.5	170.6	0	108.8	V19 Q33 I79 E80 M81	V19-K21 HydrophobicContact CG1-CG 3.93Å; K21-Q33 HydrophobicContact CB-CB 4.25Å; K21-Q33 PolarHBondContact N-O 2.67Å; K21-Q33 WeakPolarHBondContact O-CA 3.45Å; K21-Q33 WeakPolarHBondContact O-CB 2.89Å; K21-Q33 PolarHBondContact O-N 2.74Å; K21-I79 HydrophobicContact CB-CG2 4.34Å; K21-E80 CarbonylContact C-O 3.57Å; K21-E80 WeakPolarHBondContact CA-O 3.44Å; K21-M81 HydrophobicContact CB-CG 4.32Å; K21-M81 HydrophobicContact CD-CG 4.4Å; K21-M81 HydrophobicContact CD-SD 4.42Å; K21-M81 HydrophobicContact CG-CG 3.86Å; K21-M81 HydrophobicContact CG-SD 4.48Å
22	K	65.7	Low	60.5	Low	75 Å²	75	52.6 Å²	52.6	33%	0.326	30%	0.3	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.7	115.7	170.2	173.3	175.9	167.9	-135.2	0	109.1	V24 N32 I79 E80	K22-V24 HydrophobicContact CG-CG2 4.18Å; K22-N32 WeakPolarHBondContact CB-OD1 3.41Å; K22-N32 VanDerWaalsContact CD-OD1 3.31Å; K22-N32 WeakPolarHBondContact CD-OD1 3.46Å; K22-N32 WeakPolarHBondContact CG-OD1 3.44Å; K22-I79 CarbonylContact O-C 3.55Å; K22-I79 WeakPolarHBondContact O-CA 3.25Å; K22-E80 HydrophobicContact CB-CB 4.24Å; K22-E80 WeakPolarHBondContact CD-OE2 3.41Å; K22-E80 WeakPolarHBondContact CE-OE2 3.48Å; K22-E80 PolarHBondContact N-O 2.75Å; K22-E80 IonicContact NZ-OE2 2.75Å; K22-E80 PolarHBondContact NZ-OE2 3.08Å; K22-E80 PolarHBondContact O-N 2.9Å
23	V	65.1	Low	61.3	Low	4 Å²	4	52.7 Å²	52.7	2%	0.024	30%	0.298	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-98.9	113.5	-178.7	178.7	0	0	0	0	108.1	T30 T31 P72 V77 I79	V23-T30 CarbonylContact O-C 3.24Å; V23-T30 WeakPolarHBondContact O-CA 3.45Å; V23-T31 WeakPolarHBondContact CB-O 3.46Å; V23-T31 PolarHBondContact N-O 2.81Å; V23-T31 PolarHBondContact O-N 2.7Å; V23-P72 HydrophobicContact CG1-CB 3.63Å; V23-P72 HydrophobicContact CG1-CG 3.58Å; V23-V77 HydrophobicContact CB-CG1 4.42Å; V23-V77 HydrophobicContact CG1-CG1 3.15Å; V23-I79 HydrophobicContact CG2-CG1 4.42Å; V23-I79 HydrophobicContact CG2-CG2 4.47Å
24	V	65	Low	61.7	Low	40 Å²	40	53.6 Å²	53.6	24%	0.242	31%	0.305	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-103.5	112.3	178.5	-175.8	0	0	0	0	108.9	K22 T30 V77 T78	K22-V24 HydrophobicContact CG-CG2 4.18Å; V24-T30 HydrophobicContact CB-CG2 4.3Å; V24-T30 HydrophobicContact CG1-CG2 4.03Å; V24-T30 HydrophobicContact CG2-CG2 3.95Å; V24-V77 WeakPolarHBondContact O-CA 3.38Å; V24-V77 WeakPolarHBondContact O-CG1 3.19Å; V24-T78 PolarHBondContact N-O 2.72Å; V24-T78 PolarHBondContact O-N 3.42Å
25	Q	66.6	Low	62.2	Low	61 Å²	61	53.9 Å²	53.9	29%	0.285	31%	0.306	S	S	.	.			trans	-80.2	153.2	176.1	-63.2	-169.7	-39.3	0	0	111	D27 G28 A29	Q25-D27 VanDerWaalsContact C-N 3.26Å; Q25-D27 WeakPolarHBondContact CB-OD1 3.21Å; Q25-D27 PolarHBondContact O-N 2.69Å; Q25-G28 PolarHBondContact O-N 2.85Å; Q25-A29 HydrophobicContact CB-CB 4.15Å; Q25-A29 WeakPolarHBondContact CB-O 3.43Å; Q25-A29 PolarHBondContact N-O 2.78Å
26	P	63.3	Low	62.4	Low	99 Å²	99	55.8 Å²	55.8	64%	0.643	31%	0.311	S	S	*	.	T	Hydrogen-bonded Turn	trans	-68	-22.4	-174.7	27.1	-35.7	0	0	0	114	G28 N76	P26-G28 PolarHBondContact O-N 2.83Å; P26-N76 HydrophobicContact CB-CB 4.27Å; P26-N76 WeakPolarHBondContact CD-O 3.31Å; P26-N76 HydrophobicContact CG-CB 4.13Å
27	D	76.6	Confident	62.4	Low	120 Å²	120	60.4 Å²	60.4	64%	0.642	33%	0.331	S	S	*	.	T	Hydrogen-bonded Turn	trans	-74.9	-3.9	173	62.8	-76.1	0	0	0	113.1	Q25 A29	Q25-D27 VanDerWaalsContact C-N 3.26Å; Q25-D27 WeakPolarHBondContact CB-OD1 3.21Å; Q25-D27 PolarHBondContact O-N 2.69Å; D27-A29 WeakPolarHBondContact OD2-CB 3.21Å; D27-A29 PolarHBondContact OD2-N 2.69Å
28	G	66.5	Low	62.2	Low	55 Å²	55	59.2 Å²	59.2	57%	0.567	33%	0.329	S	S	*	.	S	Bend	trans	94.9	-5.8	-178.3	0	0	0	0	0	113.9	Q25 P26	Q25-G28 PolarHBondContact O-N 2.85Å; P26-G28 PolarHBondContact O-N 2.83Å
29	A	73.4	Confident	61.7	Low	35 Å²	35	62.5 Å²	62.5	29%	0.289	35%	0.345	S	S	.	.			trans	-61.9	139.6	170.2	0	0	0	0	0	111	Q25 D27	Q25-A29 HydrophobicContact CB-CB 4.15Å; Q25-A29 WeakPolarHBondContact CB-O 3.43Å; Q25-A29 PolarHBondContact N-O 2.78Å; D27-A29 WeakPolarHBondContact OD2-CB 3.21Å; D27-A29 PolarHBondContact OD2-N 2.69Å
30	T	66.6	Low	61.1	Low	75 Å²	75	67 Å²	67	46%	0.46	37%	0.372	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-125.5	131.4	176.2	58.8	0	0	0	0	109.7	V23 V24	V23-T30 CarbonylContact O-C 3.24Å; V23-T30 WeakPolarHBondContact O-CA 3.45Å; V24-T30 HydrophobicContact CB-CG2 4.3Å; V24-T30 HydrophobicContact CG1-CG2 4.03Å; V24-T30 HydrophobicContact CG2-CG2 3.95Å
31	T	67.4	Low	60	Low	63 Å²	63	72.4 Å²	72.4	39%	0.387	39%	0.391	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.9	109.2	174.7	-57.6	0	0	0	0	107.6	V23 Q33	V23-T31 WeakPolarHBondContact CB-O 3.46Å; V23-T31 PolarHBondContact N-O 2.81Å; V23-T31 PolarHBondContact O-N 2.7Å; T31-Q33 HydrophobicContact CG2-CG 4.11Å
32	N	61.3	Low	59	Low	110 Å²	110	75 Å²	75	59%	0.588	41%	0.411	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-84.6	127	171	-59	-72.6	0	0	0	108.3	K22	K22-N32 WeakPolarHBondContact CB-OD1 3.41Å; K22-N32 VanDerWaalsContact CD-OD1 3.31Å; K22-N32 WeakPolarHBondContact CD-OD1 3.46Å; K22-N32 WeakPolarHBondContact CG-OD1 3.44Å
33	Q	58.6	Low	57.7	Low	23 Å²	23	75.2 Å²	75.2	11%	0.107	41%	0.413	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-118.4	134.8	174.5	-57.3	-178.7	1.1	0	0	107.4	K20 K21 T31 Q70	K20-Q33 CarbonylContact C-O 3.5Å; K20-Q33 WeakPolarHBondContact CA-O 3.3Å; K21-Q33 HydrophobicContact CB-CB 4.25Å; K21-Q33 PolarHBondContact N-O 2.67Å; K21-Q33 WeakPolarHBondContact O-CA 3.45Å; K21-Q33 WeakPolarHBondContact O-CB 2.89Å; K21-Q33 PolarHBondContact O-N 2.74Å; T31-Q33 HydrophobicContact CG2-CG 4.11Å; Q33-Q70 PolarHBondContact NE2-O 2.75Å; Q33-Q70 VanDerWaalsContact NE2-O 3.17Å
34	E	54.2	Low	56.5	Low	98 Å²	98	82.7 Å²	82.7	46%	0.458	45%	0.448	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.5	125.1	172.4	-60.2	-172.6	88	0	0	107.4	K18 K20	K18-E34 WeakPolarHBondContact CE-OE1 3.49Å; K18-E34 IonicContact NZ-OE1 2.95Å; K18-E34 PolarHBondContact NZ-OE1 2.75Å; K20-E34 HydrophobicContact CB-CG 4.34Å; K20-E34 VanDerWaalsContact CE-OE1 3.3Å; K20-E34 WeakPolarHBondContact CE-OE1 3.37Å; K20-E34 HydrophobicContact CG-CG 3.98Å
35	V	56.6	Low	55.6	Low	16 Å²	16	81.6 Å²	81.6	10%	0.097	44%	0.442	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-121.4	128.5	178.2	-176.9	0	0	0	0	107.4	K18 V19 E37	K18-V35 CarbonylContact C-O 3.53Å; V19-V35 WeakPolarHBondContact CA-O 3.37Å; V19-V35 HydrophobicContact CB-CB 4.49Å; V19-V35 PolarHBondContact N-O 2.8Å; V19-V35 PolarHBondContact O-N 2.75Å; V35-E37 HydrophobicContact CG1-CG 4Å
36	I	53.2	Low	54.4	Low	78 Å²	78	86.4 Å²	86.4	40%	0.4	47%	0.47	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-106.5	106.8	174.3	-59.2	171.6	0	0	0	107.7	A16 Q17 K18	A16-I36 HydrophobicContact CB-CG2 4.4Å; Q17-I36 CarbonylContact O-C 3.29Å; K18-I36 HydrophobicContact CB-CG1 4.26Å; K18-I36 HydrophobicContact CD-CG1 4.45Å; K18-I36 HydrophobicContact CG-CG1 4.05Å
37	E	51.9	Low	53.3	Low	102 Å²	102	84.5 Å²	84.5	48%	0.477	47%	0.468	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-95	105.6	176	-68.4	-169	84.5	0	0	110.1	A16 Q17 V35 Q39	A16-E37 CarbonylContact C-O 3.48Å; Q17-E37 PolarHBondContact N-O 3.5Å; Q17-E37 PolarHBondContact O-N 3.03Å; V35-E37 HydrophobicContact CG1-CG 4Å; E37-Q39 PolarHBondContact O-N 3.42Å
38	C	48.4	Very low	51.6	Low	33 Å²	33	83.8 Å²	83.8	22%	0.223	46%	0.461	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-82.6	108.5	171.1	-63.6	0	0	0	0	109.9	T62	C38-T62 HydrophobicContact CB-CG2 4.1Å
39	Q	46.4	Very low	50.3	Low	112 Å²	112	87.2 Å²	87.2	52%	0.523	46%	0.462	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.6	101.6	166.8	-68.5	-163.4	2.8	0	0	109.7	T14 A15 E37 R41	T14-Q39 CarbonylContact C-O 3.45Å; A15-Q39 PolarHBondContact N-O 2.9Å; A15-Q39 WeakPolarHBondContact O-CA 3.46Å; A15-Q39 PolarHBondContact O-N 2.79Å; E37-Q39 PolarHBondContact O-N 3.42Å; Q39-R41 PolarHBondContact O-N 3.29Å
40	T	47.5	Very low	48.8	Very low	99 Å²	99	88.2 Å²	88.2	61%	0.607	46%	0.462	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-74.2	106.1	164.4	48.6	0	0	0	0	108.8	T14	T14-T40 HydrophobicContact CG2-CG2 3.5Å
41	R	42.1	Very low	47.6	Very low	174 Å²	174	94.1 Å²	94.1	66%	0.657	48%	0.481	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-102.8	106.5	168.3	-169.7	177.4	-178.4	-178.8	-2.3	108.9	Y13 Q39 E43	Y13-R41 PolarHBondContact N-O 2.79Å; Y13-R41 CarbonylContact O-C 3.51Å; Y13-R41 WeakPolarHBondContact O-CA 3.44Å; Y13-R41 PolarHBondContact O-N 2.97Å; Q39-R41 PolarHBondContact O-N 3.29Å; R41-E43 PolarHBondContact O-N 2.96Å
42	T	42.9	Very low	46.1	Very low	104 Å²	104	98.8 Å²	98.8	64%	0.638	50%	0.503	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-73.1	112.6	168.7	-46.8	0	0	0	0	108.4
43	E	38.7	Very low	45	Very low	78 Å²	78	94.8 Å²	94.8	36%	0.364	49%	0.486	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-102.8	129.8	171.4	-161.5	168.2	93.3	0	0	108.3	K11 Y13 R41 P45	K11-E43 CarbonylContact C-O 3.51Å; K11-E43 PolarHBondContact N-O 3.34Å; K11-E43 CarbonylContact O-C 3.58Å; K11-E43 PolarHBondContact O-N 2.99Å; Y13-E43 HydrophobicContact CD2-CB 3.77Å; Y13-E43 HydrophobicContact CE2-CB 3.94Å; R41-E43 PolarHBondContact O-N 2.96Å; E43-P45 WeakPolarHBondContact O-CD 3.41Å
44	E	39.2	Very low	43.9	Very low	161 Å²	161	97.5 Å²	97.5	75%	0.752	51%	0.512	S	S	*	.	P	Polyproline II helix	trans	-69.7	121.2	167.8	-76.3	-178.6	88.4	0	0	107.7	N46	E44-N46 PolarHBondContact O-N 3.17Å
45	P	46.3	Very low	43	Very low	18 Å²	18	98.5 Å²	98.5	12%	0.117	52%	0.517	C	S	.	.	P	Polyproline II helix	trans	-61.5	138.2	175.4	29.1	-35.4	0	0	0	106.8	I8 V9 K11 E43 G47	I8-P45 HydrophobicContact CB-CB 4.1Å; I8-P45 HydrophobicContact CB-CG 3.79Å; I8-P45 HydrophobicContact CD1-CB 4.42Å; I8-P45 HydrophobicContact CG2-CB 4.02Å; I8-P45 HydrophobicContact CG2-CG 3.62Å; I8-P45 VanDerWaalsContact O-CG 3.31Å; I8-P45 WeakPolarHBondContact O-CG 3.32Å; V9-P45 VanDerWaalsContact O-CD 3.31Å; V9-P45 WeakPolarHBondContact O-CD 3.4Å; K11-P45 HydrophobicContact CD-CB 4.45Å; K11-P45 HydrophobicContact CG-CB 4.23Å; E43-P45 WeakPolarHBondContact O-CD 3.41Å; P45-G47 PolarHBondContact O-N 2.72Å
46	N	42.6	Very low	41.9	Very low	162 Å²	162	100.9 Å²	100.9	87%	0.866	53%	0.534	S	S	*	.			trans	-71.3	43.3	175.7	-96.3	-74.3	0	0	0	112.6	E44 E48	E44-N46 PolarHBondContact O-N 3.17Å; N46-E48 VanDerWaalsContact C-N 3.34Å; N46-E48 PolarHBondContact O-N 2.75Å
47	G	39.4	Very low	40.9	Very low	58 Å²	58	106.4 Å²	106.4	60%	0.598	55%	0.55	S	S	*	.	S	Bend	trans	71.3	22.6	176.9	0	0	0	0	0	114.8	P45 E49	P45-G47 PolarHBondContact O-N 2.72Å; G47-E49 PolarHBondContact O-N 2.94Å
48	E	39.8	Very low	40	Very low	106 Å²	106	106 Å²	106	50%	0.495	55%	0.554	S	S	.	*			trans	-59.7	119.1	170.3	-96.5	168.8	69.9	0	0	110.1	I8 K11 N46	I8-E48 HydrophobicContact CD1-CB 4.13Å; I8-E48 VanDerWaalsContact CG1-O 3.27Å; I8-E48 WeakPolarHBondContact CG1-O 3.22Å; K11-E48 IonicContact NZ-OE1 2.89Å; K11-E48 PolarHBondContact NZ-OE1 2.79Å; K11-E48 IonicContact NZ-OE2 3.57Å; K11-E48 PolarHBondContact NZ-OE2 2.79Å; N46-E48 VanDerWaalsContact C-N 3.34Å; N46-E48 PolarHBondContact O-N 2.75Å
49	E	39.3	Very low	39.3	Very low	127 Å²	127	108.3 Å²	108.3	59%	0.593	58%	0.576	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-78.4	130.1	168	-70.1	178.2	88.3	0	0	109	T5 K7 G47	T5-E49 VanDerWaalsContact CG2-OE1 3.26Å; T5-E49 WeakPolarHBondContact CG2-OE1 3.15Å; K7-E49 HydrophobicContact CG-CG 4.38Å; G47-E49 PolarHBondContact O-N 2.94Å
50	I	42.8	Very low	38.9	Very low	56 Å²	56	104.6 Å²	104.6	29%	0.287	56%	0.562	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-123.9	134.7	169.3	17	165.6	0	0	0	111.1	I8 A53 V93	I8-I50 HydrophobicContact CD1-CD1 3.35Å; I8-I50 HydrophobicContact CD1-CG1 3.37Å; I8-I50 HydrophobicContact CG1-CD1 3.29Å; I8-I50 HydrophobicContact CG1-CG1 3.11Å; I50-A53 HydrophobicContact CD1-CB 3.45Å; I50-A53 VanDerWaalsContact CD1-CB 3.45Å; I50-V93 HydrophobicContact CD1-CB 4.21Å; I50-V93 HydrophobicContact CD1-CG1 3.86Å; I50-V93 HydrophobicContact CD1-CG2 3.4Å; I50-V93 HydrophobicContact CG1-CG1 4.49Å
51	K	41.6	Very low	38.3	Very low	198 Å²	198	104.7 Å²	104.7	86%	0.861	57%	0.567	S	S	*	*	S	Bend	trans	-85	121.8	165.1	-57.8	174.9	-176.8	176.6	0	105.1
52	D	36.2	Very low	38.2	Very low	161 Å²	161	101.3 Å²	101.3	86%	0.861	57%	0.566	S	S	*	*			trans	79.4	37.8	164.8	-126	-104.1	0	0	0	118.6	A54	D52-A54 PolarHBondContact O-N 3.3Å
53	A	38	Very low	37.9	Very low	27 Å²	27	98.7 Å²	98.7	22%	0.223	56%	0.559	C	S	.	*			trans	-79.8	113.3	167.9	0	0	0	0	0	111.7	I50 E55 V93	I50-A53 HydrophobicContact CD1-CB 3.45Å; I50-A53 VanDerWaalsContact CD1-CB 3.45Å; A53-E55 PolarHBondContact O-N 2.77Å; A53-V93 HydrophobicContact CB-CB 3.63Å; A53-V93 HydrophobicContact CB-CG1 3.88Å; A53-V93 HydrophobicContact CB-CG2 3.44Å; A53-V93 VanDerWaalsContact CB-CG2 3.44Å
54	A	34.3	Very low	37.8	Very low	80 Å²	80	104.1 Å²	104.1	66%	0.661	59%	0.585	S	S	*	*			trans	-54.8	131.1	163.9	0	0	0	0	0	109.2	D52 S56	D52-A54 PolarHBondContact O-N 3.3Å; A54-S56 PolarHBondContact O-N 3.32Å
55	E	35.9	Very low	37.7	Very low	119 Å²	119	103 Å²	103	56%	0.556	58%	0.579	S	S	*	*			trans	-64	78	169.3	-74.2	-172.2	78.6	0	0	109.2	A53 R57	A53-E55 PolarHBondContact O-N 2.77Å; E55-R57 VanDerWaalsContact C-N 3.34Å; E55-R57 PolarHBondContact O-N 3.15Å; E55-R57 VanDerWaalsContact O-N 3.08Å; E55-R57 IonicContact OE1-CZ 3.74Å; E55-R57 IonicContact OE1-NE 3.28Å; E55-R57 IonicContact OE1-NH2 3.67Å; E55-R57 PolarHBondContact OE1-NH2 2.74Å
56	S	32.9	Very low	37.3	Very low	65 Å²	65	106.1 Å²	106.1	46%	0.455	61%	0.606	S	S	.	*			trans	-84.2	84	176.9	-169.8	0	0	0	0	108.3	A54 V58	A54-S56 PolarHBondContact O-N 3.32Å; S56-V58 VanDerWaalsContact C-N 3.3Å; S56-V58 PolarHBondContact O-N 3.27Å; S56-V58 VanDerWaalsContact O-N 3.15Å
57	R	32.4	Very low	37	Very low	194 Å²	194	101.3 Å²	101.3	73%	0.732	58%	0.583	S	S	*	*			trans	-81.9	77	170.8	-60.2	-174.6	-168.1	-169.4	4.3	108.7	E55 A59	E55-R57 VanDerWaalsContact C-N 3.34Å; E55-R57 PolarHBondContact O-N 3.15Å; E55-R57 VanDerWaalsContact O-N 3.08Å; E55-R57 IonicContact OE1-CZ 3.74Å; E55-R57 IonicContact OE1-NE 3.28Å; E55-R57 IonicContact OE1-NH2 3.67Å; E55-R57 PolarHBondContact OE1-NH2 2.74Å; R57-A59 PolarHBondContact O-N 3.17Å
58	V	33	Very low	36.8	Very low	94 Å²	94	102.5 Å²	102.5	57%	0.57	59%	0.587	S	S	*	*			trans	-90.3	90.6	167.1	-176	0	0	0	0	105.7	S56 C60	S56-V58 VanDerWaalsContact C-N 3.3Å; S56-V58 PolarHBondContact O-N 3.27Å; S56-V58 VanDerWaalsContact O-N 3.15Å; V58-C60 PolarHBondContact O-N 3.39Å
59	A	34.8	Very low	36.8	Very low	82 Å²	82	101.7 Å²	101.7	68%	0.678	59%	0.589	S	S	*	*			trans	-52.1	111.3	166.5	0	0	0	0	0	106.6	R57 S61	R57-A59 PolarHBondContact O-N 3.17Å; A59-S61 PolarHBondContact O-N 2.76Å
60	C	37.1	Very low	36.7	Very low	34 Å²	34	103.1 Å²	103.1	23%	0.23	60%	0.595	C	S	.	*			trans	-59.2	101	158.5	-76.5	0	0	0	0	103.6	T14 V58 T62 C88	T14-C60 HydrophobicContact CG2-CB 3.62Å; T14-C60 WeakPolarHBondContact CG2-SG 3.4Å; V58-C60 PolarHBondContact O-N 3.39Å; C60-T62 PolarHBondContact O-N 3.26Å; C60-C88 VanDerWaalsContact SG-CB 3.6Å
61	S	35.1	Very low	36.6	Very low	101 Å²	101	108.3 Å²	108.3	71%	0.706	62%	0.619	S	S	*	*			trans	-53.1	106.2	157.1	-49	0	0	0	0	102.6	A59 G63	A59-S61 PolarHBondContact O-N 2.76Å; S61-G63 PolarHBondContact O-N 3.08Å
62	T	40.6	Very low	36.8	Very low	103 Å²	103	100.5 Å²	100.5	63%	0.632	59%	0.588	S	S	*	*			trans	-53.2	81.6	145.2	39.8	0	0	0	0	103.2	C38 C60 E64	C38-T62 HydrophobicContact CB-CG2 4.1Å; C60-T62 PolarHBondContact O-N 3.26Å; T62-E64 PolarHBondContact O-N 2.74Å
63	G	35.7	Very low	37.3	Very low	49 Å²	49	99.1 Å²	99.1	51%	0.505	59%	0.588	S	S	.	*			trans	-54.2	108.4	163.7	0	0	0	0	0	101.2	S61 E65	S61-G63 PolarHBondContact O-N 3.08Å; G63-E65 PolarHBondContact O-N 2.89Å
64	E	36.1	Very low	37.7	Very low	192 Å²	192	99.6 Å²	99.6	90%	0.897	60%	0.595	S	S	*	*	S	Bend	trans	-65.4	56.1	175.7	-169.2	172.9	80.4	0	0	107.5	T62 A66	T62-E64 PolarHBondContact O-N 2.74Å; E64-A66 VanDerWaalsContact C-N 3.31Å
65	E	37.1	Very low	38.7	Very low	138 Å²	138	105 Å²	105	65%	0.645	61%	0.607	S	S	*	*			trans	-109.2	49.4	161.8	-73	-133.7	95	0	0	106.1	G63 V67	G63-E65 PolarHBondContact O-N 2.89Å; E65-V67 HydrophobicContact CB-CG2 4.3Å; E65-V67 PolarHBondContact O-N 2.65Å
66	A	38.2	Very low	39.8	Very low	82 Å²	82	105.1 Å²	105.1	68%	0.678	61%	0.611	S	S	*	*			trans	-65.8	75.5	147.6	0	0	0	0	0	105.9	E64 A68	E64-A66 VanDerWaalsContact C-N 3.31Å; A66-A68 PolarHBondContact O-N 3.15Å
67	V	36.8	Very low	40.9	Very low	62 Å²	62	103.4 Å²	103.4	38%	0.376	60%	0.598	S	S	.	*			trans	-55.2	110	173.5	179.6	0	0	0	0	105.1	E65 V69	E65-V67 HydrophobicContact CB-CG2 4.3Å; E65-V67 PolarHBondContact O-N 2.65Å; V67-V69 PolarHBondContact O-N 3.1Å; V67-V69 VanDerWaalsContact O-N 3.08Å
68	A	35.7	Very low	42.3	Very low	83 Å²	83	98.5 Å²	98.5	69%	0.686	59%	0.59	S	S	*	*			trans	-46.3	120.1	-174.3	0	0	0	0	0	109.2	A66 Q70	A66-A68 PolarHBondContact O-N 3.15Å; A68-Q70 VanDerWaalsContact C-N 3.32Å; A68-Q70 PolarHBondContact O-N 3.27Å
69	V	39.8	Very low	43.6	Very low	88 Å²	88	98.1 Å²	98.1	53%	0.533	58%	0.584	S	S	.	*			trans	-60.1	96.8	177.2	178.2	0	0	0	0	107.3	V67 E71	V67-V69 PolarHBondContact O-N 3.1Å; V67-V69 VanDerWaalsContact O-N 3.08Å; V69-E71 VanDerWaalsContact C-N 3.31Å; V69-E71 HydrophobicContact CG1-CG 4.16Å; V69-E71 PolarHBondContact O-N 2.97Å; V69-E71 VanDerWaalsContact O-N 3.15Å
70	Q	37.4	Very low	44.9	Very low	157 Å²	157	99 Å²	99	73%	0.734	57%	0.574	S	S	*	*			trans	-75.7	96.6	158.3	-95.5	-177.5	66.4	0	0	105.4	Q33 A68 P72	Q33-Q70 PolarHBondContact NE2-O 2.75Å; Q33-Q70 VanDerWaalsContact NE2-O 3.17Å; A68-Q70 VanDerWaalsContact C-N 3.32Å; A68-Q70 PolarHBondContact O-N 3.27Å; Q70-P72 WeakPolarHBondContact O-CD 3.36Å
71	E	39.7	Very low	45.8	Very low	166 Å²	166	102.7 Å²	102.7	78%	0.776	59%	0.589	S	S	*	*			trans	-52	118.9	159.9	-76.7	-177.8	84.7	0	0	107.1	V69 P73	V69-E71 VanDerWaalsContact C-N 3.31Å; V69-E71 HydrophobicContact CG1-CG 4.16Å; V69-E71 PolarHBondContact O-N 2.97Å; V69-E71 VanDerWaalsContact O-N 3.15Å; E71-P73 WeakPolarHBondContact O-CD 3.48Å
72	P	46.2	Very low	46.6	Very low	33 Å²	33	104.3 Å²	104.3	21%	0.214	59%	0.585	C	S	.	*			trans	-65.3	127.2	177.3	28.2	-34.6	0	0	0	108.5	V23 Q70 G74 V77 I79	V23-P72 HydrophobicContact CG1-CB 3.63Å; V23-P72 HydrophobicContact CG1-CG 3.58Å; Q70-P72 WeakPolarHBondContact O-CD 3.36Å; P72-G74 PolarHBondContact O-N 2.85Å; P72-V77 HydrophobicContact CB-CB 4.38Å; P72-V77 HydrophobicContact CB-CG1 3.92Å; P72-V77 HydrophobicContact CB-CG2 4.1Å; P72-V77 HydrophobicContact CG-CB 4.18Å; P72-V77 HydrophobicContact CG-CG1 3.74Å; P72-V77 HydrophobicContact CG-CG2 4.41Å; P72-I79 HydrophobicContact CG-CD1 4.47Å
73	P	46	Very low	47.2	Very low	132 Å²	132	103 Å²	103	86%	0.857	58%	0.577	S	S	*	*	S	Bend	trans	-79	37	-171.5	31.5	-36.2	0	0	0	113.9	E71	E71-P73 WeakPolarHBondContact O-CD 3.48Å
74	G	46.8	Very low	48.1	Very low	37 Å²	37	105.4 Å²	105.4	38%	0.381	58%	0.575	S	S	.	*			trans	-130.1	127.9	-174.3	0	0	0	0	0	113.3	P72 N76 V77	P72-G74 PolarHBondContact O-N 2.85Å; G74-N76 PolarHBondContact O-N 2.85Å; G74-V77 WeakPolarHBondContact O-CG2 3.32Å; G74-V77 PolarHBondContact O-N 2.9Å
75	E	56	Low	49	Very low	195 Å²	195	100.5 Å²	100.5	91%	0.911	56%	0.559	S	S	*	*	T	Hydrogen-bonded Turn	trans	-62.9	-8.3	175.7	-161.4	171.1	90.1	0	0	113.5
76	N	58.4	Low	49.9	Very low	120 Å²	120	97 Å²	97	64%	0.642	54%	0.544	S	S	*	.	T	Hydrogen-bonded Turn	trans	-121.3	34.4	-175.1	-65.5	-60	0	0	0	113.6	P26 G74	P26-N76 HydrophobicContact CB-CB 4.27Å; P26-N76 WeakPolarHBondContact CD-O 3.31Å; P26-N76 HydrophobicContact CG-CB 4.13Å; G74-N76 PolarHBondContact O-N 2.85Å
77	V	57	Low	50.4	Low	30 Å²	30	97.3 Å²	97.3	18%	0.182	54%	0.541	C	S	.	.			trans	-102.9	127.1	-175.8	-175.2	0	0	0	0	109.5	V23 V24 P72 G74	V23-V77 HydrophobicContact CB-CG1 4.42Å; V23-V77 HydrophobicContact CG1-CG1 3.15Å; V24-V77 WeakPolarHBondContact O-CA 3.38Å; V24-V77 WeakPolarHBondContact O-CG1 3.19Å; P72-V77 HydrophobicContact CB-CB 4.38Å; P72-V77 HydrophobicContact CB-CG1 3.92Å; P72-V77 HydrophobicContact CB-CG2 4.1Å; P72-V77 HydrophobicContact CG-CB 4.18Å; P72-V77 HydrophobicContact CG-CG1 3.74Å; P72-V77 HydrophobicContact CG-CG2 4.41Å; G74-V77 WeakPolarHBondContact O-CG2 3.32Å; G74-V77 PolarHBondContact O-N 2.9Å
78	T	61	Low	50.7	Low	90 Å²	90	96.7 Å²	96.7	55%	0.552	54%	0.538	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-89.8	124.5	174.3	-56.2	0	0	0	0	108.7	V24	V24-T78 PolarHBondContact N-O 2.72Å; V24-T78 PolarHBondContact O-N 3.42Å
79	I	60.1	Low	51.1	Low	87 Å²	87	97.9 Å²	97.9	45%	0.446	54%	0.537	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107	109	177.3	-53.2	175.8	0	0	0	108.1	K21 K22 V23 P72 M81	K21-I79 HydrophobicContact CB-CG2 4.34Å; K22-I79 CarbonylContact O-C 3.55Å; K22-I79 WeakPolarHBondContact O-CA 3.25Å; V23-I79 HydrophobicContact CG2-CG1 4.42Å; V23-I79 HydrophobicContact CG2-CG2 4.47Å; P72-I79 HydrophobicContact CG-CD1 4.47Å; I79-M81 HydrophobicContact CG2-CG 4.11Å
80	E	61.7	Low	51.4	Low	99 Å²	99	94.5 Å²	94.5	46%	0.463	52%	0.516	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-86.3	120.8	169	-54.8	-173.8	109.6	0	0	108.1	K21 K22	K21-E80 CarbonylContact C-O 3.57Å; K21-E80 WeakPolarHBondContact CA-O 3.44Å; K22-E80 HydrophobicContact CB-CB 4.24Å; K22-E80 WeakPolarHBondContact CD-OE2 3.41Å; K22-E80 WeakPolarHBondContact CE-OE2 3.48Å; K22-E80 PolarHBondContact N-O 2.75Å; K22-E80 IonicContact NZ-OE2 2.75Å; K22-E80 PolarHBondContact NZ-OE2 3.08Å; K22-E80 PolarHBondContact O-N 2.9Å
81	M	55.9	Low	51.5	Low	113 Å²	113	89.3 Å²	89.3	56%	0.557	50%	0.498	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-113.8	119.3	-179.6	-92.9	176.5	66.5	0	0	110.4	V19 K20 K21 I79	V19-M81 HydrophobicContact CG1-CE 3.98Å; K20-M81 CarbonylContact O-C 3.57Å; K20-M81 WeakPolarHBondContact O-CA 3.32Å; K21-M81 HydrophobicContact CB-CG 4.32Å; K21-M81 HydrophobicContact CD-CG 4.4Å; K21-M81 HydrophobicContact CD-SD 4.42Å; K21-M81 HydrophobicContact CG-CG 3.86Å; K21-M81 HydrophobicContact CG-SD 4.48Å; I79-M81 HydrophobicContact CG2-CG 4.11Å
82	E	52.4	Low	51.5	Low	134 Å²	134	83 Å²	83	63%	0.626	47%	0.472	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-110.5	120.9	170.1	-61.2	-174	105.9	0	0	109	V19 K20	V19-E82 CarbonylContact C-O 3.6Å; V19-E82 WeakPolarHBondContact CA-O 3.46Å; K20-E82 HydrophobicContact CB-CB 4.31Å; K20-E82 PolarHBondContact N-O 2.75Å; K20-E82 PolarHBondContact O-N 2.79Å
83	V	53.9	Low	51.3	Low	75 Å²	75	82 Å²	82	46%	0.455	47%	0.465	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-108.2	116.6	176.3	-177.3	0	0	0	0	108.4	Q17 V19	Q17-V83 HydrophobicContact CB-CG1 4.31Å; Q17-V83 HydrophobicContact CG-CG1 4.49Å; V19-V83 HydrophobicContact CG1-CG2 4.15Å; V19-V83 HydrophobicContact CG2-CG1 4.28Å; V19-V83 HydrophobicContact CG2-CG2 4.14Å
84	E	53.9	Low	51	Low	100 Å²	100	80.5 Å²	80.5	47%	0.467	45%	0.448	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-111.1	112	177.8	-167.6	-179.7	102.5	0	0	108.7	K18 K20 I86	K18-E84 HydrophobicContact CB-CB 4.35Å; K18-E84 PolarHBondContact N-O 2.71Å; K18-E84 PolarHBondContact O-N 2.79Å; K20-E84 IonicContact NZ-OE2 2.72Å; E84-I86 PolarHBondContact O-N 2.95Å
85	T	54.9	Low	50.8	Low	90 Å²	90	80.3 Å²	80.3	55%	0.552	44%	0.444	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-75	107.8	176.8	-53.5	0	0	0	0	109.5	A16 Q17 S87	A16-T85 CarbonylContact O-C 3.51Å; Q17-T85 HydrophobicContact CG-CG2 4.45Å; T85-S87 PolarHBondContact O-N 3.32Å
86	I	55.7	Low	50	Low	65 Å²	65	78.1 Å²	78.1	33%	0.333	43%	0.431	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-87.5	88.7	167.9	-51	176	0	0	0	106.6	A16 K18 E84 C88	A16-I86 CarbonylContact C-O 3.53Å; A16-I86 WeakPolarHBondContact CA-O 3.3Å; A16-I86 HydrophobicContact CB-CB 4.08Å; A16-I86 WeakPolarHBondContact CB-O 3.47Å; A16-I86 PolarHBondContact N-O 3.28Å; A16-I86 CarbonylContact O-C 3.24Å; A16-I86 VanDerWaalsContact O-C 3.24Å; A16-I86 WeakPolarHBondContact O-CA 3.4Å; A16-I86 PolarHBondContact O-N 3.05Å; K18-I86 HydrophobicContact CB-CD1 3.64Å; K18-I86 HydrophobicContact CB-CG1 4.06Å; K18-I86 HydrophobicContact CD-CD1 4.13Å; K18-I86 HydrophobicContact CG-CD1 4.47Å; E84-I86 PolarHBondContact O-N 2.95Å; I86-C88 PolarHBondContact O-N 3.41Å
87	S	48.3	Very low	49.2	Very low	87 Å²	87	79.6 Å²	79.6	61%	0.608	43%	0.434	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-63.1	107.3	175.9	56.8	0	0	0	0	110	T85	T85-S87 PolarHBondContact O-N 3.32Å
88	C	44.2	Very low	48.5	Very low	49 Å²	49	84.2 Å²	84.2	33%	0.331	46%	0.455	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-96	85.4	162.6	-61.3	0	0	0	0	106.9	T14 C60 I86 D90	T14-C88 CarbonylContact C-O 3.6Å; T14-C88 VanDerWaalsContact C-O 3.29Å; T14-C88 PolarHBondContact N-O 3.43Å; T14-C88 CarbonylContact O-C 3.24Å; T14-C88 VanDerWaalsContact O-C 3.24Å; T14-C88 WeakPolarHBondContact O-CA 3.1Å; T14-C88 WeakPolarHBondContact O-CB 3.31Å; T14-C88 PolarHBondContact O-N 3.47Å; T14-C88 VanDerWaalsContact O-N 3.17Å; C60-C88 VanDerWaalsContact SG-CB 3.6Å; I86-C88 PolarHBondContact O-N 3.41Å; C88-D90 PolarHBondContact O-N 3.37Å
89	T	43.3	Very low	47.5	Very low	108 Å²	108	91.2 Å²	91.2	66%	0.663	49%	0.489	S	S	*	.			trans	-64.9	88.7	168.7	37.9	0	0	0	0	108.9	Y13	Y13-T89 HydrophobicContact CD1-CG2 4.4Å
90	D	47.4	Very low	46.9	Very low	17 Å²	17	91.5 Å²	91.5	9%	0.091	49%	0.492	C	S	.	.			trans	-76.5	135.5	159	-177.7	-85.7	0	0	0	107.1	A12 C88 S92	A12-D90 CarbonylContact C-O 3.6Å; A12-D90 CarbonylContact O-C 3.49Å; A12-D90 VanDerWaalsContact O-C 3.24Å; A12-D90 VanDerWaalsContact O-CB 3.25Å; A12-D90 WeakPolarHBondContact O-CB 3.31Å; C88-D90 PolarHBondContact O-N 3.37Å; D90-S92 WeakPolarHBondContact OD1-CB 3.27Å; D90-S92 PolarHBondContact OD1-N 2.73Å; D90-S92 VanDerWaalsContact OD1-N 3.1Å; D90-S92 PolarHBondContact OD1-OG 3.31Å
91	S	38.4	Very low	46.1	Very low	49 Å²	49	91.1 Å²	91.1	34%	0.343	49%	0.493	S	S	.	.			trans	-132.6	76.9	172.7	-73.5	0	0	0	0	105.6	V93	S91-V93 PolarHBondContact O-N 3.41Å
92	S	40.3	Very low	45.6	Very low	33 Å²	33	89.8 Å²	89.8	23%	0.231	49%	0.49	C	S	.	.			trans	-68.8	90	173.4	-72.7	0	0	0	0	110.8	D90 I94	D90-S92 WeakPolarHBondContact OD1-CB 3.27Å; D90-S92 PolarHBondContact OD1-N 2.73Å; D90-S92 VanDerWaalsContact OD1-N 3.1Å; D90-S92 PolarHBondContact OD1-OG 3.31Å; S92-I94 PolarHBondContact O-N 3.18Å; S92-I94 VanDerWaalsContact O-N 3.15Å
93	V	41.4	Very low	45.2	Very low	11 Å²	11	87.2 Å²	87.2	7%	0.067	48%	0.482	C	S	.	.			trans	-80.8	97.8	176.2	-179	0	0	0	0	109.1	I8 I50 A53 S91 A95	I8-V93 HydrophobicContact CB-CG1 4.24Å; I8-V93 HydrophobicContact CG1-CG1 3.93Å; I8-V93 HydrophobicContact CG1-CG2 4.28Å; I8-V93 HydrophobicContact CG2-CB 4.39Å; I8-V93 HydrophobicContact CG2-CG1 4.13Å; I8-V93 HydrophobicContact CG2-CG2 4.13Å; I50-V93 HydrophobicContact CD1-CB 4.21Å; I50-V93 HydrophobicContact CD1-CG1 3.86Å; I50-V93 HydrophobicContact CD1-CG2 3.4Å; I50-V93 HydrophobicContact CG1-CG1 4.49Å; A53-V93 HydrophobicContact CB-CB 3.63Å; A53-V93 HydrophobicContact CB-CG1 3.88Å; A53-V93 HydrophobicContact CB-CG2 3.44Å; A53-V93 VanDerWaalsContact CB-CG2 3.44Å; S91-V93 PolarHBondContact O-N 3.41Å; V93-A95 PolarHBondContact O-N 3.19Å
94	I	41.1	Very low	44.6	Very low	101 Å²	101	88 Å²	88	52%	0.518	48%	0.483	S	S	.	.			trans	-75.8	96.3	169.8	-48.5	177.3	0	0	0	107.3	K7 S10 S92 K96	K7-I94 VanDerWaalsContact O-O 3.13Å; S10-I94 VanDerWaalsContact OG-CD1 3.3Å; S10-I94 WeakPolarHBondContact OG-CD1 3.26Å; S92-I94 PolarHBondContact O-N 3.18Å; S92-I94 VanDerWaalsContact O-N 3.15Å; I94-K96 PolarHBondContact O-N 2.95Å
95	A	41.6	Very low	44	Very low	34 Å²	34	87.2 Å²	87.2	28%	0.281	48%	0.484	S	S	.	.	B	Isolated β-bridge	trans	-70.3	120.9	172.7	0	0	0	0	0	109.9	R6 V93	R6-A95 HydrophobicContact CB-CB 3.72Å; R6-A95 VanDerWaalsContact CD-CB 3.46Å; R6-A95 HydrophobicContact CG-CB 3.64Å; V93-A95 PolarHBondContact O-N 3.19Å
96	K	40.3	Very low	43.2	Very low	148 Å²	148	87 Å²	87	64%	0.643	48%	0.479	S	S	*	.	P	Polyproline II helix	trans	-86.1	116.4	164.7	-162.6	169.2	-176.2	174	0	108.2	I94 M98	I94-K96 PolarHBondContact O-N 2.95Å; K96-M98 PolarHBondContact O-N 3.47Å
97	E	40	Very low	42.3	Very low	151 Å²	151	88.7 Å²	88.7	71%	0.706	49%	0.491	S	S	*	.	P	Polyproline II helix	trans	-61.7	126.4	165.8	-74.1	-169.5	102.5	0	0	108.3	L4	L4-E97 HydrophobicContact CD2-CG 4.43Å
98	M	42.4	Very low	41.8	Very low	128 Å²	128	88.8 Å²	88.8	63%	0.631	48%	0.481	S	S	*	.	P	Polyproline II helix	trans	-97.7	121.1	165.9	-73.5	-174.7	171.7	0	0	106.8	K7 K96	K7-M98 HydrophobicContact CD-CE 4.31Å; K96-M98 PolarHBondContact O-N 3.47Å
99	D	40.8	Very low	41.5	Very low	237 Å²	237	92.5 Å²	92.5	100%	1.267	50%	0.495	S	S	*	.			trans	-69.8	0	165.8	-170.8	-109.2	0	0	0	110.3

Retrieved 99 of 99 residues in 17.1 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).