A0A077ZPS5_TRITR Loading...

Maturase K

AlphaFold DB , UniProt , Accession A0A077ZPS5, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 85 aa.

						>A0A077ZPS5_TRITR|A0A077ZPS5
MELLFGSLALSGGSLFVLSGPDALRVSPLSLRHVALLSFGAQQDMAPGMVGHYPTHQAFPLKAYPTKAPVLALSSSLELLCGFKV
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	32.8	Very low	41.1	Very low	246 Å²	246	123.9 Å²	123.9	100%	1.212	67%	0.667	S	S	*	*				0	102.6	0	-86.3	176.4	169.6	0	0	106.5
2	E	26.4	Very low	42	Very low	177 Å²	177	121.1 Å²	121.1	83%	0.827	69%	0.689	S	S	*	*			trans	-111.9	108.3	174.1	-69.4	-169.2	134.4	0	0	107.7	L4	E2-L4 PolarHBondContact O-N 2.95Å
3	L	32.7	Very low	42.7	Very low	149 Å²	149	114.2 Å²	114.2	78%	0.78	66%	0.661	S	S	*	*			trans	-86.5	95.7	166.3	-74.8	166.2	0	0	0	106.5	F5	L3-F5 VanDerWaalsContact C-N 3.34Å; L3-F5 HydrophobicContact CB-CD2 3.89Å; L3-F5 HydrophobicContact CB-CE2 3.7Å; L3-F5 HydrophobicContact CD1-CE2 4.21Å; L3-F5 HydrophobicContact CG-CE2 4.41Å; L3-F5 PolarHBondContact O-N 3.38Å
4	L	33.5	Very low	42.8	Very low	158 Å²	158	108.1 Å²	108.1	83%	0.827	63%	0.629	S	S	*	*			trans	-66.5	93	172.3	-72.9	165.1	0	0	0	108.7	E2 G6	E2-L4 PolarHBondContact O-N 2.95Å; L4-G6 PolarHBondContact O-N 3.42Å
5	F	40	Very low	43.2	Very low	175 Å²	175	103.5 Å²	103.5	77%	0.768	60%	0.6	S	S	*	*			trans	-86.8	103.1	170	-83.4	-83	0	0	0	109.4	L3 S7	L3-F5 VanDerWaalsContact C-N 3.34Å; L3-F5 HydrophobicContact CB-CD2 3.89Å; L3-F5 HydrophobicContact CB-CE2 3.7Å; L3-F5 HydrophobicContact CD1-CE2 4.21Å; L3-F5 HydrophobicContact CG-CE2 4.41Å; L3-F5 PolarHBondContact O-N 3.38Å; F5-S7 PolarHBondContact O-N 3.14Å
6	G	48	Very low	43.6	Very low	25 Å²	25	102.1 Å²	102.1	26%	0.258	59%	0.585	S	S	.	*	P	Polyproline II helix	trans	-61.8	128.6	163.5	0	0	0	0	0	110.5	L4 L8 L18 S19	L4-G6 PolarHBondContact O-N 3.42Å; G6-L8 PolarHBondContact O-N 2.71Å; G6-L18 CarbonylContact C-O 3.56Å; G6-L18 WeakPolarHBondContact CA-O 3.16Å; G6-S19 VanDerWaalsContact CA-OG 3.27Å; G6-S19 WeakPolarHBondContact CA-OG 3.41Å
7	S	46.7	Very low	43.9	Very low	82 Å²	82	99.4 Å²	99.4	57%	0.573	57%	0.57	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-77.7	122.2	176.7	-64.6	0	0	0	0	108.9	F5 L18	F5-S7 PolarHBondContact O-N 3.14Å; S7-L18 PolarHBondContact N-O 3.47Å; S7-L18 WeakPolarHBondContact O-CA 3.41Å; S7-L18 WeakPolarHBondContact O-CB 3.15Å; S7-L18 PolarHBondContact O-N 3.31Å
8	L	48	Very low	44.3	Very low	112 Å²	112	99.7 Å²	99.7	59%	0.586	57%	0.569	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-86.9	118.1	174.8	-65.4	169.9	0	0	0	108.7	G6 L15 F16 V17	G6-L8 PolarHBondContact O-N 2.71Å; L8-L15 HydrophobicContact CB-CD1 4.14Å; L8-L15 HydrophobicContact CD2-CD1 4.28Å; L8-L15 HydrophobicContact CD2-CD2 4.38Å; L8-L15 HydrophobicContact CD2-CG 4.33Å; L8-F16 CarbonylContact C-O 3.58Å; L8-F16 WeakPolarHBondContact CA-O 3.27Å; L8-V17 HydrophobicContact CD2-CB 3.98Å; L8-V17 HydrophobicContact CD2-CG1 3.87Å; L8-V17 HydrophobicContact CD2-CG2 3.5Å
9	A	50.5	Low	44.3	Very low	37 Å²	37	97.4 Å²	97.4	31%	0.306	56%	0.56	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-105.8	128.1	176	0	0	0	0	0	110.3	F16 L18	A9-F16 HydrophobicContact CB-CB 4.46Å; A9-F16 PolarHBondContact N-O 2.72Å; A9-F16 PolarHBondContact O-N 3.48Å; A9-L18 HydrophobicContact CB-CD1 3.99Å
10	L	46.9	Very low	44.2	Very low	118 Å²	118	95.4 Å²	95.4	62%	0.618	56%	0.561	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-105.1	118.2	174.8	-79.5	164.1	0	0	0	109.5	S14 L15 L31	L10-S14 WeakPolarHBondContact CA-O 3.29Å; L10-L15 HydrophobicContact CD2-CB 4.13Å; L10-L15 HydrophobicContact CD2-CD1 3.73Å; L10-L15 HydrophobicContact CG-CD1 3.9Å; L10-L31 HydrophobicContact CD2-CD2 3.76Å; L10-L31 HydrophobicContact CD2-CG 4.39Å
11	S	46.1	Very low	44.1	Very low	84 Å²	84	97.8 Å²	97.8	59%	0.587	58%	0.579	S	S	*	*	E	Extended strand (participates in β ladder)	trans	-136.6	126.9	174.6	-177.1	0	0	0	0	110.2	G13 S14	S11-G13 PolarHBondContact O-N 3.4Å; S11-S14 PolarHBondContact N-O 3.49Å; S11-S14 VanDerWaalsContact N-O 3.14Å; S11-S14 PolarHBondContact O-N 2.9Å
12	G	52.2	Low	44.4	Very low	90 Å²	90	92.5 Å²	92.5	93%	0.928	56%	0.556	S	S	*	*	T	Hydrogen-bonded Turn	trans	58.3	19.7	172.8	0	0	0	0	0	116.4
13	G	51	Low	45.2	Very low	31 Å²	31	87.6 Å²	87.6	32%	0.32	55%	0.546	S	S	.	.	T	Hydrogen-bonded Turn	trans	95.1	11.2	-176.5	0	0	0	0	0	115.6	S11 L31	S11-G13 PolarHBondContact O-N 3.4Å; G13-L31 PolarHBondContact O-N 3.47Å
14	S	44.7	Very low	45.5	Very low	30 Å²	30	87.2 Å²	87.2	21%	0.21	54%	0.544	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.9	131.7	178.2	-61.4	0	0	0	0	111	L10 S11 F16 P28	L10-S14 WeakPolarHBondContact CA-O 3.29Å; S11-S14 PolarHBondContact N-O 3.49Å; S11-S14 VanDerWaalsContact N-O 3.14Å; S11-S14 PolarHBondContact O-N 2.9Å; S14-F16 VanDerWaalsContact CB-CE2 3.46Å; S14-P28 VanDerWaalsContact CB-CB 3.5Å; S14-P28 VanDerWaalsContact OG-CB 3.25Å; S14-P28 WeakPolarHBondContact OG-CB 3.42Å
15	L	48.4	Very low	45.6	Very low	38 Å²	38	91.3 Å²	91.3	20%	0.199	55%	0.548	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-90.4	122.1	174.3	-173.8	75.6	0	0	0	109.4	L8 L10 V34	L8-L15 HydrophobicContact CB-CD1 4.14Å; L8-L15 HydrophobicContact CD2-CD1 4.28Å; L8-L15 HydrophobicContact CD2-CD2 4.38Å; L8-L15 HydrophobicContact CD2-CG 4.33Å; L10-L15 HydrophobicContact CD2-CB 4.13Å; L10-L15 HydrophobicContact CD2-CD1 3.73Å; L10-L15 HydrophobicContact CG-CD1 3.9Å; L15-V34 HydrophobicContact CD2-CG2 4.3Å
16	F	49.8	Very low	45.7	Very low	82 Å²	82	86.2 Å²	86.2	36%	0.36	53%	0.531	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.2	125.3	174.9	-63	-83.4	0	0	0	109.4	L8 A9 S14 P28	L8-F16 CarbonylContact C-O 3.58Å; L8-F16 WeakPolarHBondContact CA-O 3.27Å; A9-F16 HydrophobicContact CB-CB 4.46Å; A9-F16 PolarHBondContact N-O 2.72Å; A9-F16 PolarHBondContact O-N 3.48Å; S14-F16 VanDerWaalsContact CB-CE2 3.46Å; F16-P28 HydrophobicContact CZ-CB 4.43Å
17	V	49.4	Very low	45.4	Very low	55 Å²	55	89.4 Å²	89.4	33%	0.333	55%	0.55	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-93.1	104.2	175.1	-167.8	0	0	0	0	108.4	L8 S19 V26	L8-V17 HydrophobicContact CD2-CB 3.98Å; L8-V17 HydrophobicContact CD2-CG1 3.87Å; L8-V17 HydrophobicContact CD2-CG2 3.5Å; V17-S19 VanDerWaalsContact CG1-OG 3.29Å; V17-S19 WeakPolarHBondContact CG1-OG 3.33Å; V17-S19 PolarHBondContact O-N 2.98Å; V17-V26 HydrophobicContact CB-CG2 4.43Å
18	L	50.6	Low	45.4	Very low	105 Å²	105	89 Å²	89	55%	0.55	55%	0.545	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-94.3	81.5	175.7	-58.8	171.1	0	0	0	108.2	G6 S7 A9	G6-L18 CarbonylContact C-O 3.56Å; G6-L18 WeakPolarHBondContact CA-O 3.16Å; S7-L18 PolarHBondContact N-O 3.47Å; S7-L18 WeakPolarHBondContact O-CA 3.41Å; S7-L18 WeakPolarHBondContact O-CB 3.15Å; S7-L18 PolarHBondContact O-N 3.31Å; A9-L18 HydrophobicContact CB-CD1 3.99Å
19	S	43.7	Very low	45.5	Very low	57 Å²	57	87.5 Å²	87.5	40%	0.399	54%	0.537	S	S	.	.			trans	-114	112	170.1	-22.3	0	0	0	0	109.6	G6 V17	G6-S19 VanDerWaalsContact CA-OG 3.27Å; G6-S19 WeakPolarHBondContact CA-OG 3.41Å; V17-S19 VanDerWaalsContact CG1-OG 3.29Å; V17-S19 WeakPolarHBondContact CG1-OG 3.33Å; V17-S19 PolarHBondContact O-N 2.98Å
20	G	41.7	Very low	45.1	Very low	56 Å²	56	88.6 Å²	88.6	58%	0.577	54%	0.543	S	S	*	.	S	Bend	trans	67.7	175.8	159.4	0	0	0	0	0	117.3	D22	G20-D22 PolarHBondContact O-N 2.68Å; G20-D22 VanDerWaalsContact O-N 3.14Å
21	P	42.4	Very low	45.1	Very low	146 Å²	146	86.9 Å²	86.9	95%	0.948	53%	0.534	S	S	*	.	S	Bend	trans	-67.7	-12.1	-168.1	26.5	-34.4	0	0	0	114.9
22	D	39.8	Very low	45.1	Very low	136 Å²	136	92.6 Å²	92.6	73%	0.727	54%	0.542	S	S	*	.			trans	-97.7	78.2	165.2	-91.7	-62.5	0	0	0	108.8	G20 L24	G20-D22 PolarHBondContact O-N 2.68Å; G20-D22 VanDerWaalsContact O-N 3.14Å; D22-L24 PolarHBondContact O-N 2.84Å
23	A	43.2	Very low	44.8	Very low	74 Å²	74	93.5 Å²	93.5	61%	0.612	52%	0.522	S	S	*	.			trans	-66.8	72.5	166.1	0	0	0	0	0	108.9	R25	A23-R25 PolarHBondContact O-N 2.84Å
24	L	38.2	Very low	44.7	Very low	141 Å²	141	94.4 Å²	94.4	74%	0.738	52%	0.522	S	S	*	.			trans	-50.5	112.5	162.4	-90.1	158.3	0	0	0	105.4	D22 V26	D22-L24 PolarHBondContact O-N 2.84Å; L24-V26 WeakPolarHBondContact O-CG2 3.46Å; L24-V26 PolarHBondContact O-N 3.07Å
25	R	36.1	Very low	44.8	Very low	243 Å²	243	95 Å²	95	92%	0.917	53%	0.528	S	S	*	.			trans	-58.3	82.3	174.1	-73.6	-178.3	171.9	-176.1	-1.6	108.3	A23 S27	A23-R25 PolarHBondContact O-N 2.84Å; R25-S27 PolarHBondContact O-N 3.1Å; R25-S27 VanDerWaalsContact O-N 3.1Å
26	V	41.3	Very low	44.6	Very low	68 Å²	68	99.2 Å²	99.2	41%	0.412	55%	0.551	S	S	.	*			trans	-74.7	107.5	173.6	-153.3	0	0	0	0	104.7	V17 L24	V17-V26 HydrophobicContact CB-CG2 4.43Å; L24-V26 WeakPolarHBondContact O-CG2 3.46Å; L24-V26 PolarHBondContact O-N 3.07Å
27	S	42.7	Very low	44.4	Very low	92 Å²	92	101.5 Å²	101.5	64%	0.643	57%	0.566	S	S	*	*			trans	-42.5	141.8	175.8	-80.2	0	0	0	0	110.2	R25 L29	R25-S27 PolarHBondContact O-N 3.1Å; R25-S27 VanDerWaalsContact O-N 3.1Å; S27-L29 VanDerWaalsContact C-N 3.33Å; S27-L29 PolarHBondContact O-N 2.74Å
28	P	46.9	Very low	44.2	Very low	74 Å²	74	102.9 Å²	102.9	48%	0.481	58%	0.578	S	S	.	*			trans	-58.4	99	178.7	24.7	-33.2	0	0	0	108.9	S14 F16 S30	S14-P28 VanDerWaalsContact CB-CB 3.5Å; S14-P28 VanDerWaalsContact OG-CB 3.25Å; S14-P28 WeakPolarHBondContact OG-CB 3.42Å; F16-P28 HydrophobicContact CZ-CB 4.43Å; P28-S30 VanDerWaalsContact C-N 3.33Å; P28-S30 PolarHBondContact O-N 2.84Å
29	L	49.2	Very low	43.9	Very low	80 Å²	80	106.1 Å²	106.1	42%	0.419	59%	0.588	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-67.3	101.7	167.2	-89.4	157.1	0	0	0	105	S27 L31 H33	S27-L29 VanDerWaalsContact C-N 3.33Å; S27-L29 PolarHBondContact O-N 2.74Å; L29-L31 PolarHBondContact O-N 3.49Å; L29-H33 HydrophobicContact CD2-CB 3.7Å
30	S	43.6	Very low	43.7	Very low	60 Å²	60	106.3 Å²	106.3	42%	0.42	60%	0.598	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-47.2	129.1	170.4	177.3	0	0	0	0	108	P28 R32 H33	P28-S30 VanDerWaalsContact C-N 3.33Å; P28-S30 PolarHBondContact O-N 2.84Å; S30-R32 PolarHBondContact O-N 3.13Å; S30-H33 PolarHBondContact O-N 3.43Å
31	L	46.9	Very low	43.8	Very low	83 Å²	83	107.9 Å²	107.9	44%	0.435	61%	0.606	S	S	.	*	H	α-helix	trans	-46.1	-20.7	-178.6	-79.7	169.4	0	0	0	114.7	L10 G13 L29 V34 A35	L10-L31 HydrophobicContact CD2-CD2 3.76Å; L10-L31 HydrophobicContact CD2-CG 4.39Å; G13-L31 PolarHBondContact O-N 3.47Å; L29-L31 PolarHBondContact O-N 3.49Å; L31-V34 PolarHBondContact O-N 3.39Å; L31-A35 WeakPolarHBondContact O-CB 3.42Å; L31-A35 PolarHBondContact O-N 2.93Å
32	R	45.3	Very low	43.8	Very low	203 Å²	203	108.7 Å²	108.7	77%	0.766	60%	0.597	S	S	*	*	H	α-helix	trans	-62.8	-34.3	171.6	-67.9	-164.2	170.5	-160.3	-2.4	114.3	S30 L36	S30-R32 PolarHBondContact O-N 3.13Å; R32-L36 WeakPolarHBondContact O-CB 3.45Å; R32-L36 WeakPolarHBondContact O-CG 3.12Å; R32-L36 PolarHBondContact O-N 3.29Å
33	H	45.7	Very low	43.9	Very low	109 Å²	109	111 Å²	111	51%	0.505	60%	0.604	S	S	.	*	H	α-helix	trans	-72.5	-37.4	177.7	-75.3	98.8	0	0	0	112.2	L29 S30 L36 L37	L29-H33 HydrophobicContact CD2-CB 3.7Å; S30-H33 PolarHBondContact O-N 3.43Å; H33-L36 PolarHBondContact O-N 3.24Å; H33-L37 WeakPolarHBondContact O-CG 3.25Å; H33-L37 PolarHBondContact O-N 3.17Å; H33-L37 VanDerWaalsContact O-N 3.13Å
34	V	48.9	Very low	43.7	Very low	50 Å²	50	114.6 Å²	114.6	30%	0.303	61%	0.613	S	S	.	*	H	α-helix	trans	-72.6	-39.3	176.5	-177.1	0	0	0	0	110.5	L15 L31 L36 L37 S38	L15-V34 HydrophobicContact CD2-CG2 4.3Å; L31-V34 PolarHBondContact O-N 3.39Å; V34-L36 PolarHBondContact O-N 3.27Å; V34-L37 PolarHBondContact O-N 2.93Å; V34-S38 PolarHBondContact O-N 3.47Å; V34-S38 PolarHBondContact O-OG 3.01Å
35	A	46.8	Very low	43.7	Very low	42 Å²	42	116.3 Å²	116.3	35%	0.347	62%	0.619	S	S	.	*	H	α-helix	trans	-60.7	-43.7	172.7	0	0	0	0	0	111.8	L31 L37 S38 F39	L31-A35 WeakPolarHBondContact O-CB 3.42Å; L31-A35 PolarHBondContact O-N 2.93Å; A35-L37 VanDerWaalsContact C-N 3.31Å; A35-L37 PolarHBondContact O-N 3Å; A35-S38 PolarHBondContact O-N 2.95Å; A35-F39 WeakPolarHBondContact O-CD2 3.5Å; A35-F39 PolarHBondContact O-N 3.15Å
36	L	45.1	Very low	43.7	Very low	128 Å²	128	109.1 Å²	109.1	67%	0.67	61%	0.612	S	S	*	*	H	α-helix	trans	-64.4	-32.2	177.2	-80.1	165.5	0	0	0	113.5	R32 H33 V34 G40	R32-L36 WeakPolarHBondContact O-CB 3.45Å; R32-L36 WeakPolarHBondContact O-CG 3.12Å; R32-L36 PolarHBondContact O-N 3.29Å; H33-L36 PolarHBondContact O-N 3.24Å; V34-L36 PolarHBondContact O-N 3.27Å; L36-G40 WeakPolarHBondContact O-CA 3.37Å; L36-G40 PolarHBondContact O-N 2.95Å
37	L	46	Very low	43.7	Very low	130 Å²	130	112.6 Å²	112.6	68%	0.681	64%	0.636	S	S	*	*	H	α-helix	trans	-74.9	-38.3	174.4	-72.9	165	0	0	0	112.1	H33 V34 A35 G40 A41	H33-L37 WeakPolarHBondContact O-CG 3.25Å; H33-L37 PolarHBondContact O-N 3.17Å; H33-L37 VanDerWaalsContact O-N 3.13Å; V34-L37 PolarHBondContact O-N 2.93Å; A35-L37 VanDerWaalsContact C-N 3.31Å; A35-L37 PolarHBondContact O-N 3Å; L37-G40 PolarHBondContact O-N 3.47Å; L37-A41 PolarHBondContact O-N 3.38Å
38	S	43.9	Very low	43.4	Very low	83 Å²	83	111.2 Å²	111.2	58%	0.58	64%	0.636	S	S	*	*	H	α-helix	trans	-70.5	-32.3	177.1	-60.4	0	0	0	0	113.1	V34 A35	V34-S38 PolarHBondContact O-N 3.47Å; V34-S38 PolarHBondContact O-OG 3.01Å; A35-S38 PolarHBondContact O-N 2.95Å
39	F	45.6	Very low	43.1	Very low	173 Å²	173	116.7 Å²	116.7	76%	0.759	66%	0.658	S	S	*	*	H	α-helix	trans	-83.6	-17	170.5	-71.1	-70.1	0	0	0	113	A35	A35-F39 WeakPolarHBondContact O-CD2 3.5Å; A35-F39 PolarHBondContact O-N 3.15Å
40	G	37.6	Very low	42.8	Very low	61 Å²	61	119.7 Å²	119.7	63%	0.629	68%	0.679	S	S	*	*	H	α-helix	trans	-85.6	-11.3	177.3	0	0	0	0	0	114.8	L36 L37	L36-G40 WeakPolarHBondContact O-CA 3.37Å; L36-G40 PolarHBondContact O-N 2.95Å; L37-G40 PolarHBondContact O-N 3.47Å
41	A	45	Very low	42.8	Very low	90 Å²	90	119.5 Å²	119.5	74%	0.744	69%	0.686	S	S	*	*	T	Hydrogen-bonded Turn	trans	-90.2	2.6	178.2	0	0	0	0	0	113.8	L37	L37-A41 PolarHBondContact O-N 3.38Å
42	Q	42.8	Very low	42.3	Very low	162 Å²	162	124.4 Å²	124.4	76%	0.757	71%	0.707	S	S	*	*	S	Bend	trans	-128.3	66.1	179.6	-165.9	-165.8	-38.3	0	0	110.7
43	Q	41.9	Very low	42.3	Very low	184 Å²	184	125.1 Å²	125.1	86%	0.86	71%	0.711	S	S	*	*			trans	-168.1	100.7	146.4	-106	163.7	22.7	0	0	110
44	D	38.4	Very low	42.4	Very low	151 Å²	151	125.3 Å²	125.3	81%	0.807	72%	0.722	S	S	*	*			trans	-33.2	138.6	150.5	-125.2	-40.9	0	0	0	112.2
45	M	37.7	Very low	42.3	Very low	176 Å²	176	129.4 Å²	129.4	87%	0.867	75%	0.748	S	S	*	*			trans	66.8	100	162.6	-76.5	158.2	149.5	0	0	119.7
46	A	37.5	Very low	42	Very low	93 Å²	93	135 Å²	135	77%	0.769	77%	0.766	S	S	*	*				171.4	127.7	114.9	0	0	0	0	0	111.8	G48	A46-G48 PolarHBondContact O-N 2.8Å
47	P	39.9	Very low	41.8	Very low	140 Å²	140	136.2 Å²	136.2	91%	0.909	77%	0.768	S	S	*	*			trans	-90.3	99.8	172.1	33.8	-25.4	0	0	0	109
48	G	37.8	Very low	41.9	Very low	64 Å²	64	135 Å²	135	66%	0.66	78%	0.777	S	S	*	*			trans	160.4	99.1	171.6	0	0	0	0	0	113.3	A46	A46-G48 PolarHBondContact O-N 2.8Å
49	M	39.4	Very low	42.2	Very low	189 Å²	189	139.4 Å²	139.4	93%	0.931	79%	0.786	S	S	*	*			trans	166.3	111.9	131.5	-90.1	-174.4	79.7	0	0	108.2	G51	M49-G51 PolarHBondContact O-N 2.77Å
50	V	42.4	Very low	42.2	Very low	142 Å²	142	136.2 Å²	136.2	86%	0.861	78%	0.782	S	S	*	*			trans	-68.3	97.7	170.6	-178.1	0	0	0	0	107.2	H52	V50-H52 PolarHBondContact O-N 3.25Å
51	G	44.4	Very low	42.7	Very low	56 Å²	56	141.8 Å²	141.8	58%	0.577	80%	0.797	S	S	*	*			trans	-73.2	114.1	175.6	0	0	0	0	0	110.8	M49 Y53	M49-G51 PolarHBondContact O-N 2.77Å; G51-Y53 PolarHBondContact O-N 3.32Å
52	H	36	Very low	42.5	Very low	187 Å²	187	146 Å²	146	87%	0.866	80%	0.798	S	S	*	*			trans	-54.9	116.2	168.6	-83.7	-111.2	0	0	0	110.6	V50	V50-H52 PolarHBondContact O-N 3.25Å
53	Y	45	Very low	42.6	Very low	217 Å²	217	142.9 Å²	142.9	85%	0.851	80%	0.801	S	S	*	*			trans	-77.1	125.2	167.8	-72.4	-84.5	0	0	0	109.5	G51 T55	G51-Y53 PolarHBondContact O-N 3.32Å; Y53-T55 PolarHBondContact O-N 2.97Å
54	P	48.8	Very low	42.9	Very low	113 Å²	113	144.7 Å²	144.7	73%	0.734	80%	0.801	S	S	*	*			trans	-73.3	109.6	173.6	28.4	-30.1	0	0	0	109.3	H56	P54-H56 VanDerWaalsContact C-N 3.26Å; P54-H56 PolarHBondContact O-N 3.14Å
55	T	45.6	Very low	43.2	Very low	137 Å²	137	143.2 Å²	143.2	84%	0.84	80%	0.8	S	S	*	*			trans	-71.2	81.1	166	36.4	0	0	0	0	109.5	Y53	Y53-T55 PolarHBondContact O-N 2.97Å
56	H	41.1	Very low	43.4	Very low	158 Å²	158	141.5 Å²	141.5	73%	0.731	80%	0.8	S	S	*	*			trans	-133.2	122.2	170.4	-90.7	-81.6	0	0	0	111.3	P54	P54-H56 VanDerWaalsContact C-N 3.26Å; P54-H56 PolarHBondContact O-N 3.14Å
57	Q	41	Very low	43.4	Very low	154 Å²	154	146.8 Å²	146.8	72%	0.72	81%	0.805	S	S	*	*			trans	79.4	89.5	154.8	-58.1	-177.7	0.3	0	0	116.4	F59	Q57-F59 WeakPolarHBondContact O-CD2 3.43Å; Q57-F59 PolarHBondContact O-N 3Å; Q57-F59 VanDerWaalsContact O-N 3.08Å
58	A	47.2	Very low	43.6	Very low	104 Å²	104	144.2 Å²	144.2	86%	0.86	80%	0.796	S	S	*	*			trans	-55.5	109.5	152.5	0	0	0	0	0	108.9
59	F	50.7	Low	43.7	Very low	177 Å²	177	146.9 Å²	146.9	78%	0.776	80%	0.801	S	S	*	*			trans	-65.7	127	171.8	-79.2	-97.5	0	0	0	109.2	Q57 L61	Q57-F59 WeakPolarHBondContact O-CD2 3.43Å; Q57-F59 PolarHBondContact O-N 3Å; Q57-F59 VanDerWaalsContact O-N 3.08Å; F59-L61 PolarHBondContact O-N 3.02Å
60	P	46.5	Very low	44	Very low	105 Å²	105	144 Å²	144	68%	0.682	79%	0.794	S	S	*	*			trans	-69.2	122.1	170	27.9	-29.5	0	0	0	107.9	K62	P60-K62 PolarHBondContact O-N 3.23Å
61	L	48.5	Very low	44	Very low	179 Å²	179	145 Å²	145	94%	0.937	79%	0.794	S	S	*	*			trans	-64.4	80.8	170.8	-67.2	170.6	0	0	0	108.8	F59 A63	F59-L61 PolarHBondContact O-N 3.02Å; L61-A63 PolarHBondContact O-N 3.38Å
62	K	40.7	Very low	44	Very low	177 Å²	177	146.3 Å²	146.3	77%	0.77	80%	0.799	S	S	*	*			trans	-65.1	118.2	165.8	-80.3	-175.3	177.2	-179.6	0	107.1	P60 Y64	P60-K62 PolarHBondContact O-N 3.23Å; K62-Y64 PolarHBondContact O-N 3.18Å
63	A	43.9	Very low	44.4	Very low	98 Å²	98	144 Å²	144	81%	0.81	79%	0.792	S	S	*	*			trans	-45.7	123.6	-179.7	0	0	0	0	0	112	L61	L61-A63 PolarHBondContact O-N 3.38Å
64	Y	48.6	Very low	44.4	Very low	221 Å²	221	139 Å²	139	87%	0.867	79%	0.789	S	S	*	*			trans	-79.1	130.6	166.1	-78	-89.2	0	0	0	108.9	K62 T66	K62-Y64 PolarHBondContact O-N 3.18Å; Y64-T66 PolarHBondContact O-N 3.4Å
65	P	44	Very low	44.1	Very low	120 Å²	120	137.7 Å²	137.7	78%	0.779	78%	0.783	S	S	*	*			trans	-72.5	122.7	175.7	29.4	-31.2	0	0	0	109.5	K67	P65-K67 PolarHBondContact O-N 2.96Å; P65-K67 VanDerWaalsContact O-N 3.08Å
66	T	42.9	Very low	43.9	Very low	141 Å²	141	135.2 Å²	135.2	87%	0.865	77%	0.771	S	S	*	*			trans	-56.2	101.5	171.9	33.3	0	0	0	0	111.9	Y64	Y64-T66 PolarHBondContact O-N 3.4Å
67	K	36.6	Very low	44	Very low	203 Å²	203	132.9 Å²	132.9	88%	0.883	76%	0.763	S	S	*	*			trans	-147.9	103.4	149.8	-73.1	-160.8	178.3	-179.2	0	109.3	P65	P65-K67 PolarHBondContact O-N 2.96Å; P65-K67 VanDerWaalsContact O-N 3.08Å
68	A	44.3	Very low	44	Very low	86 Å²	86	133.3 Å²	133.3	71%	0.711	77%	0.766	S	S	*	*			trans	-81.3	151.7	174	0	0	0	0	0	111.4	V70	A68-V70 HydrophobicContact CB-CG2 4.22Å
69	P	41.2	Very low	43.9	Very low	120 Å²	120	136 Å²	136	78%	0.779	76%	0.764	S	S	*	*			trans	-114.2	93.8	144.8	32.5	-18.8	0	0	0	108.2	L71	P69-L71 VanDerWaalsContact C-N 3.3Å; P69-L71 PolarHBondContact O-N 3.08Å
70	V	45.1	Very low	43.5	Very low	128 Å²	128	135.2 Å²	135.2	78%	0.776	77%	0.767	S	S	*	*			trans	-93.7	71.2	164.1	-174.6	0	0	0	0	107.2	A68	A68-V70 HydrophobicContact CB-CG2 4.22Å
71	L	42.4	Very low	43.4	Very low	164 Å²	164	133.5 Å²	133.5	86%	0.859	76%	0.757	S	S	*	*			trans	-143.2	87.8	173.6	-92.5	164.2	0	0	0	107.2	P69	P69-L71 VanDerWaalsContact C-N 3.3Å; P69-L71 PolarHBondContact O-N 3.08Å
72	A	43.2	Very low	42.9	Very low	83 Å²	83	128.4 Å²	128.4	69%	0.686	75%	0.748	S	S	*	*			trans	158.3	48.1	153.7	0	0	0	0	0	112.4
73	L	45.3	Very low	43	Very low	139 Å²	139	128.9 Å²	128.9	73%	0.728	75%	0.751	S	S	*	*			trans	-114.1	12.8	171.4	-76	172.8	0	0	0	113.7
74	S	45	Very low	42.8	Very low	112 Å²	112	133.7 Å²	133.7	78%	0.783	75%	0.753	S	S	*	*	S	Bend	trans	-87.3	-9.3	-179.4	87.3	0	0	0	0	115
75	S	41.9	Very low	42.5	Very low	85 Å²	85	132.8 Å²	132.8	59%	0.594	77%	0.77	S	S	*	*	S	Bend	trans	-112.5	-15.2	-172.1	41.2	0	0	0	0	115.4
76	S	42.2	Very low	42.4	Very low	85 Å²	85	133.5 Å²	133.5	59%	0.594	77%	0.77	S	S	*	*	S	Bend	trans	-98.4	-7.1	178.9	-61.7	0	0	0	0	114.2
77	L	42.2	Very low	42.4	Very low	110 Å²	110	133.1 Å²	133.1	58%	0.576	77%	0.765	S	S	*	*	H	α-helix	trans	-79.9	-23.8	179.8	-127.6	150.2	0	0	0	112.2	L79 L80 C81	L77-L79 VanDerWaalsContact C-N 3.32Å; L77-L79 PolarHBondContact O-N 3.23Å; L77-L80 PolarHBondContact O-N 3.27Å; L77-C81 VanDerWaalsContact CD2-SG 3.54Å; L77-C81 WeakPolarHBondContact O-CB 3.42Å; L77-C81 PolarHBondContact O-N 2.76Å; L77-C81 VanDerWaalsContact O-N 3.07Å
78	E	42	Very low	42.7	Very low	163 Å²	163	129.2 Å²	129.2	76%	0.762	76%	0.758	S	S	*	*	H	α-helix	trans	-67.5	-31.9	173.3	-67.4	-171	152.1	0	0	112.6	L80	E78-L80 VanDerWaalsContact C-N 3.35Å
79	L	43.9	Very low	42.6	Very low	160 Å²	160	131.7 Å²	131.7	84%	0.838	76%	0.761	S	S	*	*	H	α-helix	trans	-75.3	-22	178.1	-94.6	160.6	0	0	0	113.6	L77	L77-L79 VanDerWaalsContact C-N 3.32Å; L77-L79 PolarHBondContact O-N 3.23Å
80	L	43.1	Very low	42.7	Very low	160 Å²	160	132.4 Å²	132.4	84%	0.838	76%	0.76	S	S	*	*	H	α-helix	trans	-98	-27.5	179.8	-147.5	79.6	0	0	0	112.7	L77 E78	L77-L80 PolarHBondContact O-N 3.27Å; E78-L80 VanDerWaalsContact C-N 3.35Å
81	C	44	Very low	42.6	Very low	70 Å²	70	132.7 Å²	132.7	47%	0.473	76%	0.759	S	S	.	*	H	α-helix	trans	-87.6	-18.1	-175.3	-84.7	0	0	0	0	115.3	L77 F83	L77-C81 VanDerWaalsContact CD2-SG 3.54Å; L77-C81 WeakPolarHBondContact O-CB 3.42Å; L77-C81 PolarHBondContact O-N 2.76Å; L77-C81 VanDerWaalsContact O-N 3.07Å; C81-F83 WeakPolarHBondContact O-CD2 3.42Å; C81-F83 PolarHBondContact O-N 3.32Å
82	G	38.1	Very low	42.6	Very low	72 Å²	72	130.5 Å²	130.5	74%	0.742	75%	0.752	S	S	*	*			trans	54.3	8.3	173	0	0	0	0	0	116.4	K84	G82-K84 PolarHBondContact O-N 3.08Å
83	F	43.3	Very low	42.5	Very low	187 Å²	187	134.2 Å²	134.2	82%	0.82	76%	0.757	S	S	*	*			trans	-89.5	98	179.7	-89.3	-79.7	0	0	0	107.9	C81 V85	C81-F83 WeakPolarHBondContact O-CD2 3.42Å; C81-F83 PolarHBondContact O-N 3.32Å; F83-V85 PolarHBondContact O-N 3.35Å
84	K	39.8	Very low	42.3	Very low	199 Å²	199	133.8 Å²	133.8	87%	0.865	76%	0.759	S	S	*	*			trans	-66.7	120.7	161.1	-179.3	165.1	178.9	156.4	0	108.1	G82	G82-K84 PolarHBondContact O-N 3.08Å
85	V	42.1	Very low	42	Very low	202 Å²	202	135.7 Å²	135.7	100%	1.224	76%	0.757	S	S	*	*			trans	-82.2	0	159.2	-174.3	0	0	0	0	108.4	F83	F83-V85 PolarHBondContact O-N 3.35Å

Retrieved 85 of 85 residues in 65.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).