A0A077ZQU6_TRITR Loading...

Uncharacterized protein

AlphaFold DB , UniProt , Accession A0A077ZQU6, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 73 aa.

						>A0A077ZQU6_TRITR|A0A077ZQU6
MVSQEFNNPNITPYLLILAGIATLAKRAQIPRHRYLTNLYFRLIAFYEKDLKKIVTYSTIPQIALVIFIIYTK
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	48.1	Very low	60.2	Low	245 Å²	245	125 Å²	125	100%	1.207	66%	0.661	S	S	*	*				0	60.6	0	-127.4	172.8	100.9	0	0	109.8
2	V	63.6	Low	61.4	Low	99 Å²	99	121.2 Å²	121.2	60%	0.6	65%	0.646	S	S	*	*			trans	-131	-12.8	-173.1	171.9	0	0	0	0	112.9	Q4 F6	V2-Q4 PolarHBondContact O-N 2.78Å; V2-F6 HydrophobicContact CG1-CD2 4.34Å; V2-F6 HydrophobicContact CG1-CE2 3.92Å; V2-F6 WeakPolarHBondContact O-CD2 3.33Å
3	S	57	Low	62.6	Low	108 Å²	108	116.8 Å²	116.8	76%	0.755	63%	0.629	S	S	*	*	T	Hydrogen-bonded Turn	trans	-77.9	-17.5	-173	-43.8	0	0	0	0	115.1
4	Q	54.5	Low	64	Low	179 Å²	179	120.8 Å²	120.8	84%	0.836	63%	0.632	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83.3	-30.2	-171.4	-164	164.2	-31.4	0	0	113.1	V2 N7	V2-Q4 PolarHBondContact O-N 2.78Å; Q4-N7 PolarHBondContact O-N 3.08Å
5	E	57.8	Low	65.3	Low	141 Å²	141	117.5 Å²	117.5	66%	0.659	62%	0.615	S	S	*	*	G	3₁₀ helix	trans	-69.7	-34.5	178.3	-66.4	-74.1	137.2	0	0	111.8	N7 N8 I11	E5-N7 VanDerWaalsContact C-N 3.27Å; E5-N7 PolarHBondContact O-N 3.03Å; E5-N8 PolarHBondContact O-N 3.46Å; E5-I11 WeakPolarHBondContact O-CD1 3.41Å
6	F	57.7	Low	66.6	Low	122 Å²	122	118.5 Å²	118.5	54%	0.535	62%	0.62	S	S	.	*	G	3₁₀ helix	trans	-73.5	-14.2	-179.2	-77.2	-84.6	0	0	0	114.4	V2 L15	V2-F6 HydrophobicContact CG1-CD2 4.34Å; V2-F6 HydrophobicContact CG1-CE2 3.92Å; V2-F6 WeakPolarHBondContact O-CD2 3.33Å; F6-L15 HydrophobicContact CD1-CD1 3.6Å; F6-L15 HydrophobicContact CE1-CD1 3.84Å; F6-L15 HydrophobicContact CE1-CD2 4.17Å
7	N	59.8	Low	67.9	Low	141 Å²	141	117.5 Å²	117.5	75%	0.754	61%	0.614	S	S	*	*	G	3₁₀ helix	trans	-94.8	6.7	-178.6	-158.5	25.8	0	0	0	113.2	Q4 E5 P9	Q4-N7 PolarHBondContact O-N 3.08Å; E5-N7 VanDerWaalsContact C-N 3.27Å; E5-N7 PolarHBondContact O-N 3.03Å; N7-P9 WeakPolarHBondContact O-CD 3.46Å
8	N	59.7	Low	69	Low	72 Å²	72	117.3 Å²	117.3	39%	0.385	61%	0.614	S	S	.	*			trans	-76.8	120.9	171.8	-171	-7.5	0	0	0	108.9	E5 N10 I11	E5-N8 PolarHBondContact O-N 3.46Å; N8-N10 PolarHBondContact O-N 3.38Å; N8-N10 PolarHBondContact OD1-N 3.44Å; N8-I11 HydrophobicContact CB-CD1 4.13Å; N8-I11 HydrophobicContact CB-CG1 4.43Å; N8-I11 PolarHBondContact O-N 3.47Å
9	P	64.6	Low	70	Confident	101 Å²	101	114 Å²	114	66%	0.656	61%	0.605	S	S	*	*	T	Hydrogen-bonded Turn	trans	-57.6	-18.3	-180	21.1	-32.6	0	0	0	113.6	N7	N7-P9 WeakPolarHBondContact O-CD 3.46Å
10	N	70	Confident	70.9	Confident	118 Å²	118	110.4 Å²	110.4	63%	0.631	60%	0.596	S	S	*	*	T	Hydrogen-bonded Turn	trans	-74.7	-18.9	174.6	-77.6	-11.9	0	0	0	114.9	N8 Y14	N8-N10 PolarHBondContact O-N 3.38Å; N8-N10 PolarHBondContact OD1-N 3.44Å; N10-Y14 WeakPolarHBondContact O-CD2 3.4Å; N10-Y14 WeakPolarHBondContact O-CE2 3.42Å
11	I	69.8	Low	71.7	Confident	49 Å²	49	110.1 Å²	110.1	25%	0.251	59%	0.593	S	S	.	*	T	Hydrogen-bonded Turn	trans	-92.2	-26.9	-177.1	-71.2	168.7	0	0	0	112.1	E5 N8 P13 Y14 L15	E5-I11 WeakPolarHBondContact O-CD1 3.41Å; N8-I11 HydrophobicContact CB-CD1 4.13Å; N8-I11 HydrophobicContact CB-CG1 4.43Å; N8-I11 PolarHBondContact O-N 3.47Å; I11-P13 VanDerWaalsContact C-CD 3.47Å; I11-Y14 PolarHBondContact O-N 2.98Å; I11-L15 HydrophobicContact CG2-CD1 3.82Å; I11-L15 HydrophobicContact CG2-CG 4.04Å; I11-L15 PolarHBondContact O-N 3.48Å
12	T	74.7	Confident	73.3	Confident	79 Å²	79	101.2 Å²	101.2	49%	0.485	56%	0.558	S	S	.	*	H	α-helix	trans	-50.6	-44.8	178.5	-45.1	0	0	0	0	115	Y14 L15 L16	T12-Y14 PolarHBondContact O-N 3.39Å; T12-L15 PolarHBondContact O-N 2.99Å; T12-L16 PolarHBondContact O-N 3.05Å; T12-L16 VanDerWaalsContact O-N 3.09Å
13	P	77.1	Confident	74.3	Confident	65 Å²	65	100 Å²	100	42%	0.422	55%	0.552	S	S	.	*	H	α-helix	trans	-66.1	-36.7	-179.4	24.2	-33.6	0	0	0	113	I11 L16 I17	I11-P13 VanDerWaalsContact C-CD 3.47Å; P13-L16 PolarHBondContact O-N 3.15Å; P13-I17 VanDerWaalsContact O-CG1 3.3Å; P13-I17 WeakPolarHBondContact O-CG1 3.37Å; P13-I17 PolarHBondContact O-N 3.22Å
14	Y	81.7	Confident	75.4	Confident	172 Å²	172	100.8 Å²	100.8	68%	0.675	55%	0.547	S	S	*	.	H	α-helix	trans	-67.1	-39.5	178.9	-64.9	-76.8	0	0	0	112.1	N10 I11 T12 L16 I17 L18	N10-Y14 WeakPolarHBondContact O-CD2 3.4Å; N10-Y14 WeakPolarHBondContact O-CE2 3.42Å; I11-Y14 PolarHBondContact O-N 2.98Å; T12-Y14 PolarHBondContact O-N 3.39Å; Y14-L16 VanDerWaalsContact C-N 3.35Å; Y14-I17 PolarHBondContact O-N 3.31Å; Y14-L18 WeakPolarHBondContact O-CB 3.21Å; Y14-L18 PolarHBondContact O-N 3.39Å
15	L	84	Confident	76.5	Confident	72 Å²	72	94.7 Å²	94.7	38%	0.377	53%	0.526	S	S	.	.	H	α-helix	trans	-66	-38.3	175.3	-66.3	174.9	0	0	0	111.7	F6 I11 T12 L18 A19	F6-L15 HydrophobicContact CD1-CD1 3.6Å; F6-L15 HydrophobicContact CE1-CD1 3.84Å; F6-L15 HydrophobicContact CE1-CD2 4.17Å; I11-L15 HydrophobicContact CG2-CD1 3.82Å; I11-L15 HydrophobicContact CG2-CG 4.04Å; I11-L15 PolarHBondContact O-N 3.48Å; T12-L15 PolarHBondContact O-N 2.99Å; L15-L18 PolarHBondContact O-N 3.46Å; L15-A19 VanDerWaalsContact O-CB 3.26Å; L15-A19 WeakPolarHBondContact O-CB 2.8Å; L15-A19 PolarHBondContact O-N 2.95Å
16	L	85.5	Confident	77.2	Confident	133 Å²	133	94.8 Å²	94.8	70%	0.696	53%	0.525	S	S	*	.	H	α-helix	trans	-65	-42.1	176.3	-161.3	104.2	0	0	0	111.6	T12 P13 Y14 A19 G20	T12-L16 PolarHBondContact O-N 3.05Å; T12-L16 VanDerWaalsContact O-N 3.09Å; P13-L16 PolarHBondContact O-N 3.15Å; Y14-L16 VanDerWaalsContact C-N 3.35Å; L16-A19 PolarHBondContact O-N 3Å; L16-G20 PolarHBondContact O-N 3.3Å
17	I	88.6	Confident	77.7	Confident	101 Å²	101	97.9 Å²	97.9	52%	0.518	53%	0.533	S	S	.	.	H	α-helix	trans	-63.3	-47.5	175.5	-67.6	166.4	0	0	0	110.4	P13 Y14 A19 G20 I21	P13-I17 VanDerWaalsContact O-CG1 3.3Å; P13-I17 WeakPolarHBondContact O-CG1 3.37Å; P13-I17 PolarHBondContact O-N 3.22Å; Y14-I17 PolarHBondContact O-N 3.31Å; I17-A19 PolarHBondContact O-N 2.88Å; I17-G20 PolarHBondContact O-N 3.45Å; I17-I21 HydrophobicContact CG2-CD1 3.81Å; I17-I21 HydrophobicContact CG2-CG1 4.44Å; I17-I21 WeakPolarHBondContact O-CG1 3.33Å; I17-I21 PolarHBondContact O-N 3.43Å
18	L	87.7	Confident	77.8	Confident	115 Å²	115	93.2 Å²	93.2	60%	0.602	51%	0.514	S	S	*	.	H	α-helix	trans	-62	-43.3	179	-173.8	66	0	0	0	111.7	Y14 L15 G20 I21 A22	Y14-L18 WeakPolarHBondContact O-CB 3.21Å; Y14-L18 PolarHBondContact O-N 3.39Å; L15-L18 PolarHBondContact O-N 3.46Å; L18-G20 VanDerWaalsContact C-N 3.33Å; L18-G20 PolarHBondContact O-N 3.06Å; L18-I21 PolarHBondContact O-N 3.23Å; L18-A22 WeakPolarHBondContact O-CB 3.39Å; L18-A22 PolarHBondContact O-N 3.43Å
19	A	88.3	Confident	77.9	Confident	54 Å²	54	96.6 Å²	96.6	45%	0.446	53%	0.527	S	S	.	.	H	α-helix	trans	-63.5	-38.2	174.7	0	0	0	0	0	112.1	L15 L16 I17 T23	L15-A19 VanDerWaalsContact O-CB 3.26Å; L15-A19 WeakPolarHBondContact O-CB 2.8Å; L15-A19 PolarHBondContact O-N 2.95Å; L16-A19 PolarHBondContact O-N 3Å; I17-A19 PolarHBondContact O-N 2.88Å; A19-T23 WeakPolarHBondContact O-CB 3.32Å; A19-T23 PolarHBondContact O-N 2.77Å; A19-T23 PolarHBondContact O-OG1 3.36Å
20	G	88.8	Confident	77.6	Confident	41 Å²	41	97.5 Å²	97.5	42%	0.423	53%	0.526	S	S	.	.	H	α-helix	trans	-62	-49.4	174.3	0	0	0	0	0	112.2	L16 I17 L18 T23 L24	L16-G20 PolarHBondContact O-N 3.3Å; I17-G20 PolarHBondContact O-N 3.45Å; L18-G20 VanDerWaalsContact C-N 3.33Å; L18-G20 PolarHBondContact O-N 3.06Å; G20-T23 PolarHBondContact O-N 3.31Å; G20-L24 WeakPolarHBondContact O-CB 3.44Å; G20-L24 PolarHBondContact O-N 3.35Å
21	I	85.8	Confident	77	Confident	105 Å²	105	95.7 Å²	95.7	54%	0.538	52%	0.52	S	S	.	.	H	α-helix	trans	-62.5	-45.3	177.2	-64.7	167.5	0	0	0	110.6	I17 L18 T23 L24 A25	I17-I21 HydrophobicContact CG2-CD1 3.81Å; I17-I21 HydrophobicContact CG2-CG1 4.44Å; I17-I21 WeakPolarHBondContact O-CG1 3.33Å; I17-I21 PolarHBondContact O-N 3.43Å; L18-I21 PolarHBondContact O-N 3.23Å; I21-T23 VanDerWaalsContact C-N 3.31Å; I21-T23 PolarHBondContact O-N 3.32Å; I21-L24 PolarHBondContact O-N 3.1Å; I21-A25 WeakPolarHBondContact O-CB 3.19Å; I21-A25 PolarHBondContact O-N 3.17Å
22	A	83.5	Confident	76.3	Confident	58 Å²	58	102 Å²	102	48%	0.479	54%	0.541	S	S	.	.	H	α-helix	trans	-60.4	-41.2	177.7	0	0	0	0	0	112	L18 K26	L18-A22 WeakPolarHBondContact O-CB 3.39Å; L18-A22 PolarHBondContact O-N 3.43Å; A22-K26 WeakPolarHBondContact O-CB 3.36Å; A22-K26 PolarHBondContact O-N 3.33Å
23	T	83.7	Confident	75.7	Confident	75 Å²	75	104.9 Å²	104.9	46%	0.46	55%	0.549	S	S	.	.	H	α-helix	trans	-66.7	-41.2	176.6	-56.8	0	0	0	0	111.5	A19 G20 I21 K26 R27	A19-T23 WeakPolarHBondContact O-CB 3.32Å; A19-T23 PolarHBondContact O-N 2.77Å; A19-T23 PolarHBondContact O-OG1 3.36Å; G20-T23 PolarHBondContact O-N 3.31Å; I21-T23 VanDerWaalsContact C-N 3.31Å; I21-T23 PolarHBondContact O-N 3.32Å; T23-K26 PolarHBondContact O-N 2.99Å; T23-R27 WeakPolarHBondContact O-CG 3.49Å; T23-R27 PolarHBondContact O-N 3.32Å
24	L	80.3	Confident	75.2	Confident	124 Å²	124	111.8 Å²	111.8	65%	0.649	57%	0.566	S	S	*	*	H	α-helix	trans	-67.2	-43.3	178.1	-163.6	71.5	0	0	0	111.6	G20 I21 K26 R27 A28	G20-L24 WeakPolarHBondContact O-CB 3.44Å; G20-L24 PolarHBondContact O-N 3.35Å; I21-L24 PolarHBondContact O-N 3.1Å; L24-K26 VanDerWaalsContact C-N 3.35Å; L24-K26 PolarHBondContact O-N 3.38Å; L24-R27 PolarHBondContact O-N 2.79Å; L24-A28 WeakPolarHBondContact O-CB 3.33Å; L24-A28 PolarHBondContact O-N 2.89Å
25	A	76.6	Confident	74.5	Confident	50 Å²	50	111.2 Å²	111.2	41%	0.413	56%	0.564	S	S	.	*	H	α-helix	trans	-60.1	-44.5	175.3	0	0	0	0	0	111.3	I21 R27 A28 Q29	I21-A25 WeakPolarHBondContact O-CB 3.19Å; I21-A25 PolarHBondContact O-N 3.17Å; A25-R27 VanDerWaalsContact C-N 3.35Å; A25-R27 PolarHBondContact O-N 3.45Å; A25-A28 PolarHBondContact O-N 3.5Å; A25-Q29 WeakPolarHBondContact O-CB 3.26Å; A25-Q29 PolarHBondContact O-N 2.82Å
26	K	72.7	Confident	73.9	Confident	144 Å²	144	113.1 Å²	113.1	63%	0.626	57%	0.574	S	S	*	*	H	α-helix	trans	-62.8	-40.1	175.7	-163.6	169.6	-174	176.6	0	111.7	A22 T23 L24 Q29 I30	A22-K26 WeakPolarHBondContact O-CB 3.36Å; A22-K26 PolarHBondContact O-N 3.33Å; T23-K26 PolarHBondContact O-N 2.99Å; L24-K26 VanDerWaalsContact C-N 3.35Å; L24-K26 PolarHBondContact O-N 3.38Å; K26-Q29 PolarHBondContact O-N 3.04Å; K26-I30 HydrophobicContact CG-CD1 4.29Å; K26-I30 VanDerWaalsContact O-CD1 3.23Å; K26-I30 WeakPolarHBondContact O-CD1 3.38Å; K26-I30 VanDerWaalsContact O-CG1 3.22Å; K26-I30 WeakPolarHBondContact O-CG1 3.18Å; K26-I30 PolarHBondContact O-N 3.16Å
27	R	69.8	Low	73.4	Confident	186 Å²	186	110.2 Å²	110.2	70%	0.702	56%	0.562	S	S	*	*	H	α-helix	trans	-65.8	-35.2	173.5	-74.7	179.1	-179.9	-103.4	2	112.9	T23 L24 A25 P31	T23-R27 WeakPolarHBondContact O-CG 3.49Å; T23-R27 PolarHBondContact O-N 3.32Å; L24-R27 PolarHBondContact O-N 2.79Å; A25-R27 VanDerWaalsContact C-N 3.35Å; A25-R27 PolarHBondContact O-N 3.45Å; R27-P31 WeakPolarHBondContact O-CD 3.25Å
28	A	61.7	Low	72.9	Confident	44 Å²	44	110.6 Å²	110.6	36%	0.364	57%	0.565	S	S	.	*	H	α-helix	trans	-77.2	-29.1	178	0	0	0	0	0	113.4	L24 A25	L24-A28 WeakPolarHBondContact O-CB 3.33Å; L24-A28 PolarHBondContact O-N 2.89Å; A25-A28 PolarHBondContact O-N 3.5Å
29	Q	60.2	Low	72.4	Confident	142 Å²	142	108.9 Å²	108.9	66%	0.664	56%	0.556	S	S	*	*	H	α-helix	trans	-70.9	-42.4	178.5	-109.3	175.9	-26.8	0	0	113	A25 K26 H33	A25-Q29 WeakPolarHBondContact O-CB 3.26Å; A25-Q29 PolarHBondContact O-N 2.82Å; K26-Q29 PolarHBondContact O-N 3.04Å; Q29-H33 PolarHBondContact O-N 3.47Å
30	I	59.5	Low	72	Confident	121 Å²	121	113.8 Å²	113.8	62%	0.621	56%	0.564	S	S	*	*	H	α-helix	trans	-61.8	-38.2	-171.5	-63.7	159.8	0	0	0	113.5	K26	K26-I30 HydrophobicContact CG-CD1 4.29Å; K26-I30 VanDerWaalsContact O-CD1 3.23Å; K26-I30 WeakPolarHBondContact O-CD1 3.38Å; K26-I30 VanDerWaalsContact O-CG1 3.22Å; K26-I30 WeakPolarHBondContact O-CG1 3.18Å; K26-I30 PolarHBondContact O-N 3.16Å
31	P	56.4	Low	71.5	Confident	80 Å²	80	118.7 Å²	118.7	52%	0.519	57%	0.574	S	S	.	*	H	α-helix	trans	-90.3	-31	178.4	19.8	-13.3	0	0	0	114.8	R27 Y35	R27-P31 WeakPolarHBondContact O-CD 3.25Å; P31-Y35 WeakPolarHBondContact O-CB 3.27Å; P31-Y35 PolarHBondContact O-N 3.37Å
32	R	56.7	Low	71.4	Confident	181 Å²	181	123.1 Å²	123.1	68%	0.683	58%	0.584	S	S	*	*	H	α-helix	trans	-75	-39.1	-173.9	-74.4	-169.5	-179.6	160.4	1.5	113.2	R34 Y35 L36	R32-R34 PolarHBondContact O-N 3.13Å; R32-Y35 PolarHBondContact O-N 3.35Å; R32-L36 WeakPolarHBondContact O-CB 3.21Å; R32-L36 VanDerWaalsContact O-CG 3.3Å; R32-L36 WeakPolarHBondContact O-CG 3.48Å; R32-L36 PolarHBondContact O-N 3.05Å
33	H	61.7	Low	71.4	Confident	139 Å²	139	124.2 Å²	124.2	64%	0.644	58%	0.581	S	S	*	*	H	α-helix	trans	-65.6	-42.8	179.5	-165.1	-52.7	0	0	0	111	Q29 Y35 T37	Q29-H33 PolarHBondContact O-N 3.47Å; H33-Y35 PolarHBondContact O-N 3.28Å; H33-T37 PolarHBondContact CE1-OG1 2.98Å; H33-T37 PolarHBondContact ND1-OG1 2.85Å; H33-T37 VanDerWaalsContact ND1-OG1 3.1Å; H33-T37 WeakPolarHBondContact O-CB 3.45Å; H33-T37 PolarHBondContact O-N 2.79Å; H33-T37 PolarHBondContact O-OG1 3.31Å
34	R	66.5	Low	71.4	Confident	211 Å²	211	124 Å²	124	80%	0.796	58%	0.577	S	S	*	*	H	α-helix	trans	-67.2	-39.6	-180	-160.1	177.2	-166.3	-175.5	3.8	112.2	R32 N38	R32-R34 PolarHBondContact O-N 3.13Å; R34-N38 VanDerWaalsContact O-CB 3.31Å; R34-N38 WeakPolarHBondContact O-CB 3.25Å; R34-N38 PolarHBondContact O-N 3.37Å
35	Y	67.6	Low	71.4	Confident	160 Å²	160	120 Å²	120	63%	0.627	56%	0.562	S	S	*	*	H	α-helix	trans	-67.8	-47.1	179.1	-171.1	-95.1	0	0	0	112	P31 R32 H33 N38 L39	P31-Y35 WeakPolarHBondContact O-CB 3.27Å; P31-Y35 PolarHBondContact O-N 3.37Å; R32-Y35 PolarHBondContact O-N 3.35Å; H33-Y35 PolarHBondContact O-N 3.28Å; Y35-N38 PolarHBondContact O-N 3.27Å; Y35-L39 HydrophobicContact CE1-CD1 3.86Å; Y35-L39 WeakPolarHBondContact O-CB 3.45Å; Y35-L39 PolarHBondContact O-N 2.79Å
36	L	70.6	Confident	71.6	Confident	111 Å²	111	123.9 Å²	123.9	58%	0.581	57%	0.569	S	S	*	*	H	α-helix	trans	-65.3	-42.4	179.1	-69.5	173.1	0	0	0	111.9	R32 N38 L39 Y40	R32-L36 WeakPolarHBondContact O-CB 3.21Å; R32-L36 VanDerWaalsContact O-CG 3.3Å; R32-L36 WeakPolarHBondContact O-CG 3.48Å; R32-L36 PolarHBondContact O-N 3.05Å; L36-N38 VanDerWaalsContact C-N 3.34Å; L36-N38 PolarHBondContact O-N 3.45Å; L36-L39 PolarHBondContact O-N 3.24Å; L36-Y40 VanDerWaalsContact O-CB 3.29Å; L36-Y40 WeakPolarHBondContact O-CB 3.14Å; L36-Y40 PolarHBondContact O-N 2.74Å
37	T	74.5	Confident	71.8	Confident	72 Å²	72	124.2 Å²	124.2	44%	0.442	57%	0.568	S	S	.	*	H	α-helix	trans	-63.1	-41.1	176.3	-55.9	0	0	0	0	111.6	H33 Y40 F41	H33-T37 PolarHBondContact CE1-OG1 2.98Å; H33-T37 PolarHBondContact ND1-OG1 2.85Å; H33-T37 VanDerWaalsContact ND1-OG1 3.1Å; H33-T37 WeakPolarHBondContact O-CB 3.45Å; H33-T37 PolarHBondContact O-N 2.79Å; H33-T37 PolarHBondContact O-OG1 3.31Å; T37-Y40 PolarHBondContact O-N 3.18Å; T37-F41 WeakPolarHBondContact O-CB 3.28Å; T37-F41 PolarHBondContact O-N 3.4Å
38	N	78	Confident	72.3	Confident	109 Å²	109	120.4 Å²	120.4	58%	0.583	56%	0.558	S	S	*	*	H	α-helix	trans	-67.7	-40.9	178.3	-166.9	24.6	0	0	0	112	R34 Y35 L36 F41 R42	R34-N38 VanDerWaalsContact O-CB 3.31Å; R34-N38 WeakPolarHBondContact O-CB 3.25Å; R34-N38 PolarHBondContact O-N 3.37Å; Y35-N38 PolarHBondContact O-N 3.27Å; L36-N38 VanDerWaalsContact C-N 3.34Å; L36-N38 PolarHBondContact O-N 3.45Å; N38-F41 PolarHBondContact O-N 3.41Å; N38-R42 WeakPolarHBondContact O-CB 3.47Å; N38-R42 PolarHBondContact O-N 2.95Å
39	L	77.3	Confident	73	Confident	80 Å²	80	125.6 Å²	125.6	42%	0.419	57%	0.572	S	S	.	*	H	α-helix	trans	-65	-42.4	177	-164.3	148.8	0	0	0	111.1	Y35 L36 R42 L43	Y35-L39 HydrophobicContact CE1-CD1 3.86Å; Y35-L39 WeakPolarHBondContact O-CB 3.45Å; Y35-L39 PolarHBondContact O-N 2.79Å; L36-L39 PolarHBondContact O-N 3.24Å; L39-R42 PolarHBondContact O-N 3.27Å; L39-L43 HydrophobicContact CD2-CD1 3.61Å; L39-L43 HydrophobicContact CD2-CG 4.24Å; L39-L43 WeakPolarHBondContact O-CG 3.49Å; L39-L43 PolarHBondContact O-N 3.44Å
40	Y	79.7	Confident	73.9	Confident	157 Å²	157	121.2 Å²	121.2	62%	0.616	55%	0.553	S	S	*	*	H	α-helix	trans	-62.5	-46	174.9	-176.2	-106.5	0	0	0	112.3	L36 T37 R42 L43 I44	L36-Y40 VanDerWaalsContact O-CB 3.29Å; L36-Y40 WeakPolarHBondContact O-CB 3.14Å; L36-Y40 PolarHBondContact O-N 2.74Å; T37-Y40 PolarHBondContact O-N 3.18Å; Y40-R42 VanDerWaalsContact C-N 3.33Å; Y40-R42 PolarHBondContact O-N 2.96Å; Y40-L43 PolarHBondContact O-N 3.38Å; Y40-I44 HydrophobicContact CD1-CD1 3.67Å; Y40-I44 HydrophobicContact CE1-CD1 3.14Å; Y40-I44 HydrophobicContact CE1-CG1 4.27Å; Y40-I44 HydrophobicContact CE2-CD1 4.13Å; Y40-I44 HydrophobicContact CG-CD1 4.36Å; Y40-I44 VanDerWaalsContact CZ-CD1 3.4Å; Y40-I44 PolarHBondContact O-N 2.89Å
41	F	79.5	Confident	74.7	Confident	144 Å²	144	120.4 Å²	120.4	63%	0.632	55%	0.55	S	S	*	.	H	α-helix	trans	-62.9	-40.3	177	-169.5	-96.3	0	0	0	111.9	T37 N38 I44 A45	T37-F41 WeakPolarHBondContact O-CB 3.28Å; T37-F41 PolarHBondContact O-N 3.4Å; N38-F41 PolarHBondContact O-N 3.41Å; F41-I44 PolarHBondContact O-N 3.48Å; F41-A45 VanDerWaalsContact O-CB 3.32Å; F41-A45 WeakPolarHBondContact O-CB 3.22Å; F41-A45 PolarHBondContact O-N 3.42Å
42	R	83.8	Confident	75.8	Confident	197 Å²	197	122.6 Å²	122.6	74%	0.743	55%	0.551	S	S	*	*	H	α-helix	trans	-65.4	-39	176.6	-167.3	174.5	-178.1	-175.4	0.2	112.1	N38 L39 Y40 F46	N38-R42 WeakPolarHBondContact O-CB 3.47Å; N38-R42 PolarHBondContact O-N 2.95Å; L39-R42 PolarHBondContact O-N 3.27Å; Y40-R42 VanDerWaalsContact C-N 3.33Å; Y40-R42 PolarHBondContact O-N 2.96Å; R42-F46 VanDerWaalsContact O-CB 3.28Å; R42-F46 WeakPolarHBondContact O-CB 3.49Å; R42-F46 PolarHBondContact O-N 2.94Å
43	L	83.3	Confident	76.8	Confident	81 Å²	81	119.8 Å²	119.8	42%	0.424	54%	0.544	S	S	.	.	H	α-helix	trans	-64.1	-49.6	173.9	-76.9	170.9	0	0	0	111.3	L39 Y40 A45 F46 Y47	L39-L43 HydrophobicContact CD2-CD1 3.61Å; L39-L43 HydrophobicContact CD2-CG 4.24Å; L39-L43 WeakPolarHBondContact O-CG 3.49Å; L39-L43 PolarHBondContact O-N 3.44Å; Y40-L43 PolarHBondContact O-N 3.38Å; L43-A45 VanDerWaalsContact C-N 3.33Å; L43-A45 PolarHBondContact O-N 2.92Å; L43-F46 WeakPolarHBondContact O-CB 3.34Å; L43-F46 PolarHBondContact O-N 2.91Å; L43-Y47 HydrophobicContact CB-CD2 4.49Å; L43-Y47 HydrophobicContact CD2-CE2 4.33Å; L43-Y47 WeakPolarHBondContact O-CB 3.45Å; L43-Y47 VanDerWaalsContact O-CD2 3.22Å; L43-Y47 WeakPolarHBondContact O-CD2 3.42Å; L43-Y47 PolarHBondContact O-N 3.43Å
44	I	82.4	Confident	77.5	Confident	72 Å²	72	118.5 Å²	118.5	37%	0.369	54%	0.541	S	S	.	.	H	α-helix	trans	-58.4	-46.5	177.3	-69.9	171.2	0	0	0	110.9	Y40 F41 F46 Y47 E48	Y40-I44 HydrophobicContact CD1-CD1 3.67Å; Y40-I44 HydrophobicContact CE1-CD1 3.14Å; Y40-I44 HydrophobicContact CE1-CG1 4.27Å; Y40-I44 HydrophobicContact CE2-CD1 4.13Å; Y40-I44 HydrophobicContact CG-CD1 4.36Å; Y40-I44 VanDerWaalsContact CZ-CD1 3.4Å; Y40-I44 PolarHBondContact O-N 2.89Å; F41-I44 PolarHBondContact O-N 3.48Å; I44-F46 VanDerWaalsContact C-N 3.28Å; I44-F46 PolarHBondContact O-N 3.37Å; I44-Y47 PolarHBondContact O-N 3.34Å; I44-E48 WeakPolarHBondContact O-CB 3.32Å; I44-E48 PolarHBondContact O-N 3.46Å
45	A	81	Confident	78	Confident	40 Å²	40	112.2 Å²	112.2	33%	0.331	53%	0.526	S	S	.	.	H	α-helix	trans	-64.9	-32.6	-180	0	0	0	0	0	112.9	F41 L43 K49	F41-A45 VanDerWaalsContact O-CB 3.32Å; F41-A45 WeakPolarHBondContact O-CB 3.22Å; F41-A45 PolarHBondContact O-N 3.42Å; L43-A45 VanDerWaalsContact C-N 3.33Å; L43-A45 PolarHBondContact O-N 2.92Å; A45-K49 WeakPolarHBondContact O-CG 3.39Å; A45-K49 PolarHBondContact O-N 3.49Å
46	F	80.3	Confident	78.4	Confident	130 Å²	130	108.5 Å²	108.5	57%	0.57	52%	0.52	S	S	*	.	H	α-helix	trans	-69.2	-51.9	173.4	-175.2	-99.1	0	0	0	110.7	R42 L43 I44 E48 K49 D50	R42-F46 VanDerWaalsContact O-CB 3.28Å; R42-F46 WeakPolarHBondContact O-CB 3.49Å; R42-F46 PolarHBondContact O-N 2.94Å; L43-F46 WeakPolarHBondContact O-CB 3.34Å; L43-F46 PolarHBondContact O-N 2.91Å; I44-F46 VanDerWaalsContact C-N 3.28Å; I44-F46 PolarHBondContact O-N 3.37Å; F46-E48 PolarHBondContact O-N 3.19Å; F46-K49 PolarHBondContact O-N 3.5Å; F46-D50 VanDerWaalsContact CE1-OD2 3.27Å; F46-D50 WeakPolarHBondContact CE1-OD2 3.31Å; F46-D50 VanDerWaalsContact CZ-OD2 3.25Å; F46-D50 WeakPolarHBondContact CZ-OD2 3.36Å; F46-D50 PolarHBondContact O-N 2.83Å; F46-D50 VanDerWaalsContact O-N 3.13Å
47	Y	77.7	Confident	78.7	Confident	152 Å²	152	111.5 Å²	111.5	60%	0.596	52%	0.524	S	S	*	.	H	α-helix	trans	-60	-42.6	177.6	-84.8	-71.1	0	0	0	112.5	L43 I44 K49 D50 L51	L43-Y47 HydrophobicContact CB-CD2 4.49Å; L43-Y47 HydrophobicContact CD2-CE2 4.33Å; L43-Y47 WeakPolarHBondContact O-CB 3.45Å; L43-Y47 VanDerWaalsContact O-CD2 3.22Å; L43-Y47 WeakPolarHBondContact O-CD2 3.42Å; L43-Y47 PolarHBondContact O-N 3.43Å; I44-Y47 PolarHBondContact O-N 3.34Å; Y47-K49 VanDerWaalsContact C-N 3.3Å; Y47-K49 PolarHBondContact O-N 3.47Å; Y47-D50 PolarHBondContact O-N 3.07Å; Y47-L51 WeakPolarHBondContact O-CB 3.32Å; Y47-L51 PolarHBondContact O-N 2.91Å
48	E	79.6	Confident	78.7	Confident	105 Å²	105	110.6 Å²	110.6	49%	0.491	52%	0.521	S	S	.	.	H	α-helix	trans	-62.6	-37.8	-179.5	-165.4	-168	141.4	0	0	112	I44 F46 K52	I44-E48 WeakPolarHBondContact O-CB 3.32Å; I44-E48 PolarHBondContact O-N 3.46Å; F46-E48 PolarHBondContact O-N 3.19Å; E48-K52 WeakPolarHBondContact O-CG 3.38Å; E48-K52 PolarHBondContact O-N 3.38Å; E48-K52 IonicContact OE1-NZ 2.74Å; E48-K52 PolarHBondContact OE1-NZ 3.17Å
49	K	76.4	Confident	78.9	Confident	153 Å²	153	108.2 Å²	108.2	67%	0.665	51%	0.511	S	S	*	.	H	α-helix	trans	-67.7	-44.4	176.3	-78.1	-176	179.4	-178.1	0	112	A45 F46 Y47 K53	A45-K49 WeakPolarHBondContact O-CG 3.39Å; A45-K49 PolarHBondContact O-N 3.49Å; F46-K49 PolarHBondContact O-N 3.5Å; Y47-K49 VanDerWaalsContact C-N 3.3Å; Y47-K49 PolarHBondContact O-N 3.47Å; K49-K53 PolarHBondContact O-N 2.99Å
50	D	79.2	Confident	78.9	Confident	50 Å²	50	109.2 Å²	109.2	27%	0.267	52%	0.515	S	S	.	.	H	α-helix	trans	-73.9	-34	-179.3	-74.3	-37.1	0	0	0	112	F46 Y47 K52 K53 I54	F46-D50 VanDerWaalsContact CE1-OD2 3.27Å; F46-D50 WeakPolarHBondContact CE1-OD2 3.31Å; F46-D50 VanDerWaalsContact CZ-OD2 3.25Å; F46-D50 WeakPolarHBondContact CZ-OD2 3.36Å; F46-D50 PolarHBondContact O-N 2.83Å; F46-D50 VanDerWaalsContact O-N 3.13Å; Y47-D50 PolarHBondContact O-N 3.07Å; D50-K52 PolarHBondContact O-N 3.36Å; D50-K53 CarbonylContact O-C 3.59Å; D50-K53 WeakPolarHBondContact O-CB 3.39Å; D50-K53 PolarHBondContact O-N 3.1Å; D50-K53 VanDerWaalsContact O-N 3.16Å; D50-I54 WeakPolarHBondContact O-CB 3.33Å; D50-I54 WeakPolarHBondContact O-CG1 3.02Å; D50-I54 PolarHBondContact O-N 2.98Å
51	L	76.6	Confident	78.7	Confident	105 Å²	105	105.1 Å²	105.1	55%	0.55	51%	0.508	S	S	.	.	H	α-helix	trans	-67.5	-39.6	179.4	-153.7	147.6	0	0	0	111.3	Y47 K53 I54 V55	Y47-L51 WeakPolarHBondContact O-CB 3.32Å; Y47-L51 PolarHBondContact O-N 2.91Å; L51-K53 VanDerWaalsContact C-N 3.33Å; L51-K53 PolarHBondContact O-N 3Å; L51-I54 PolarHBondContact O-N 3.47Å; L51-V55 HydrophobicContact CD2-CG2 3.98Å; L51-V55 WeakPolarHBondContact O-CB 3.29Å; L51-V55 VanDerWaalsContact O-CG2 3.25Å; L51-V55 WeakPolarHBondContact O-CG2 3.3Å; L51-V55 PolarHBondContact O-N 3.4Å
52	K	79.1	Confident	78.7	Confident	125 Å²	125	103.9 Å²	103.9	54%	0.543	50%	0.504	S	S	.	.	H	α-helix	trans	-58.7	-45	170.5	-75	175.4	-172.5	164.6	0	111.5	E48 D50 V55 T56	E48-K52 WeakPolarHBondContact O-CG 3.38Å; E48-K52 PolarHBondContact O-N 3.38Å; E48-K52 IonicContact OE1-NZ 2.74Å; E48-K52 PolarHBondContact OE1-NZ 3.17Å; D50-K52 PolarHBondContact O-N 3.36Å; K52-V55 PolarHBondContact O-N 2.87Å; K52-T56 PolarHBondContact O-N 3.47Å; K52-T56 PolarHBondContact O-OG1 3.22Å; K52-T56 VanDerWaalsContact O-OG1 3.04Å
53	K	77.7	Confident	78.6	Confident	122 Å²	122	99.3 Å²	99.3	53%	0.53	49%	0.494	S	S	.	.	H	α-helix	trans	-62.5	-47.5	176.2	-70.1	177.7	-176.7	175.1	0	111.5	K49 D50 L51 V55 T56 Y57	K49-K53 PolarHBondContact O-N 2.99Å; D50-K53 CarbonylContact O-C 3.59Å; D50-K53 WeakPolarHBondContact O-CB 3.39Å; D50-K53 PolarHBondContact O-N 3.1Å; D50-K53 VanDerWaalsContact O-N 3.16Å; L51-K53 VanDerWaalsContact C-N 3.33Å; L51-K53 PolarHBondContact O-N 3Å; K53-V55 VanDerWaalsContact C-N 3.32Å; K53-V55 PolarHBondContact O-N 2.86Å; K53-T56 PolarHBondContact O-N 3.46Å; K53-Y57 HydrophobicContact CB-CD2 4.3Å; K53-Y57 WeakPolarHBondContact O-CB 3.44Å; K53-Y57 WeakPolarHBondContact O-CD2 3.36Å; K53-Y57 PolarHBondContact O-N 3.21Å
54	I	75.8	Confident	78.6	Confident	113 Å²	113	98.1 Å²	98.1	58%	0.579	50%	0.495	S	S	*	.	H	α-helix	trans	-60.4	-43	-179.6	-69.2	162.3	0	0	0	110.6	D50 L51 Y57 S58	D50-I54 WeakPolarHBondContact O-CB 3.33Å; D50-I54 WeakPolarHBondContact O-CG1 3.02Å; D50-I54 PolarHBondContact O-N 2.98Å; L51-I54 PolarHBondContact O-N 3.47Å; I54-Y57 CarbonylContact O-C 3.56Å; I54-Y57 PolarHBondContact O-N 3.31Å; I54-S58 WeakPolarHBondContact O-CB 3.23Å; I54-S58 PolarHBondContact O-N 3.46Å
55	V	77.3	Confident	78.8	Confident	79 Å²	79	99.6 Å²	99.6	48%	0.479	50%	0.503	S	S	.	.	H	α-helix	trans	-62.9	-46	176.8	171.6	0	0	0	0	110.7	L51 K52 K53 S58 T59	L51-V55 HydrophobicContact CD2-CG2 3.98Å; L51-V55 WeakPolarHBondContact O-CB 3.29Å; L51-V55 VanDerWaalsContact O-CG2 3.25Å; L51-V55 WeakPolarHBondContact O-CG2 3.3Å; L51-V55 PolarHBondContact O-N 3.4Å; K52-V55 PolarHBondContact O-N 2.87Å; K53-V55 VanDerWaalsContact C-N 3.32Å; K53-V55 PolarHBondContact O-N 2.86Å; V55-S58 WeakPolarHBondContact O-CB 3.22Å; V55-S58 PolarHBondContact O-N 3Å; V55-S58 VanDerWaalsContact O-N 3.17Å; V55-T59 PolarHBondContact O-N 3.4Å; V55-T59 VanDerWaalsContact O-N 3.1Å
56	T	76.1	Confident	79.1	Confident	82 Å²	82	101.6 Å²	101.6	50%	0.503	51%	0.511	S	S	.	.	H	α-helix	trans	-64.6	-40	175.7	-52.8	0	0	0	0	112.3	K52 K53 S58 T59 I60	K52-T56 PolarHBondContact O-N 3.47Å; K52-T56 PolarHBondContact O-OG1 3.22Å; K52-T56 VanDerWaalsContact O-OG1 3.04Å; K53-T56 PolarHBondContact O-N 3.46Å; T56-S58 PolarHBondContact O-N 2.82Å; T56-T59 PolarHBondContact O-N 2.94Å; T56-T59 PolarHBondContact O-OG1 2.91Å; T56-I60 HydrophobicContact CG2-CD1 4.27Å; T56-I60 WeakPolarHBondContact O-CG1 3.42Å; T56-I60 PolarHBondContact O-N 2.89Å
57	Y	76.7	Confident	79.5	Confident	173 Å²	173	100 Å²	100	68%	0.678	51%	0.508	S	S	*	.	H	α-helix	trans	-68.5	-22	174.8	-86.9	-68.3	0	0	0	113	K53 I54 P61	K53-Y57 HydrophobicContact CB-CD2 4.3Å; K53-Y57 WeakPolarHBondContact O-CB 3.44Å; K53-Y57 WeakPolarHBondContact O-CD2 3.36Å; K53-Y57 PolarHBondContact O-N 3.21Å; I54-Y57 CarbonylContact O-C 3.56Å; I54-Y57 PolarHBondContact O-N 3.31Å; Y57-P61 WeakPolarHBondContact O-CD 3.37Å; Y57-P61 WeakPolarHBondContact O-CG 3.35Å
58	S	76.2	Confident	80	Confident	54 Å²	54	99.5 Å²	99.5	38%	0.378	51%	0.509	S	S	.	.	H	α-helix	trans	-80.6	-34.6	174.6	-177.1	0	0	0	0	112	I54 V55 T56 P61 Q62	I54-S58 WeakPolarHBondContact O-CB 3.23Å; I54-S58 PolarHBondContact O-N 3.46Å; V55-S58 WeakPolarHBondContact O-CB 3.22Å; V55-S58 PolarHBondContact O-N 3Å; V55-S58 VanDerWaalsContact O-N 3.17Å; T56-S58 PolarHBondContact O-N 2.82Å; S58-P61 WeakPolarHBondContact O-CD 3.34Å; S58-P61 WeakPolarHBondContact O-CG 3.33Å; S58-Q62 VanDerWaalsContact O-CG 3.26Å; S58-Q62 WeakPolarHBondContact O-CG 3.45Å
59	T	80.6	Confident	80.5	Confident	59 Å²	59	99.2 Å²	99.2	36%	0.362	51%	0.51	S	S	.	.	H	α-helix	trans	-75.2	-35.8	-178.5	53.6	0	0	0	0	112.7	V55 T56 Q62 I63	V55-T59 PolarHBondContact O-N 3.4Å; V55-T59 VanDerWaalsContact O-N 3.1Å; T56-T59 PolarHBondContact O-N 2.94Å; T56-T59 PolarHBondContact O-OG1 2.91Å; T59-Q62 PolarHBondContact O-N 3.4Å; T59-I63 WeakPolarHBondContact O-CG1 3.32Å; T59-I63 PolarHBondContact O-N 3.46Å
60	I	78.7	Confident	81	Confident	100 Å²	100	97.4 Å²	97.4	51%	0.513	51%	0.506	S	S	.	.	H	α-helix	trans	-56.8	-53.3	178.4	-65.5	165.4	0	0	0	113.1	T56 Q62 I63 A64	T56-I60 HydrophobicContact CG2-CD1 4.27Å; T56-I60 WeakPolarHBondContact O-CG1 3.42Å; T56-I60 PolarHBondContact O-N 2.89Å; I60-Q62 VanDerWaalsContact C-N 3.31Å; I60-Q62 PolarHBondContact O-N 3.18Å; I60-I63 PolarHBondContact O-N 2.87Å; I60-A64 WeakPolarHBondContact O-CB 3.3Å; I60-A64 PolarHBondContact O-N 3.49Å
61	P	74.6	Confident	81.2	Confident	72 Å²	72	104.6 Å²	104.6	47%	0.468	53%	0.531	S	S	.	.	H	α-helix	trans	-69.1	-29.2	179.8	27.2	-34.8	0	0	0	112.3	Y57 S58 A64 L65	Y57-P61 WeakPolarHBondContact O-CD 3.37Å; Y57-P61 WeakPolarHBondContact O-CG 3.35Å; S58-P61 WeakPolarHBondContact O-CD 3.34Å; S58-P61 WeakPolarHBondContact O-CG 3.33Å; P61-A64 PolarHBondContact O-N 2.75Å; P61-L65 WeakPolarHBondContact O-CB 3.44Å; P61-L65 PolarHBondContact O-N 2.89Å
62	Q	80.1	Confident	81.6	Confident	117 Å²	117	104.4 Å²	104.4	55%	0.547	53%	0.534	S	S	.	.	H	α-helix	trans	-64.3	-46.8	173.8	-73.3	175.1	-6.2	0	0	111.2	S58 T59 I60 L65 V66	S58-Q62 VanDerWaalsContact O-CG 3.26Å; S58-Q62 WeakPolarHBondContact O-CG 3.45Å; T59-Q62 PolarHBondContact O-N 3.4Å; I60-Q62 VanDerWaalsContact C-N 3.31Å; I60-Q62 PolarHBondContact O-N 3.18Å; Q62-L65 PolarHBondContact O-N 3.32Å; Q62-V66 WeakPolarHBondContact O-CG2 3.5Å; Q62-V66 PolarHBondContact O-N 3.42Å
63	I	81.6	Confident	80.8	Confident	102 Å²	102	109.7 Å²	109.7	52%	0.523	56%	0.557	S	S	.	*	H	α-helix	trans	-64.5	-42.4	176.5	-63.8	163.6	0	0	0	110.4	T59 I60 L65 V66 I67	T59-I63 WeakPolarHBondContact O-CG1 3.32Å; T59-I63 PolarHBondContact O-N 3.46Å; I60-I63 PolarHBondContact O-N 2.87Å; I63-L65 VanDerWaalsContact C-N 3.34Å; I63-L65 PolarHBondContact O-N 3.01Å; I63-V66 PolarHBondContact O-N 3.41Å; I63-I67 HydrophobicContact CG2-CD1 4.02Å; I63-I67 WeakPolarHBondContact O-CG1 3.26Å; I63-I67 PolarHBondContact O-N 3.09Å
64	A	82.3	Confident	81	Confident	55 Å²	55	109.1 Å²	109.1	46%	0.455	56%	0.558	S	S	.	*	H	α-helix	trans	-61.3	-41.9	177.6	0	0	0	0	0	112.3	I60 P61 I67 F68	I60-A64 WeakPolarHBondContact O-CB 3.3Å; I60-A64 PolarHBondContact O-N 3.49Å; P61-A64 PolarHBondContact O-N 2.75Å; A64-I67 PolarHBondContact O-N 3.49Å; A64-F68 WeakPolarHBondContact O-CB 3.42Å; A64-F68 PolarHBondContact O-N 2.88Å
65	L	86.9	Confident	81.2	Confident	104 Å²	104	108.9 Å²	108.9	55%	0.545	56%	0.557	S	S	.	*	H	α-helix	trans	-65.6	-40.9	177.5	-171.9	151.9	0	0	0	111.4	P61 Q62 I63 F68 I69	P61-L65 WeakPolarHBondContact O-CB 3.44Å; P61-L65 PolarHBondContact O-N 2.89Å; Q62-L65 PolarHBondContact O-N 3.32Å; I63-L65 VanDerWaalsContact C-N 3.34Å; I63-L65 PolarHBondContact O-N 3.01Å; L65-F68 PolarHBondContact O-N 2.95Å; L65-I69 HydrophobicContact CD2-CD1 3.49Å; L65-I69 VanDerWaalsContact CD2-CD1 3.49Å; L65-I69 HydrophobicContact CD2-CG1 4.26Å; L65-I69 WeakPolarHBondContact O-CG1 3.11Å; L65-I69 PolarHBondContact O-N 3.45Å
66	V	87.1	Confident	81.5	Confident	81 Å²	81	110.6 Å²	110.6	49%	0.491	56%	0.562	S	S	.	*	H	α-helix	trans	-61.4	-44.8	175.5	171.6	0	0	0	0	111.3	Q62 I63 F68 I69 I70	Q62-V66 WeakPolarHBondContact O-CG2 3.5Å; Q62-V66 PolarHBondContact O-N 3.42Å; I63-V66 PolarHBondContact O-N 3.41Å; V66-F68 VanDerWaalsContact C-N 3.35Å; V66-F68 PolarHBondContact O-N 3.42Å; V66-I69 PolarHBondContact O-N 3.34Å; V66-I70 HydrophobicContact CG1-CD1 3.99Å; V66-I70 WeakPolarHBondContact O-CG1 3.44Å; V66-I70 PolarHBondContact O-N 2.93Å; V66-I70 VanDerWaalsContact O-N 3.15Å
67	I	88.8	Confident	81.8	Confident	97 Å²	97	112.2 Å²	112.2	50%	0.497	57%	0.565	S	S	.	*	H	α-helix	trans	-62.5	-43.1	176.9	-65.7	167.1	0	0	0	110.8	I63 A64 I69 I70 Y71	I63-I67 HydrophobicContact CG2-CD1 4.02Å; I63-I67 WeakPolarHBondContact O-CG1 3.26Å; I63-I67 PolarHBondContact O-N 3.09Å; A64-I67 PolarHBondContact O-N 3.49Å; I67-I69 PolarHBondContact O-N 2.96Å; I67-I70 PolarHBondContact O-N 3.32Å; I67-Y71 PolarHBondContact O-N 3.28Å
68	F	89.1	Confident	82.1	Confident	142 Å²	142	108.4 Å²	108.4	62%	0.623	56%	0.558	S	S	*	*	H	α-helix	trans	-60.7	-41.6	178.8	-176.5	-97.4	0	0	0	112.6	A64 L65 V66 Y71 T72	A64-F68 WeakPolarHBondContact O-CB 3.42Å; A64-F68 PolarHBondContact O-N 2.88Å; L65-F68 PolarHBondContact O-N 2.95Å; V66-F68 VanDerWaalsContact C-N 3.35Å; V66-F68 PolarHBondContact O-N 3.42Å; F68-Y71 PolarHBondContact O-N 3.2Å; F68-T72 WeakPolarHBondContact O-CB 3.46Å; F68-T72 PolarHBondContact O-N 3.49Å; F68-T72 VanDerWaalsContact O-N 3.08Å; F68-T72 PolarHBondContact O-OG1 3.5Å
69	I	89.9	Confident	82.5	Confident	99 Å²	99	112.1 Å²	112.1	51%	0.508	57%	0.57	S	S	.	*	H	α-helix	trans	-64.6	-40.6	176	-68.5	174.3	0	0	0	111.3	L65 V66 I67 K73	L65-I69 HydrophobicContact CD2-CD1 3.49Å; L65-I69 VanDerWaalsContact CD2-CD1 3.49Å; L65-I69 HydrophobicContact CD2-CG1 4.26Å; L65-I69 WeakPolarHBondContact O-CG1 3.11Å; L65-I69 PolarHBondContact O-N 3.45Å; V66-I69 PolarHBondContact O-N 3.34Å; I67-I69 PolarHBondContact O-N 2.96Å; I69-K73 PolarHBondContact O-N 3.42Å
70	I	87.6	Confident	82.6	Confident	115 Å²	115	115.9 Å²	115.9	59%	0.59	59%	0.585	S	S	*	*	H	α-helix	trans	-67.6	-39.6	179.5	-66.9	167.4	0	0	0	111.3	V66 I67	V66-I70 HydrophobicContact CG1-CD1 3.99Å; V66-I70 WeakPolarHBondContact O-CG1 3.44Å; V66-I70 PolarHBondContact O-N 2.93Å; V66-I70 VanDerWaalsContact O-N 3.15Å; I67-I70 PolarHBondContact O-N 3.32Å
71	Y	83.4	Confident	82.9	Confident	201 Å²	201	117.1 Å²	117.1	79%	0.788	59%	0.591	S	S	*	*	H	α-helix	trans	-78.5	-25	-177.3	-122.3	-86.4	0	0	0	114.1	I67 F68 K73	I67-Y71 PolarHBondContact O-N 3.28Å; F68-Y71 PolarHBondContact O-N 3.2Å; Y71-K73 VanDerWaalsContact C-N 3.34Å
72	T	84.4	Confident	83.6	Confident	100 Å²	100	120.8 Å²	120.8	61%	0.613	60%	0.601	S	S	*	*	H	α-helix	trans	-84.4	-12.7	179.6	-54.4	0	0	0	0	112.2	F68	F68-T72 WeakPolarHBondContact O-CB 3.46Å; F68-T72 PolarHBondContact O-N 3.49Å; F68-T72 VanDerWaalsContact O-N 3.08Å; F68-T72 PolarHBondContact O-OG1 3.5Å
73	K	62.2	Low	83.9	Confident	237 Å²	237	121.2 Å²	121.2	100%	1.03	61%	0.606	S	S	*	*			trans	-98.8	0	178.9	-171.7	175.7	-178.9	175.1	0	111.1	I69 Y71	I69-K73 PolarHBondContact O-N 3.42Å; Y71-K73 VanDerWaalsContact C-N 3.34Å

Retrieved 73 of 73 residues in 97.4 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).