A0A077ZR09_TRITR Loading...

DnaJ domain containing protein

AlphaFold DB , UniProt , Accession A0A077ZR09, Species TRITR (Trichuris trichiura, Whipworm), Gene n/a, Length 84 aa.

						>A0A077ZR09_TRITR|A0A077ZR09
MHPDKTGNTRKWYHSWEQMNMIIVADAHFAALSQAKEVLSDPEKRKAYNAWRRCPTFMSFEEWLLRKDFIGMVNDLLYSFFVYA
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	53.6	Low	65.3	Low	234 Å²	234	124.1 Å²	124.1	100%	1.153	64%	0.636	S	S	*	*				0	103.9	0	-79.8	172.1	170.1	0	0	108.3
2	H	61.2	Low	66.4	Low	119 Å²	119	119.8 Å²	119.8	55%	0.551	61%	0.606	S	S	*	*	P	Polyproline II helix	trans	-75.3	131.7	167.5	-177.5	-73.9	0	0	0	107.2	D4 W12	H2-D4 PolarHBondContact O-N 2.93Å; H2-W12 AromaticContact CD2-CH2 3.68Å; H2-W12 AromaticContact CD2-CZ3 3.81Å
3	P	60.6	Low	67.5	Low	28 Å²	28	119.4 Å²	119.4	18%	0.182	59%	0.594	C	S	.	*	P	Polyproline II helix	trans	-65.9	124.7	178.4	29.1	-35.2	0	0	0	107.5	W12	P3-W12 HydrophobicContact CB-CG 4.5Å; P3-W12 VanDerWaalsContact CD-CD1 3.41Å; P3-W12 HydrophobicContact CG-CB 3.52Å; P3-W12 HydrophobicContact CG-CD2 3.7Å; P3-W12 HydrophobicContact CG-CE3 4.26Å; P3-W12 HydrophobicContact CG-CG 3.34Å
4	D	60.4	Low	68.7	Low	120 Å²	120	118.1 Å²	118.1	64%	0.642	59%	0.586	S	S	*	*	P	Polyproline II helix	trans	-67.4	171.7	169.7	76.5	35.1	0	0	0	110.3	H2 T6	H2-D4 PolarHBondContact O-N 2.93Å; D4-T6 PolarHBondContact O-N 2.9Å; D4-T6 PolarHBondContact O-OG1 3.45Å; D4-T6 VanDerWaalsContact O-OG1 3.1Å
5	K	64.5	Low	69.8	Low	212 Å²	212	113.5 Å²	113.5	92%	0.922	57%	0.569	S	S	*	*	S	Bend	trans	-40	8.1	-168.7	-58	-177.7	179.7	-179.2	0	119.6
6	T	58.9	Low	70.7	Confident	77 Å²	77	114.3 Å²	114.3	47%	0.472	56%	0.564	S	S	.	*	S	Bend	trans	-64.3	141.6	163.8	63.3	0	0	0	0	110.3	D4 N8	D4-T6 PolarHBondContact O-N 2.9Å; D4-T6 PolarHBondContact O-OG1 3.45Å; D4-T6 VanDerWaalsContact O-OG1 3.1Å; T6-N8 PolarHBondContact O-N 3.2Å
7	G	63.6	Low	71.8	Confident	85 Å²	85	113.2 Å²	113.2	88%	0.876	56%	0.557	S	S	*	*	T	Hydrogen-bonded Turn	trans	-61.1	16.4	-179.1	0	0	0	0	0	116.2	T9	G7-T9 VanDerWaalsContact C-N 3.33Å
8	N	68.3	Low	72.7	Confident	80 Å²	80	114.3 Å²	114.3	43%	0.428	56%	0.56	S	S	.	*	T	Hydrogen-bonded Turn	trans	-87.5	3.6	176.2	-158.5	16.5	0	0	0	113.4	T6 R10 K11 W12	T6-N8 PolarHBondContact O-N 3.2Å; N8-R10 VanDerWaalsContact C-N 3.31Å; N8-R10 PolarHBondContact O-N 3.32Å; N8-K11 PolarHBondContact O-N 2.89Å; N8-K11 WeakPolarHBondContact OD1-CB 3.18Å; N8-K11 WeakPolarHBondContact OD1-CD 3.23Å; N8-W12 PolarHBondContact O-N 2.86Å
9	T	70.5	Confident	73.5	Confident	58 Å²	58	114.4 Å²	114.4	36%	0.356	56%	0.561	S	S	.	*	H	α-helix	trans	-54.6	-44.3	-179.1	53.5	0	0	0	0	112.1	G7 K11 W12 Y13	G7-T9 VanDerWaalsContact C-N 3.33Å; T9-K11 PolarHBondContact O-N 3.45Å; T9-W12 PolarHBondContact O-N 2.91Å; T9-Y13 VanDerWaalsContact O-CD2 3.25Å; T9-Y13 WeakPolarHBondContact O-CD2 3.2Å; T9-Y13 PolarHBondContact O-N 2.91Å
10	R	76.9	Confident	74.3	Confident	192 Å²	192	112 Å²	112	73%	0.725	55%	0.551	S	S	*	*	H	α-helix	trans	-60.2	-43.6	-178.9	-170.6	-177.4	-64.1	162.4	-0.3	113.3	N8 W12 Y13 H14	N8-R10 VanDerWaalsContact C-N 3.31Å; N8-R10 PolarHBondContact O-N 3.32Å; R10-W12 VanDerWaalsContact C-N 3.32Å; R10-Y13 PolarHBondContact O-N 3.46Å; R10-H14 PolarHBondContact O-CD2 3.36Å; R10-H14 PolarHBondContact O-N 3.47Å; R10-H14 VanDerWaalsContact O-N 3.12Å
11	K	80.6	Confident	75.1	Confident	160 Å²	160	112.7 Å²	112.7	70%	0.696	55%	0.554	S	S	*	*	H	α-helix	trans	-66.4	-38.2	178.3	-67.9	-171.9	179.4	177.7	0	111.2	N8 T9 S15	N8-K11 PolarHBondContact O-N 2.89Å; N8-K11 WeakPolarHBondContact OD1-CB 3.18Å; N8-K11 WeakPolarHBondContact OD1-CD 3.23Å; T9-K11 PolarHBondContact O-N 3.45Å; K11-S15 WeakPolarHBondContact O-CB 3.38Å; K11-S15 PolarHBondContact O-N 3.25Å
12	W	78.2	Confident	76.9	Confident	72 Å²	72	107.1 Å²	107.1	27%	0.273	53%	0.528	S	S	.	.	H	α-helix	trans	-67.4	-42.9	176.7	-176.8	87.8	0	0	0	112.7	H2 P3 N8 T9 R10 H14 S15 W16	H2-W12 AromaticContact CD2-CH2 3.68Å; H2-W12 AromaticContact CD2-CZ3 3.81Å; P3-W12 HydrophobicContact CB-CG 4.5Å; P3-W12 VanDerWaalsContact CD-CD1 3.41Å; P3-W12 HydrophobicContact CG-CB 3.52Å; P3-W12 HydrophobicContact CG-CD2 3.7Å; P3-W12 HydrophobicContact CG-CE3 4.26Å; P3-W12 HydrophobicContact CG-CG 3.34Å; N8-W12 PolarHBondContact O-N 2.86Å; T9-W12 PolarHBondContact O-N 2.91Å; R10-W12 VanDerWaalsContact C-N 3.32Å; W12-H14 PolarHBondContact O-N 3.35Å; W12-S15 PolarHBondContact O-N 3.35Å; W12-W16 HydrophobicContact CH2-CG 4.32Å; W12-W16 HydrophobicContact CZ3-CB 4.46Å; W12-W16 WeakPolarHBondContact O-CB 3.38Å; W12-W16 PolarHBondContact O-N 3.3Å
13	Y	80.5	Confident	78.2	Confident	115 Å²	115	106.8 Å²	106.8	45%	0.451	53%	0.529	S	S	.	.	H	α-helix	trans	-57.2	-49.5	174.5	-90.5	-79.1	0	0	0	111.2	T9 R10 S15 W16 E17	T9-Y13 VanDerWaalsContact O-CD2 3.25Å; T9-Y13 WeakPolarHBondContact O-CD2 3.2Å; T9-Y13 PolarHBondContact O-N 2.91Å; R10-Y13 PolarHBondContact O-N 3.46Å; Y13-S15 VanDerWaalsContact C-N 3.34Å; Y13-S15 PolarHBondContact O-N 3.48Å; Y13-W16 PolarHBondContact O-N 3.01Å; Y13-E17 WeakPolarHBondContact O-CB 3.43Å; Y13-E17 WeakPolarHBondContact O-CG 3.5Å; Y13-E17 PolarHBondContact O-N 3.43Å
14	H	84.1	Confident	79.7	Confident	102 Å²	102	108.2 Å²	108.2	47%	0.472	54%	0.537	S	S	.	.	H	α-helix	trans	-61.4	-40.1	176.1	-76.2	-48.6	0	0	0	113.1	R10 W12 W16 E17 Q18	R10-H14 PolarHBondContact O-CD2 3.36Å; R10-H14 PolarHBondContact O-N 3.47Å; R10-H14 VanDerWaalsContact O-N 3.12Å; W12-H14 PolarHBondContact O-N 3.35Å; H14-W16 VanDerWaalsContact C-N 3.35Å; H14-E17 IonicContact ND1-OE2 3.32Å; H14-E17 PolarHBondContact ND1-OE2 2.98Å; H14-Q18 WeakPolarHBondContact O-CB 3.44Å; H14-Q18 VanDerWaalsContact O-CG 3.3Å; H14-Q18 WeakPolarHBondContact O-CG 3.23Å; H14-Q18 PolarHBondContact O-N 2.91Å
15	S	85.7	Confident	81.2	Confident	49 Å²	49	105.2 Å²	105.2	34%	0.343	53%	0.529	S	S	.	.	H	α-helix	trans	-64.3	-40.6	175.2	-176.7	0	0	0	0	111.9	K11 W12 Y13 Q18 M19	K11-S15 WeakPolarHBondContact O-CB 3.38Å; K11-S15 PolarHBondContact O-N 3.25Å; W12-S15 PolarHBondContact O-N 3.35Å; Y13-S15 VanDerWaalsContact C-N 3.34Å; Y13-S15 PolarHBondContact O-N 3.48Å; S15-Q18 PolarHBondContact O-N 2.64Å; S15-M19 WeakPolarHBondContact O-CG 3.28Å; S15-M19 PolarHBondContact O-N 2.89Å
16	W	84.5	Confident	82.4	Confident	126 Å²	126	100.3 Å²	100.3	48%	0.477	51%	0.513	S	S	.	.	H	α-helix	trans	-68.3	-42.5	178.6	179	84.4	0	0	0	111.3	W12 Y13 H14 Q18 M19 N20	W12-W16 HydrophobicContact CH2-CG 4.32Å; W12-W16 HydrophobicContact CZ3-CB 4.46Å; W12-W16 WeakPolarHBondContact O-CB 3.38Å; W12-W16 PolarHBondContact O-N 3.3Å; Y13-W16 PolarHBondContact O-N 3.01Å; H14-W16 VanDerWaalsContact C-N 3.35Å; W16-Q18 PolarHBondContact O-N 2.86Å; W16-M19 PolarHBondContact O-N 3.38Å; W16-N20 VanDerWaalsContact O-CB 3.31Å; W16-N20 WeakPolarHBondContact O-CB 3.46Å; W16-N20 PolarHBondContact O-N 3.3Å
17	E	88.1	Confident	83.9	Confident	95 Å²	95	99.5 Å²	99.5	44%	0.444	51%	0.514	S	S	.	.	H	α-helix	trans	-58.5	-46.7	173	-74.9	174.8	158.9	0	0	111.2	Y13 H14 M19 N20 M21	Y13-E17 WeakPolarHBondContact O-CB 3.43Å; Y13-E17 WeakPolarHBondContact O-CG 3.5Å; Y13-E17 PolarHBondContact O-N 3.43Å; H14-E17 IonicContact ND1-OE2 3.32Å; H14-E17 PolarHBondContact ND1-OE2 2.98Å; E17-M19 PolarHBondContact O-N 2.93Å; E17-N20 PolarHBondContact O-N 2.9Å; E17-M21 WeakPolarHBondContact O-CB 3.4Å; E17-M21 VanDerWaalsContact O-CG 3.24Å; E17-M21 WeakPolarHBondContact O-CG 3.27Å; E17-M21 PolarHBondContact O-N 2.93Å
18	Q	88.1	Confident	85.2	Confident	133 Å²	133	101.2 Å²	101.2	62%	0.621	50%	0.499	S	S	*	.	H	α-helix	trans	-61	-45.1	176.6	-75.2	178.5	-0.9	0	0	112.2	H14 S15 W16 M21 I22	H14-Q18 WeakPolarHBondContact O-CB 3.44Å; H14-Q18 VanDerWaalsContact O-CG 3.3Å; H14-Q18 WeakPolarHBondContact O-CG 3.23Å; H14-Q18 PolarHBondContact O-N 2.91Å; S15-Q18 PolarHBondContact O-N 2.64Å; W16-Q18 PolarHBondContact O-N 2.86Å; Q18-M21 PolarHBondContact O-N 3.38Å; Q18-I22 WeakPolarHBondContact O-CG1 3.43Å; Q18-I22 PolarHBondContact O-N 3.4Å
19	M	88.8	Confident	86.3	Confident	116 Å²	116	104.1 Å²	104.1	57%	0.571	51%	0.508	S	S	*	.	H	α-helix	trans	-61.9	-44.8	175.4	-74.5	178.9	-175	0	0	111.7	S15 W16 E17 M21 I22 I23	S15-M19 WeakPolarHBondContact O-CG 3.28Å; S15-M19 PolarHBondContact O-N 2.89Å; W16-M19 PolarHBondContact O-N 3.38Å; E17-M19 PolarHBondContact O-N 2.93Å; M19-M21 VanDerWaalsContact C-N 3.33Å; M19-M21 PolarHBondContact O-N 3.32Å; M19-I22 PolarHBondContact O-N 3.37Å; M19-I23 VanDerWaalsContact O-CG1 3.3Å; M19-I23 WeakPolarHBondContact O-CG1 3.46Å; M19-I23 PolarHBondContact O-N 3.47Å
20	N	89.9	Confident	87.2	Confident	67 Å²	67	103.5 Å²	103.5	36%	0.358	51%	0.509	S	S	.	.	H	α-helix	trans	-62.8	-41.1	178.6	-171	66	0	0	0	111.4	W16 E17 I22 I23 V24	W16-N20 VanDerWaalsContact O-CB 3.31Å; W16-N20 WeakPolarHBondContact O-CB 3.46Å; W16-N20 PolarHBondContact O-N 3.3Å; E17-N20 PolarHBondContact O-N 2.9Å; N20-I22 VanDerWaalsContact C-N 3.34Å; N20-I22 PolarHBondContact O-N 3.42Å; N20-I23 PolarHBondContact O-N 3.4Å; N20-V24 WeakPolarHBondContact O-CB 3.47Å; N20-V24 VanDerWaalsContact O-CG2 3.25Å; N20-V24 WeakPolarHBondContact O-CG2 3.29Å; N20-V24 PolarHBondContact O-N 3.19Å
21	M	90	Very high	87.6	Confident	127 Å²	127	96.8 Å²	96.8	63%	0.626	50%	0.495	S	S	*	.	H	α-helix	trans	-61.4	-41	174.5	-74.5	-60.2	-61.8	0	0	112.3	E17 Q18 M19 A25	E17-M21 WeakPolarHBondContact O-CB 3.4Å; E17-M21 VanDerWaalsContact O-CG 3.24Å; E17-M21 WeakPolarHBondContact O-CG 3.27Å; E17-M21 PolarHBondContact O-N 2.93Å; Q18-M21 PolarHBondContact O-N 3.38Å; M19-M21 VanDerWaalsContact C-N 3.33Å; M19-M21 PolarHBondContact O-N 3.32Å; M21-A25 VanDerWaalsContact O-CB 3.23Å; M21-A25 WeakPolarHBondContact O-CB 3.44Å; M21-A25 PolarHBondContact O-N 3.3Å
22	I	91.2	Very high	88.1	Confident	116 Å²	116	95 Å²	95	60%	0.595	49%	0.492	S	S	*	.	H	α-helix	trans	-64.8	-45.9	176.1	-68.3	164.3	0	0	0	110.7	Q18 M19 N20 V24 A25 D26	Q18-I22 WeakPolarHBondContact O-CG1 3.43Å; Q18-I22 PolarHBondContact O-N 3.4Å; M19-I22 PolarHBondContact O-N 3.37Å; N20-I22 VanDerWaalsContact C-N 3.34Å; N20-I22 PolarHBondContact O-N 3.42Å; I22-V24 PolarHBondContact O-N 2.94Å; I22-A25 PolarHBondContact O-N 3.43Å; I22-D26 WeakPolarHBondContact O-CB 3.32Å; I22-D26 PolarHBondContact O-N 2.95Å
23	I	89.9	Confident	88.7	Confident	112 Å²	112	93.9 Å²	93.9	57%	0.574	50%	0.495	S	S	*	.	H	α-helix	trans	-61.1	-45.5	178.9	-67.9	163.5	0	0	0	110.9	M19 N20 D26 A27	M19-I23 VanDerWaalsContact O-CG1 3.3Å; M19-I23 WeakPolarHBondContact O-CG1 3.46Å; M19-I23 PolarHBondContact O-N 3.47Å; N20-I23 PolarHBondContact O-N 3.4Å; I23-D26 PolarHBondContact O-N 3.49Å; I23-A27 WeakPolarHBondContact O-CB 3.44Å; I23-A27 PolarHBondContact O-N 3.18Å
24	V	90.9	Very high	88.9	Confident	58 Å²	58	93.7 Å²	93.7	35%	0.352	50%	0.498	S	S	.	.	H	α-helix	trans	-64	-44.3	177.8	169.5	0	0	0	0	110.5	N20 I22 D26 A27 H28	N20-V24 WeakPolarHBondContact O-CB 3.47Å; N20-V24 VanDerWaalsContact O-CG2 3.25Å; N20-V24 WeakPolarHBondContact O-CG2 3.29Å; N20-V24 PolarHBondContact O-N 3.19Å; I22-V24 PolarHBondContact O-N 2.94Å; V24-D26 PolarHBondContact O-N 3.39Å; V24-A27 PolarHBondContact O-N 3.04Å; V24-H28 VanDerWaalsContact CG1-CD2 3.46Å; V24-H28 WeakPolarHBondContact CG1-CD2 3.21Å; V24-H28 PolarHBondContact O-CD2 2.83Å; V24-H28 PolarHBondContact O-N 3.19Å
25	A	91.1	Very high	89.1	Confident	58 Å²	58	90.9 Å²	90.9	48%	0.479	49%	0.493	S	S	.	.	H	α-helix	trans	-62.4	-41.5	177.4	0	0	0	0	0	112.5	M21 I22 H28 F29	M21-A25 VanDerWaalsContact O-CB 3.23Å; M21-A25 WeakPolarHBondContact O-CB 3.44Å; M21-A25 PolarHBondContact O-N 3.3Å; I22-A25 PolarHBondContact O-N 3.43Å; A25-H28 PolarHBondContact O-N 2.95Å; A25-F29 WeakPolarHBondContact O-CB 3.36Å; A25-F29 PolarHBondContact O-N 2.84Å
26	D	91.1	Very high	89.2	Confident	108 Å²	108	95.5 Å²	95.5	58%	0.578	51%	0.507	S	S	*	.	H	α-helix	trans	-65.3	-43.3	177.3	-168.1	56.6	0	0	0	111.6	I22 I23 V24 H28 F29 A30	I22-D26 WeakPolarHBondContact O-CB 3.32Å; I22-D26 PolarHBondContact O-N 2.95Å; I23-D26 PolarHBondContact O-N 3.49Å; V24-D26 PolarHBondContact O-N 3.39Å; D26-H28 PolarHBondContact O-N 3.1Å; D26-F29 PolarHBondContact O-N 3.21Å; D26-A30 WeakPolarHBondContact O-CB 3.47Å; D26-A30 PolarHBondContact O-N 2.96Å
27	A	90.8	Very high	89.4	Confident	60 Å²	60	95 Å²	95	50%	0.496	51%	0.51	S	S	.	.	H	α-helix	trans	-61.8	-42.2	174.7	0	0	0	0	0	112.4	I23 V24 A30 A31	I23-A27 WeakPolarHBondContact O-CB 3.44Å; I23-A27 PolarHBondContact O-N 3.18Å; V24-A27 PolarHBondContact O-N 3.04Å; A27-A30 PolarHBondContact O-N 3.14Å; A27-A31 PolarHBondContact O-N 3.37Å; A27-A31 VanDerWaalsContact O-N 3.09Å
28	H	90	Very high	89.2	Confident	121 Å²	121	92 Å²	92	56%	0.56	50%	0.498	S	S	*	.	H	α-helix	trans	-64.2	-41.7	173.9	-77.9	-62.7	0	0	0	112	V24 A25 D26 A31 L32	V24-H28 VanDerWaalsContact CG1-CD2 3.46Å; V24-H28 WeakPolarHBondContact CG1-CD2 3.21Å; V24-H28 PolarHBondContact O-CD2 2.83Å; V24-H28 PolarHBondContact O-N 3.19Å; A25-H28 PolarHBondContact O-N 2.95Å; D26-H28 PolarHBondContact O-N 3.1Å; H28-A31 PolarHBondContact O-N 3.02Å; H28-L32 WeakPolarHBondContact O-CB 3.38Å; H28-L32 VanDerWaalsContact O-CG 3.31Å; H28-L32 WeakPolarHBondContact O-CG 3.36Å; H28-L32 PolarHBondContact O-N 3.25Å
29	F	90.6	Very high	89	Confident	141 Å²	141	89.9 Å²	89.9	62%	0.618	49%	0.49	S	S	*	.	H	α-helix	trans	-63.3	-44.5	178	-177.3	-98.8	0	0	0	111.6	A25 D26 A31 L32 S33	A25-F29 WeakPolarHBondContact O-CB 3.36Å; A25-F29 PolarHBondContact O-N 2.84Å; D26-F29 PolarHBondContact O-N 3.21Å; F29-A31 PolarHBondContact O-N 3.47Å; F29-L32 PolarHBondContact O-N 3.45Å; F29-S33 WeakPolarHBondContact O-CB 3.43Å; F29-S33 PolarHBondContact O-N 2.88Å
30	A	89.8	Confident	88.9	Confident	45 Å²	45	88.2 Å²	88.2	37%	0.372	49%	0.49	S	S	.	.	H	α-helix	trans	-58	-46.9	175.3	0	0	0	0	0	111.7	D26 A27 L32 S33 Q34	D26-A30 WeakPolarHBondContact O-CB 3.47Å; D26-A30 PolarHBondContact O-N 2.96Å; A27-A30 PolarHBondContact O-N 3.14Å; A30-L32 PolarHBondContact O-N 2.95Å; A30-S33 PolarHBondContact O-N 3.34Å; A30-Q34 WeakPolarHBondContact O-CG 3.45Å; A30-Q34 PolarHBondContact O-N 2.99Å
31	A	86.7	Confident	88.7	Confident	52 Å²	52	88 Å²	88	43%	0.43	49%	0.489	S	S	.	.	H	α-helix	trans	-62.2	-40.7	177.1	0	0	0	0	0	112.7	A27 H28 F29 A35	A27-A31 PolarHBondContact O-N 3.37Å; A27-A31 VanDerWaalsContact O-N 3.09Å; H28-A31 PolarHBondContact O-N 3.02Å; F29-A31 PolarHBondContact O-N 3.47Å; A31-A35 WeakPolarHBondContact O-CB 3.34Å; A31-A35 PolarHBondContact O-N 3.48Å
32	L	89.9	Confident	88.5	Confident	123 Å²	123	86 Å²	86	64%	0.644	49%	0.485	S	S	*	.	H	α-helix	trans	-67.3	-39.1	176	-73.1	172.8	0	0	0	112.1	H28 F29 A30 A35 K36	H28-L32 WeakPolarHBondContact O-CB 3.38Å; H28-L32 VanDerWaalsContact O-CG 3.31Å; H28-L32 WeakPolarHBondContact O-CG 3.36Å; H28-L32 PolarHBondContact O-N 3.25Å; F29-L32 PolarHBondContact O-N 3.45Å; A30-L32 PolarHBondContact O-N 2.95Å; L32-A35 PolarHBondContact O-N 3.38Å; L32-K36 WeakPolarHBondContact O-CB 3.42Å; L32-K36 PolarHBondContact O-N 3.25Å
33	S	90.2	Very high	88.1	Confident	48 Å²	48	86.6 Å²	86.6	34%	0.336	49%	0.486	S	S	.	.	H	α-helix	trans	-61.7	-46.9	176.3	-168	0	0	0	0	110.8	F29 A30 K36 E37	F29-S33 WeakPolarHBondContact O-CB 3.43Å; F29-S33 PolarHBondContact O-N 2.88Å; A30-S33 PolarHBondContact O-N 3.34Å; S33-K36 WeakPolarHBondContact O-CB 3.45Å; S33-K36 PolarHBondContact O-N 3.31Å; S33-E37 PolarHBondContact O-N 2.93Å
34	Q	86.3	Confident	87.7	Confident	110 Å²	110	85.5 Å²	85.5	51%	0.514	48%	0.477	S	S	.	.	H	α-helix	trans	-61.6	-45.7	175.5	-71.6	176.4	-16.3	0	0	112	A30 K36 E37 V38	A30-Q34 WeakPolarHBondContact O-CG 3.45Å; A30-Q34 PolarHBondContact O-N 2.99Å; Q34-K36 VanDerWaalsContact C-N 3.28Å; Q34-K36 PolarHBondContact O-N 2.94Å; Q34-E37 PolarHBondContact O-N 3.08Å; Q34-V38 WeakPolarHBondContact O-CG2 3.28Å; Q34-V38 PolarHBondContact O-N 3.3Å; Q34-V38 VanDerWaalsContact O-N 3.1Å
35	A	87.9	Confident	87.4	Confident	44 Å²	44	88.9 Å²	88.9	36%	0.364	48%	0.483	S	S	.	.	H	α-helix	trans	-60.1	-39.8	176.4	0	0	0	0	0	111.7	A31 L32 V38 L39	A31-A35 WeakPolarHBondContact O-CB 3.34Å; A31-A35 PolarHBondContact O-N 3.48Å; L32-A35 PolarHBondContact O-N 3.38Å; A35-V38 PolarHBondContact O-N 3.09Å; A35-L39 WeakPolarHBondContact O-CB 3.4Å; A35-L39 WeakPolarHBondContact O-CG 3.33Å; A35-L39 PolarHBondContact O-N 3.39Å
36	K	88.2	Confident	87.1	Confident	145 Å²	145	92.9 Å²	92.9	63%	0.63	49%	0.49	S	S	*	.	H	α-helix	trans	-60.7	-45.2	175.4	-178.8	-170.7	179.8	-170	0	111.3	L32 S33 Q34 V38 L39 S40	L32-K36 WeakPolarHBondContact O-CB 3.42Å; L32-K36 PolarHBondContact O-N 3.25Å; S33-K36 WeakPolarHBondContact O-CB 3.45Å; S33-K36 PolarHBondContact O-N 3.31Å; Q34-K36 VanDerWaalsContact C-N 3.28Å; Q34-K36 PolarHBondContact O-N 2.94Å; K36-V38 PolarHBondContact O-N 2.86Å; K36-L39 PolarHBondContact O-N 2.98Å; K36-S40 VanDerWaalsContact O-CB 3.23Å; K36-S40 WeakPolarHBondContact O-CB 3.42Å; K36-S40 PolarHBondContact O-N 3.23Å; K36-S40 PolarHBondContact O-OG 3.25Å
37	E	88.2	Confident	86.7	Confident	116 Å²	116	88 Å²	88	54%	0.542	46%	0.464	S	S	.	.	H	α-helix	trans	-61	-44.3	178.4	-72	178	-170.4	0	0	112	S33 Q34 L39 D41	S33-E37 PolarHBondContact O-N 2.93Å; Q34-E37 PolarHBondContact O-N 3.08Å; E37-L39 VanDerWaalsContact C-N 3.34Å; E37-L39 PolarHBondContact O-N 3.31Å; E37-D41 PolarHBondContact O-N 2.84Å
38	V	82.8	Confident	86.3	Confident	31 Å²	31	88.8 Å²	88.8	19%	0.188	46%	0.455	C	S	.	.	H	α-helix	trans	-64.1	-38.7	177.2	173.3	0	0	0	0	111.8	Q34 A35 K36 K44 R45 Y48 F60	Q34-V38 WeakPolarHBondContact O-CG2 3.28Å; Q34-V38 PolarHBondContact O-N 3.3Å; Q34-V38 VanDerWaalsContact O-N 3.1Å; A35-V38 PolarHBondContact O-N 3.09Å; K36-V38 PolarHBondContact O-N 2.86Å; V38-K44 HydrophobicContact CG1-CB 4.3Å; V38-K44 CarbonylContact O-C 3.21Å; V38-K44 WeakPolarHBondContact O-CB 3.26Å; V38-R45 PolarHBondContact O-N 3.2Å; V38-Y48 HydrophobicContact CG1-CD2 4.37Å; V38-Y48 HydrophobicContact CG1-CG 4.41Å; V38-F60 HydrophobicContact CB-CE1 4.49Å; V38-F60 HydrophobicContact CG1-CD1 4.46Å; V38-F60 HydrophobicContact CG1-CE1 3.59Å; V38-F60 HydrophobicContact CG1-CZ 3.96Å; V38-F60 HydrophobicContact CG2-CE1 4Å
39	L	84.1	Confident	86	Confident	90 Å²	90	86.4 Å²	86.4	47%	0.471	45%	0.447	S	S	.	.	H	α-helix	trans	-83	-23.9	-177.7	-67	175.4	0	0	0	113.7	A35 K36 E37 R45 Y48	A35-L39 WeakPolarHBondContact O-CB 3.4Å; A35-L39 WeakPolarHBondContact O-CG 3.33Å; A35-L39 PolarHBondContact O-N 3.39Å; K36-L39 PolarHBondContact O-N 2.98Å; E37-L39 VanDerWaalsContact C-N 3.34Å; E37-L39 PolarHBondContact O-N 3.31Å; L39-R45 HydrophobicContact CD2-CG 4.28Å; L39-Y48 HydrophobicContact CD2-CD1 4.47Å
40	S	86.7	Confident	85.7	Confident	81 Å²	81	81.7 Å²	81.7	57%	0.566	43%	0.434	S	S	*	.	H	α-helix	trans	-76.3	-33.6	179.7	-59.7	0	0	0	0	111.9	K36 P42	K36-S40 VanDerWaalsContact O-CB 3.23Å; K36-S40 WeakPolarHBondContact O-CB 3.42Å; K36-S40 PolarHBondContact O-N 3.23Å; K36-S40 PolarHBondContact O-OG 3.25Å; S40-P42 WeakPolarHBondContact O-CD 3.5Å
41	D	86.5	Confident	85.4	Confident	62 Å²	62	82.2 Å²	82.2	33%	0.332	43%	0.426	S	S	.	.	S	Bend	trans	-81.6	119.4	175.9	-177.4	-32.9	0	0	0	110.3	E37 E43 K44 R45	E37-D41 PolarHBondContact O-N 2.84Å; D41-E43 VanDerWaalsContact C-N 3.3Å; D41-E43 PolarHBondContact O-N 3.36Å; D41-E43 PolarHBondContact OD1-N 2.86Å; D41-K44 HydrophobicContact CB-CB 3.96Å; D41-K44 HydrophobicContact CB-CD 3.92Å; D41-K44 HydrophobicContact CB-CG 3.92Å; D41-K44 PolarHBondContact O-N 3.36Å; D41-K44 PolarHBondContact OD1-N 3.18Å; D41-R45 VanDerWaalsContact O-CB 3.28Å; D41-R45 WeakPolarHBondContact O-CB 3.42Å; D41-R45 PolarHBondContact O-N 2.84Å
42	P	86.3	Confident	85.2	Confident	85 Å²	85	88.2 Å²	88.2	55%	0.552	44%	0.437	S	S	*	.	H	α-helix	trans	-57.8	-36.9	-178.9	-25.4	34.9	0	0	0	114.5	S40 K46	S40-P42 WeakPolarHBondContact O-CD 3.5Å; P42-K46 WeakPolarHBondContact O-CB 3.36Å; P42-K46 PolarHBondContact O-N 3.39Å
43	E	82.8	Confident	84.8	Confident	128 Å²	128	92.4 Å²	92.4	60%	0.598	45%	0.445	S	S	*	.	H	α-helix	trans	-73	-44.1	-178.8	-72.5	-58.5	133.5	0	0	110.6	D41 R45 K46 A47	D41-E43 VanDerWaalsContact C-N 3.3Å; D41-E43 PolarHBondContact O-N 3.36Å; D41-E43 PolarHBondContact OD1-N 2.86Å; E43-R45 VanDerWaalsContact C-N 3.34Å; E43-R45 PolarHBondContact O-N 2.96Å; E43-K46 WeakPolarHBondContact O-CB 3.26Å; E43-K46 PolarHBondContact O-N 2.86Å; E43-A47 PolarHBondContact O-N 3.3Å
44	K	80.9	Confident	83.8	Confident	90 Å²	90	93.6 Å²	93.6	39%	0.391	45%	0.452	S	S	.	.	H	α-helix	trans	-63.8	-40.2	174.2	-63.9	-175.9	-175.3	178.4	0	111.5	V38 D41 K46 A47 Y48	V38-K44 HydrophobicContact CG1-CB 4.3Å; V38-K44 CarbonylContact O-C 3.21Å; V38-K44 WeakPolarHBondContact O-CB 3.26Å; D41-K44 HydrophobicContact CB-CB 3.96Å; D41-K44 HydrophobicContact CB-CD 3.92Å; D41-K44 HydrophobicContact CB-CG 3.92Å; D41-K44 PolarHBondContact O-N 3.36Å; D41-K44 PolarHBondContact OD1-N 3.18Å; K44-K46 VanDerWaalsContact C-N 3.33Å; K44-K46 PolarHBondContact O-N 3.32Å; K44-A47 WeakPolarHBondContact O-CB 3.45Å; K44-A47 PolarHBondContact O-N 3.43Å; K44-Y48 WeakPolarHBondContact O-CB 3.4Å; K44-Y48 PolarHBondContact O-N 2.97Å
45	R	84.6	Confident	82.7	Confident	129 Å²	129	94.2 Å²	94.2	49%	0.487	47%	0.465	S	S	.	.	H	α-helix	trans	-62.1	-39.8	175.5	-173.3	175.2	64.9	158	-0.4	111.9	V38 L39 D41 E43 Y48 N49	V38-R45 PolarHBondContact O-N 3.2Å; L39-R45 HydrophobicContact CD2-CG 4.28Å; D41-R45 VanDerWaalsContact O-CB 3.28Å; D41-R45 WeakPolarHBondContact O-CB 3.42Å; D41-R45 PolarHBondContact O-N 2.84Å; E43-R45 VanDerWaalsContact C-N 3.34Å; E43-R45 PolarHBondContact O-N 2.96Å; R45-Y48 PolarHBondContact O-N 3.25Å; R45-N49 WeakPolarHBondContact O-CB 3.39Å; R45-N49 VanDerWaalsContact O-CG 3.28Å; R45-N49 PolarHBondContact O-N 3.41Å; R45-N49 PolarHBondContact O-ND2 3.17Å
46	K	84.1	Confident	81.5	Confident	142 Å²	142	94.9 Å²	94.9	62%	0.617	47%	0.465	S	S	*	.	H	α-helix	trans	-64.9	-42.5	175	-170.8	-177.8	-179.2	-176.4	0	111.3	P42 E43 K44 N49 A50	P42-K46 WeakPolarHBondContact O-CB 3.36Å; P42-K46 PolarHBondContact O-N 3.39Å; E43-K46 WeakPolarHBondContact O-CB 3.26Å; E43-K46 PolarHBondContact O-N 2.86Å; K44-K46 VanDerWaalsContact C-N 3.33Å; K44-K46 PolarHBondContact O-N 3.32Å; K46-N49 PolarHBondContact O-N 2.98Å; K46-A50 PolarHBondContact O-N 3.3Å
47	A	83.7	Confident	80.8	Confident	5 Å²	5	98.8 Å²	98.8	4%	0.041	48%	0.483	C	S	.	.	H	α-helix	trans	-62	-46	175.6	0	0	0	0	0	111.5	E43 K44 N49 A50 W51 W63 L64	E43-A47 PolarHBondContact O-N 3.3Å; K44-A47 WeakPolarHBondContact O-CB 3.45Å; K44-A47 PolarHBondContact O-N 3.43Å; A47-N49 PolarHBondContact O-N 3.29Å; A47-A50 WeakPolarHBondContact O-CB 3.37Å; A47-A50 PolarHBondContact O-N 2.86Å; A47-A50 VanDerWaalsContact O-N 3.14Å; A47-W51 PolarHBondContact O-N 3.49Å; A47-W63 HydrophobicContact CB-CH2 4.25Å; A47-W63 HydrophobicContact CB-CZ3 3.89Å; A47-W63 VanDerWaalsContact O-CH2 3.26Å; A47-W63 WeakPolarHBondContact O-CH2 3.26Å; A47-W63 VanDerWaalsContact O-CZ3 3.26Å; A47-W63 WeakPolarHBondContact O-CZ3 3.32Å; A47-L64 HydrophobicContact CB-CD1 4.45Å
48	Y	82.2	Confident	80.2	Confident	76 Å²	76	95.3 Å²	95.3	30%	0.298	47%	0.467	S	S	.	.	H	α-helix	trans	-59.7	-44	175	-175.9	-96.9	0	0	0	112.5	V38 L39 K44 R45 A50 W51 R52 F60	V38-Y48 HydrophobicContact CG1-CD2 4.37Å; V38-Y48 HydrophobicContact CG1-CG 4.41Å; L39-Y48 HydrophobicContact CD2-CD1 4.47Å; K44-Y48 WeakPolarHBondContact O-CB 3.4Å; K44-Y48 PolarHBondContact O-N 2.97Å; R45-Y48 PolarHBondContact O-N 3.25Å; Y48-A50 VanDerWaalsContact C-N 3.29Å; Y48-A50 PolarHBondContact O-N 3.45Å; Y48-W51 HydrophobicContact CD2-CE3 4.06Å; Y48-W51 HydrophobicContact CD2-CZ3 4.37Å; Y48-W51 AromaticContact CE2-CE3 3.8Å; Y48-W51 HydrophobicContact CE2-CE3 3.8Å; Y48-W51 AromaticContact CE2-CZ3 3.66Å; Y48-W51 HydrophobicContact CE2-CZ3 3.66Å; Y48-W51 PolarHBondContact O-N 3.45Å; Y48-R52 WeakPolarHBondContact O-CB 3.38Å; Y48-R52 PolarHBondContact O-N 3.2Å; Y48-F60 HydrophobicContact CD2-CB 4.39Å; Y48-F60 AromaticContact CD2-CD1 3.98Å; Y48-F60 HydrophobicContact CD2-CD1 3.98Å; Y48-F60 AromaticContact CD2-CD2 3.72Å; Y48-F60 HydrophobicContact CD2-CD2 3.72Å; Y48-F60 HydrophobicContact CD2-CE1 4.17Å; Y48-F60 AromaticContact CD2-CE2 3.94Å; Y48-F60 HydrophobicContact CD2-CE2 3.94Å; Y48-F60 AromaticContact CD2-CG 3.74Å; Y48-F60 HydrophobicContact CD2-CG 3.74Å; Y48-F60 HydrophobicContact CD2-CZ 4.14Å; Y48-F60 HydrophobicContact CE2-CB 4.46Å; Y48-F60 HydrophobicContact CE2-CG 4.27Å; Y48-F60 HydrophobicContact CG-CE2 4.37Å
49	N	84.6	Confident	80.2	Confident	72 Å²	72	96.3 Å²	96.3	39%	0.385	48%	0.476	S	S	.	.	H	α-helix	trans	-62.9	-34.6	175.5	-75.8	-29.4	0	0	0	112.8	R45 K46 A47 R53	R45-N49 WeakPolarHBondContact O-CB 3.39Å; R45-N49 VanDerWaalsContact O-CG 3.28Å; R45-N49 PolarHBondContact O-N 3.41Å; R45-N49 PolarHBondContact O-ND2 3.17Å; K46-N49 PolarHBondContact O-N 2.98Å; A47-N49 PolarHBondContact O-N 3.29Å; N49-R53 WeakPolarHBondContact O-CG 3.47Å; N49-R53 PolarHBondContact O-N 2.88Å
50	A	84.2	Confident	80.1	Confident	42 Å²	42	93.3 Å²	93.3	35%	0.347	46%	0.459	S	S	.	.	H	α-helix	trans	-68.1	-46.7	174.7	0	0	0	0	0	111.3	K46 A47 Y48 R52 R53 C54 W63	K46-A50 PolarHBondContact O-N 3.3Å; A47-A50 WeakPolarHBondContact O-CB 3.37Å; A47-A50 PolarHBondContact O-N 2.86Å; A47-A50 VanDerWaalsContact O-N 3.14Å; Y48-A50 VanDerWaalsContact C-N 3.29Å; Y48-A50 PolarHBondContact O-N 3.45Å; A50-R52 VanDerWaalsContact C-N 3.33Å; A50-R52 PolarHBondContact O-N 3.39Å; A50-R53 PolarHBondContact O-N 3.45Å; A50-C54 PolarHBondContact O-N 2.96Å; A50-W63 HydrophobicContact CB-CH2 4.12Å; A50-W63 HydrophobicContact CB-CZ2 4.36Å
51	W	82.7	Confident	79.8	Confident	55 Å²	55	95.5 Å²	95.5	21%	0.208	46%	0.46	C	S	.	.	H	α-helix	trans	-57.5	-44.5	173.1	174.3	75.8	0	0	0	111.8	A47 Y48 R53 C54 M58 F60 W63	A47-W51 PolarHBondContact O-N 3.49Å; Y48-W51 HydrophobicContact CD2-CE3 4.06Å; Y48-W51 HydrophobicContact CD2-CZ3 4.37Å; Y48-W51 AromaticContact CE2-CE3 3.8Å; Y48-W51 HydrophobicContact CE2-CE3 3.8Å; Y48-W51 AromaticContact CE2-CZ3 3.66Å; Y48-W51 HydrophobicContact CE2-CZ3 3.66Å; Y48-W51 PolarHBondContact O-N 3.45Å; W51-R53 PolarHBondContact O-N 3.38Å; W51-C54 CarbonylContact O-C 3.55Å; W51-C54 PolarHBondContact O-N 3.09Å; W51-M58 WeakPolarHBondContact CZ2-O 3.37Å; W51-M58 PolarHBondContact NE1-O 2.84Å; W51-F60 HydrophobicContact CB-CD2 3.94Å; W51-F60 HydrophobicContact CB-CE2 4.4Å; W51-F60 HydrophobicContact CD2-CB 3.97Å; W51-F60 HydrophobicContact CD2-CD2 4.01Å; W51-F60 HydrophobicContact CD2-CG 4.47Å; W51-F60 HydrophobicContact CE3-CB 3.99Å; W51-F60 HydrophobicContact CE3-CD2 4.12Å; W51-F60 HydrophobicContact CE3-CG 4.41Å; W51-F60 AromaticContact CG-CD2 3.95Å; W51-F60 HydrophobicContact CG-CD2 3.95Å; W51-F60 HydrophobicContact CH2-CB 4.26Å; W51-F60 HydrophobicContact CZ2-CB 4.23Å; W51-F60 HydrophobicContact CZ3-CB 4.14Å; W51-W63 HydrophobicContact CB-CD2 3.83Å; W51-W63 HydrophobicContact CB-CE3 3.81Å; W51-W63 HydrophobicContact CB-CG 4.33Å; W51-W63 HydrophobicContact CB-CH2 4.34Å; W51-W63 HydrophobicContact CB-CZ2 4.39Å; W51-W63 HydrophobicContact CB-CZ3 4.06Å; W51-W63 VanDerWaalsContact CD1-CB 3.45Å; W51-W63 AromaticContact CD1-CD1 3.79Å; W51-W63 AromaticContact CD1-CD2 3.83Å; W51-W63 AromaticContact CD1-CG 3.39Å; W51-W63 HydrophobicContact CG-CB 4.35Å; W51-W63 HydrophobicContact CG-CD2 4.16Å; W51-W63 HydrophobicContact CG-CE3 4.34Å; W51-W63 HydrophobicContact CG-CG 4.16Å
52	R	82.6	Confident	79.6	Confident	178 Å²	178	97.3 Å²	97.3	67%	0.672	47%	0.466	S	S	*	.	H	α-helix	trans	-63.1	-26.2	178.9	-154.2	-166.7	81.1	165.5	4.9	113.8	Y48 A50 C54	Y48-R52 WeakPolarHBondContact O-CB 3.38Å; Y48-R52 PolarHBondContact O-N 3.2Å; A50-R52 VanDerWaalsContact C-N 3.33Å; A50-R52 PolarHBondContact O-N 3.39Å; R52-C54 VanDerWaalsContact C-N 3.33Å
53	R	81.1	Confident	79.3	Confident	212 Å²	212	95.6 Å²	95.6	80%	0.8	45%	0.449	S	S	*	.	H	α-helix	trans	-79.2	-19.3	175.4	-73.8	175.2	178.7	-176.4	-2.8	112.7	N49 A50 W51 P55	N49-R53 WeakPolarHBondContact O-CG 3.47Å; N49-R53 PolarHBondContact O-N 2.88Å; A50-R53 PolarHBondContact O-N 3.45Å; W51-R53 PolarHBondContact O-N 3.38Å; R53-P55 WeakPolarHBondContact O-CD 3.5Å
54	C	69.1	Low	79.2	Confident	72 Å²	72	91.9 Å²	91.9	49%	0.486	43%	0.433	S	S	.	.	S	Bend	trans	-117.3	83.4	179	-63.9	0	0	0	0	108.5	A50 W51 R52 T56	A50-C54 PolarHBondContact O-N 2.96Å; W51-C54 CarbonylContact O-C 3.55Å; W51-C54 PolarHBondContact O-N 3.09Å; R52-C54 VanDerWaalsContact C-N 3.33Å; C54-T56 VanDerWaalsContact C-N 3.32Å; C54-T56 PolarHBondContact O-N 3.23Å
55	P	63	Low	79.1	Confident	123 Å²	123	93.5 Å²	93.5	80%	0.799	45%	0.445	S	S	*	.			trans	-61.2	98	177.3	25.3	-32.1	0	0	0	108.6	R53	R53-P55 WeakPolarHBondContact O-CD 3.5Å
56	T	63.5	Low	78.7	Confident	59 Å²	59	94.7 Å²	94.7	36%	0.362	45%	0.45	S	S	.	.			trans	-103	155.8	176.2	48	0	0	0	0	108.1	C54 M58	C54-T56 VanDerWaalsContact C-N 3.32Å; C54-T56 PolarHBondContact O-N 3.23Å; T56-M58 PolarHBondContact O-N 2.76Å
57	F	72.4	Confident	78.2	Confident	227 Å²	227	92.3 Å²	92.3	100%	0.996	44%	0.439	S	S	*	.	S	Bend	trans	-71.3	13.4	-179.1	-67.4	-83.8	0	0	0	114.2
58	M	77.4	Confident	77.7	Confident	42 Å²	42	96 Å²	96	21%	0.207	46%	0.458	C	S	.	.	S	Bend	trans	-125.6	153.2	-173.5	70.1	-174.7	67.3	0	0	111.2	W51 T56 E62 W63 R66	W51-M58 WeakPolarHBondContact CZ2-O 3.37Å; W51-M58 PolarHBondContact NE1-O 2.84Å; T56-M58 PolarHBondContact O-N 2.76Å; M58-E62 HydrophobicContact CB-CB 4.03Å; M58-E62 WeakPolarHBondContact CB-OE2 3.46Å; M58-E62 HydrophobicContact CG-CB 4.33Å; M58-E62 HydrophobicContact SD-CB 4.4Å; M58-W63 HydrophobicContact CG-CB 4.25Å; M58-W63 HydrophobicContact SD-CB 4.19Å; M58-R66 VanDerWaalsContact SD-CD 3.6Å
59	S	82.6	Confident	77.1	Confident	53 Å²	53	99 Å²	99	37%	0.371	47%	0.473	S	S	.	.			trans	-63.7	160.2	177.1	63.8	0	0	0	0	111.9	E61 E62 W63	S59-E61 PolarHBondContact O-N 3.47Å; S59-E62 PolarHBondContact N-OE2 2.99Å; S59-E62 PolarHBondContact O-N 2.96Å; S59-E62 WeakPolarHBondContact OG-CB 3.31Å; S59-E62 VanDerWaalsContact OG-CG 3.26Å; S59-E62 WeakPolarHBondContact OG-CG 3.49Å; S59-E62 PolarHBondContact OG-N 3.39Å; S59-E62 PolarHBondContact OG-OE2 3.48Å; S59-W63 PolarHBondContact O-N 3.42Å
60	F	80.8	Confident	76.1	Confident	27 Å²	27	100.2 Å²	100.2	12%	0.118	48%	0.479	C	S	.	.	H	α-helix	trans	-58.6	-36.5	176.1	174	-115.2	0	0	0	112.1	V38 Y48 W51 W63 L64	V38-F60 HydrophobicContact CB-CE1 4.49Å; V38-F60 HydrophobicContact CG1-CD1 4.46Å; V38-F60 HydrophobicContact CG1-CE1 3.59Å; V38-F60 HydrophobicContact CG1-CZ 3.96Å; V38-F60 HydrophobicContact CG2-CE1 4Å; Y48-F60 HydrophobicContact CD2-CB 4.39Å; Y48-F60 AromaticContact CD2-CD1 3.98Å; Y48-F60 HydrophobicContact CD2-CD1 3.98Å; Y48-F60 AromaticContact CD2-CD2 3.72Å; Y48-F60 HydrophobicContact CD2-CD2 3.72Å; Y48-F60 HydrophobicContact CD2-CE1 4.17Å; Y48-F60 AromaticContact CD2-CE2 3.94Å; Y48-F60 HydrophobicContact CD2-CE2 3.94Å; Y48-F60 AromaticContact CD2-CG 3.74Å; Y48-F60 HydrophobicContact CD2-CG 3.74Å; Y48-F60 HydrophobicContact CD2-CZ 4.14Å; Y48-F60 HydrophobicContact CE2-CB 4.46Å; Y48-F60 HydrophobicContact CE2-CG 4.27Å; Y48-F60 HydrophobicContact CG-CE2 4.37Å; W51-F60 HydrophobicContact CB-CD2 3.94Å; W51-F60 HydrophobicContact CB-CE2 4.4Å; W51-F60 HydrophobicContact CD2-CB 3.97Å; W51-F60 HydrophobicContact CD2-CD2 4.01Å; W51-F60 HydrophobicContact CD2-CG 4.47Å; W51-F60 HydrophobicContact CE3-CB 3.99Å; W51-F60 HydrophobicContact CE3-CD2 4.12Å; W51-F60 HydrophobicContact CE3-CG 4.41Å; W51-F60 AromaticContact CG-CD2 3.95Å; W51-F60 HydrophobicContact CG-CD2 3.95Å; W51-F60 HydrophobicContact CH2-CB 4.26Å; W51-F60 HydrophobicContact CZ2-CB 4.23Å; W51-F60 HydrophobicContact CZ3-CB 4.14Å; F60-W63 HydrophobicContact CD2-CE3 4.11Å; F60-W63 AromaticContact CE2-CE3 3.97Å; F60-W63 HydrophobicContact CE2-CE3 3.97Å; F60-W63 HydrophobicContact CE2-CZ3 4Å; F60-W63 PolarHBondContact O-N 2.85Å; F60-L64 HydrophobicContact CZ-CD1 4.45Å; F60-L64 WeakPolarHBondContact O-CB 3.39Å; F60-L64 PolarHBondContact O-N 2.9Å
61	E	81.5	Confident	75.3	Confident	127 Å²	127	99.7 Å²	99.7	59%	0.593	48%	0.477	S	S	*	.	H	α-helix	trans	-65.8	-46.6	177.8	-64.4	-177.7	175.7	0	0	111.8	S59 W63 L64 L65	S59-E61 PolarHBondContact O-N 3.47Å; E61-W63 VanDerWaalsContact C-N 3.29Å; E61-W63 PolarHBondContact O-N 2.88Å; E61-L64 PolarHBondContact O-N 3.3Å; E61-L65 WeakPolarHBondContact O-CG 3.23Å; E61-L65 PolarHBondContact O-N 3.3Å
62	E	81.4	Confident	74.4	Confident	99 Å²	99	102.6 Å²	102.6	46%	0.463	49%	0.494	S	S	.	.	H	α-helix	trans	-61.4	-39.6	174.9	-73.4	170	125.1	0	0	111.9	M58 S59 R66	M58-E62 HydrophobicContact CB-CB 4.03Å; M58-E62 WeakPolarHBondContact CB-OE2 3.46Å; M58-E62 HydrophobicContact CG-CB 4.33Å; M58-E62 HydrophobicContact SD-CB 4.4Å; S59-E62 PolarHBondContact N-OE2 2.99Å; S59-E62 PolarHBondContact O-N 2.96Å; S59-E62 WeakPolarHBondContact OG-CB 3.31Å; S59-E62 VanDerWaalsContact OG-CG 3.26Å; S59-E62 WeakPolarHBondContact OG-CG 3.49Å; S59-E62 PolarHBondContact OG-N 3.39Å; S59-E62 PolarHBondContact OG-OE2 3.48Å; E62-R66 WeakPolarHBondContact O-CG 3.49Å; E62-R66 PolarHBondContact O-N 3.5Å; E62-R66 VanDerWaalsContact O-N 3.09Å
63	W	80.8	Confident	73.3	Confident	49 Å²	49	96.7 Å²	96.7	19%	0.186	48%	0.478	C	S	.	.	H	α-helix	trans	-65.9	-39.7	175.4	180	86.7	0	0	0	112	A47 A50 W51 M58 S59 F60 E61 R66 K67	A47-W63 HydrophobicContact CB-CH2 4.25Å; A47-W63 HydrophobicContact CB-CZ3 3.89Å; A47-W63 VanDerWaalsContact O-CH2 3.26Å; A47-W63 WeakPolarHBondContact O-CH2 3.26Å; A47-W63 VanDerWaalsContact O-CZ3 3.26Å; A47-W63 WeakPolarHBondContact O-CZ3 3.32Å; A50-W63 HydrophobicContact CB-CH2 4.12Å; A50-W63 HydrophobicContact CB-CZ2 4.36Å; W51-W63 HydrophobicContact CB-CD2 3.83Å; W51-W63 HydrophobicContact CB-CE3 3.81Å; W51-W63 HydrophobicContact CB-CG 4.33Å; W51-W63 HydrophobicContact CB-CH2 4.34Å; W51-W63 HydrophobicContact CB-CZ2 4.39Å; W51-W63 HydrophobicContact CB-CZ3 4.06Å; W51-W63 VanDerWaalsContact CD1-CB 3.45Å; W51-W63 AromaticContact CD1-CD1 3.79Å; W51-W63 AromaticContact CD1-CD2 3.83Å; W51-W63 AromaticContact CD1-CG 3.39Å; W51-W63 HydrophobicContact CG-CB 4.35Å; W51-W63 HydrophobicContact CG-CD2 4.16Å; W51-W63 HydrophobicContact CG-CE3 4.34Å; W51-W63 HydrophobicContact CG-CG 4.16Å; M58-W63 HydrophobicContact CG-CB 4.25Å; M58-W63 HydrophobicContact SD-CB 4.19Å; S59-W63 PolarHBondContact O-N 3.42Å; F60-W63 HydrophobicContact CD2-CE3 4.11Å; F60-W63 AromaticContact CE2-CE3 3.97Å; F60-W63 HydrophobicContact CE2-CE3 3.97Å; F60-W63 HydrophobicContact CE2-CZ3 4Å; F60-W63 PolarHBondContact O-N 2.85Å; E61-W63 VanDerWaalsContact C-N 3.29Å; E61-W63 PolarHBondContact O-N 2.88Å; W63-R66 PolarHBondContact O-N 3.38Å; W63-K67 HydrophobicContact CH2-CD 3.8Å; W63-K67 HydrophobicContact CZ2-CD 4.44Å; W63-K67 HydrophobicContact CZ3-CD 3.98Å; W63-K67 WeakPolarHBondContact O-CB 3.3Å; W63-K67 PolarHBondContact O-N 3.03Å
64	L	80	Confident	72.4	Confident	50 Å²	50	90.7 Å²	90.7	26%	0.262	46%	0.462	S	S	.	.	H	α-helix	trans	-64.8	-46	178.1	-167.5	68.9	0	0	0	111	A47 F60 E61 R66 K67 D68	A47-L64 HydrophobicContact CB-CD1 4.45Å; F60-L64 HydrophobicContact CZ-CD1 4.45Å; F60-L64 WeakPolarHBondContact O-CB 3.39Å; F60-L64 PolarHBondContact O-N 2.9Å; E61-L64 PolarHBondContact O-N 3.3Å; L64-R66 VanDerWaalsContact C-N 3.27Å; L64-R66 PolarHBondContact O-N 3.01Å; L64-K67 WeakPolarHBondContact O-CB 3.44Å; L64-K67 PolarHBondContact O-N 2.98Å; L64-K67 VanDerWaalsContact O-N 3.08Å; L64-D68 PolarHBondContact O-N 2.99Å
65	L	80	Confident	72.3	Confident	124 Å²	124	92.9 Å²	92.9	65%	0.649	47%	0.469	S	S	*	.	H	α-helix	trans	-57.4	-40.1	174.3	-71.2	172.3	0	0	0	112	E61 F69	E61-L65 WeakPolarHBondContact O-CG 3.23Å; E61-L65 PolarHBondContact O-N 3.3Å; L65-F69 WeakPolarHBondContact O-CB 3.36Å; L65-F69 PolarHBondContact O-N 2.95Å
66	R	75.3	Confident	72.1	Confident	154 Å²	154	92.2 Å²	92.2	58%	0.581	46%	0.458	S	S	*	.	H	α-helix	trans	-69.8	-38.3	175	-74.2	-179.6	-174.1	-125.7	2	112.8	M58 E62 W63 L64 D68 F69 I70	M58-R66 VanDerWaalsContact SD-CD 3.6Å; E62-R66 WeakPolarHBondContact O-CG 3.49Å; E62-R66 PolarHBondContact O-N 3.5Å; E62-R66 VanDerWaalsContact O-N 3.09Å; W63-R66 PolarHBondContact O-N 3.38Å; L64-R66 VanDerWaalsContact C-N 3.27Å; L64-R66 PolarHBondContact O-N 3.01Å; R66-D68 VanDerWaalsContact C-N 3.31Å; R66-F69 PolarHBondContact O-N 3.47Å; R66-I70 VanDerWaalsContact O-CG1 3.28Å; R66-I70 WeakPolarHBondContact O-CG1 3.46Å; R66-I70 PolarHBondContact O-N 2.91Å
67	K	72.6	Confident	71.8	Confident	92 Å²	92	93.4 Å²	93.4	40%	0.4	46%	0.462	S	S	.	.	H	α-helix	trans	-60.9	-44.9	176.2	-176.2	-171.4	170.7	-163.2	0	110.2	W63 L64 F69 I70 G71	W63-K67 HydrophobicContact CH2-CD 3.8Å; W63-K67 HydrophobicContact CZ2-CD 4.44Å; W63-K67 HydrophobicContact CZ3-CD 3.98Å; W63-K67 WeakPolarHBondContact O-CB 3.3Å; W63-K67 PolarHBondContact O-N 3.03Å; L64-K67 WeakPolarHBondContact O-CB 3.44Å; L64-K67 PolarHBondContact O-N 2.98Å; L64-K67 VanDerWaalsContact O-N 3.08Å; K67-F69 VanDerWaalsContact C-N 3.35Å; K67-I70 PolarHBondContact O-N 2.82Å; K67-G71 PolarHBondContact O-N 3.45Å
68	D	73.5	Confident	71	Confident	83 Å²	83	90.9 Å²	90.9	44%	0.444	45%	0.447	S	S	.	.	H	α-helix	trans	-66.5	-38.6	177.6	-66.2	-18	0	0	0	111.2	L64 R66 G71 M72	L64-D68 PolarHBondContact O-N 2.99Å; R66-D68 VanDerWaalsContact C-N 3.31Å; D68-G71 PolarHBondContact O-N 3.33Å; D68-M72 HydrophobicContact CB-CE 4.4Å; D68-M72 WeakPolarHBondContact O-CG 3.25Å; D68-M72 PolarHBondContact O-N 2.85Å
69	F	70.8	Confident	70.2	Confident	138 Å²	138	92.1 Å²	92.1	61%	0.605	46%	0.46	S	S	*	.	H	α-helix	trans	-62	-44.4	173.2	-172.8	-96.9	0	0	0	112.6	L65 R66 K67 G71 M72 V73	L65-F69 WeakPolarHBondContact O-CB 3.36Å; L65-F69 PolarHBondContact O-N 2.95Å; R66-F69 PolarHBondContact O-N 3.47Å; K67-F69 VanDerWaalsContact C-N 3.35Å; F69-G71 VanDerWaalsContact C-N 3.31Å; F69-G71 PolarHBondContact O-N 3.21Å; F69-M72 PolarHBondContact O-N 2.79Å; F69-V73 HydrophobicContact CD1-CG2 4.11Å; F69-V73 HydrophobicContact CE1-CG2 3.77Å; F69-V73 HydrophobicContact CZ-CG2 4.07Å; F69-V73 WeakPolarHBondContact O-CG2 3.4Å; F69-V73 PolarHBondContact O-N 3.48Å
70	I	62.8	Low	68.8	Low	99 Å²	99	96.9 Å²	96.9	51%	0.508	47%	0.474	S	S	.	.	H	α-helix	trans	-65	-37.8	176.5	-66.9	163.8	0	0	0	110.8	R66 K67 V73 N74	R66-I70 VanDerWaalsContact O-CG1 3.28Å; R66-I70 WeakPolarHBondContact O-CG1 3.46Å; R66-I70 PolarHBondContact O-N 2.91Å; K67-I70 PolarHBondContact O-N 2.82Å; I70-V73 PolarHBondContact O-N 3.49Å; I70-N74 WeakPolarHBondContact O-CB 3.3Å; I70-N74 PolarHBondContact O-N 3.4Å; I70-N74 PolarHBondContact O-ND2 3.3Å
71	G	67.4	Low	67.5	Low	30 Å²	30	103.5 Å²	103.5	31%	0.309	50%	0.503	S	S	.	.	H	α-helix	trans	-57.7	-52.4	172.3	0	0	0	0	0	111.7	K67 D68 F69 V73 N74 D75	K67-G71 PolarHBondContact O-N 3.45Å; D68-G71 PolarHBondContact O-N 3.33Å; F69-G71 VanDerWaalsContact C-N 3.31Å; F69-G71 PolarHBondContact O-N 3.21Å; G71-V73 VanDerWaalsContact C-N 3.34Å; G71-V73 PolarHBondContact O-N 2.96Å; G71-N74 PolarHBondContact O-N 2.98Å; G71-D75 PolarHBondContact O-N 2.83Å
72	M	63.3	Low	66.2	Low	116 Å²	116	102.2 Å²	102.2	57%	0.571	50%	0.503	S	S	*	.	H	α-helix	trans	-59.5	-41.4	177.2	-72.5	-175.1	-125.6	0	0	112.8	D68 F69 D75 L76	D68-M72 HydrophobicContact CB-CE 4.4Å; D68-M72 WeakPolarHBondContact O-CG 3.25Å; D68-M72 PolarHBondContact O-N 2.85Å; F69-M72 PolarHBondContact O-N 2.79Å; M72-D75 PolarHBondContact O-N 3.18Å; M72-L76 WeakPolarHBondContact O-CB 3.24Å; M72-L76 VanDerWaalsContact O-CG 3.29Å; M72-L76 WeakPolarHBondContact O-CG 3.41Å; M72-L76 PolarHBondContact O-N 3.19Å
73	V	60.8	Low	64.7	Low	55 Å²	55	107.4 Å²	107.4	33%	0.333	52%	0.52	S	S	.	.	H	α-helix	trans	-65.6	-42.4	177.5	172.9	0	0	0	0	110.9	F69 I70 G71 L76 L77	F69-V73 HydrophobicContact CD1-CG2 4.11Å; F69-V73 HydrophobicContact CE1-CG2 3.77Å; F69-V73 HydrophobicContact CZ-CG2 4.07Å; F69-V73 WeakPolarHBondContact O-CG2 3.4Å; F69-V73 PolarHBondContact O-N 3.48Å; I70-V73 PolarHBondContact O-N 3.49Å; G71-V73 VanDerWaalsContact C-N 3.34Å; G71-V73 PolarHBondContact O-N 2.96Å; V73-L76 PolarHBondContact O-N 3.48Å; V73-L77 HydrophobicContact CG1-CD1 3.97Å; V73-L77 HydrophobicContact CG1-CG 4.33Å; V73-L77 WeakPolarHBondContact O-CB 3.41Å; V73-L77 VanDerWaalsContact O-CG 3.27Å; V73-L77 WeakPolarHBondContact O-CG 3.34Å; V73-L77 PolarHBondContact O-N 3.21Å
74	N	61.4	Low	63.1	Low	85 Å²	85	111.5 Å²	111.5	46%	0.455	56%	0.564	S	S	.	*	H	α-helix	trans	-64	-40.3	176.1	-84	-33.3	0	0	0	112	I70 G71 L77 Y78	I70-N74 WeakPolarHBondContact O-CB 3.3Å; I70-N74 PolarHBondContact O-N 3.4Å; I70-N74 PolarHBondContact O-ND2 3.3Å; G71-N74 PolarHBondContact O-N 2.98Å; N74-L77 PolarHBondContact O-N 3.4Å; N74-Y78 WeakPolarHBondContact O-CB 3.47Å; N74-Y78 PolarHBondContact O-N 3.12Å
75	D	65.9	Low	62.2	Low	118 Å²	118	114.6 Å²	114.6	63%	0.631	58%	0.58	S	S	*	*	H	α-helix	trans	-65.5	-41.5	176.5	-72.4	-16	0	0	0	111.5	G71 M72 Y78 S79	G71-D75 PolarHBondContact O-N 2.83Å; M72-D75 PolarHBondContact O-N 3.18Å; D75-Y78 PolarHBondContact O-N 3.32Å; D75-S79 WeakPolarHBondContact O-CB 3.48Å; D75-S79 PolarHBondContact O-N 3.22Å
76	L	59	Low	61.3	Low	109 Å²	109	114.1 Å²	114.1	57%	0.571	58%	0.576	S	S	*	*	H	α-helix	trans	-63.8	-43.1	174.6	-76	170.1	0	0	0	111.8	M72 V73 S79 F80	M72-L76 WeakPolarHBondContact O-CB 3.24Å; M72-L76 VanDerWaalsContact O-CG 3.29Å; M72-L76 WeakPolarHBondContact O-CG 3.41Å; M72-L76 PolarHBondContact O-N 3.19Å; V73-L76 PolarHBondContact O-N 3.48Å; L76-S79 PolarHBondContact O-N 2.88Å; L76-F80 WeakPolarHBondContact O-CB 3.45Å; L76-F80 PolarHBondContact O-N 2.68Å
77	L	58.5	Low	60.5	Low	85 Å²	85	111.8 Å²	111.8	45%	0.445	58%	0.576	S	S	.	*	H	α-helix	trans	-66.6	-42.2	177.3	-71.3	175.4	0	0	0	111.5	V73 N74 S79 F80 F81	V73-L77 HydrophobicContact CG1-CD1 3.97Å; V73-L77 HydrophobicContact CG1-CG 4.33Å; V73-L77 WeakPolarHBondContact O-CB 3.41Å; V73-L77 VanDerWaalsContact O-CG 3.27Å; V73-L77 WeakPolarHBondContact O-CG 3.34Å; V73-L77 PolarHBondContact O-N 3.21Å; N74-L77 PolarHBondContact O-N 3.4Å; L77-S79 VanDerWaalsContact C-N 3.33Å; L77-S79 PolarHBondContact O-N 3.22Å; L77-F80 PolarHBondContact O-N 3.3Å; L77-F81 WeakPolarHBondContact O-CD2 3.31Å; L77-F81 PolarHBondContact O-N 3.32Å
78	Y	55.1	Low	59.8	Low	174 Å²	174	113 Å²	113	68%	0.682	59%	0.586	S	S	*	*	H	α-helix	trans	-61.9	-41.9	174	-111.1	-92.4	0	0	0	111.4	N74 D75 F80 F81 V82	N74-Y78 WeakPolarHBondContact O-CB 3.47Å; N74-Y78 PolarHBondContact O-N 3.12Å; D75-Y78 PolarHBondContact O-N 3.32Å; Y78-F80 VanDerWaalsContact C-N 3.32Å; Y78-F80 PolarHBondContact O-N 3.29Å; Y78-F81 PolarHBondContact O-N 3.46Å; Y78-V82 HydrophobicContact CD1-CG2 3.96Å; Y78-V82 VanDerWaalsContact O-CB 3.23Å; Y78-V82 WeakPolarHBondContact O-CB 3.39Å; Y78-V82 WeakPolarHBondContact O-CG2 3.34Å; Y78-V82 PolarHBondContact O-N 3.1Å
79	S	60	Low	58.9	Low	68 Å²	68	114.9 Å²	114.9	48%	0.476	60%	0.595	S	S	.	*	H	α-helix	trans	-64.2	-35.9	175.1	-173.3	0	0	0	0	112.5	D75 L76 L77	D75-S79 WeakPolarHBondContact O-CB 3.48Å; D75-S79 PolarHBondContact O-N 3.22Å; L76-S79 PolarHBondContact O-N 2.88Å; L77-S79 VanDerWaalsContact C-N 3.33Å; L77-S79 PolarHBondContact O-N 3.22Å
80	F	53.6	Low	58.2	Low	153 Å²	153	113.3 Å²	113.3	67%	0.671	59%	0.594	S	S	*	*	H	α-helix	trans	-71.9	-40.2	177.4	-104.8	-89.9	0	0	0	112.6	L76 L77 Y78 A84	L76-F80 WeakPolarHBondContact O-CB 3.45Å; L76-F80 PolarHBondContact O-N 2.68Å; L77-F80 PolarHBondContact O-N 3.3Å; Y78-F80 VanDerWaalsContact C-N 3.32Å; Y78-F80 PolarHBondContact O-N 3.29Å; F80-A84 WeakPolarHBondContact O-CB 3.25Å; F80-A84 PolarHBondContact O-N 2.65Å
81	F	52.8	Low	57.8	Low	166 Å²	166	114.4 Å²	114.4	73%	0.728	60%	0.6	S	S	*	*	H	α-helix	trans	-86.2	-20.1	-177	-83.7	-81.6	0	0	0	114.3	L77 Y78	L77-F81 WeakPolarHBondContact O-CD2 3.31Å; L77-F81 PolarHBondContact O-N 3.32Å; Y78-F81 PolarHBondContact O-N 3.46Å
82	V	55.7	Low	57.1	Low	99 Å²	99	120.8 Å²	120.8	60%	0.6	62%	0.623	S	S	*	*	H	α-helix	trans	-84.3	-19.5	174.6	174.5	0	0	0	0	111.9	Y78	Y78-V82 HydrophobicContact CD1-CG2 3.96Å; Y78-V82 VanDerWaalsContact O-CB 3.23Å; Y78-V82 WeakPolarHBondContact O-CB 3.39Å; Y78-V82 WeakPolarHBondContact O-CG2 3.34Å; Y78-V82 PolarHBondContact O-N 3.1Å
83	Y	50	Low	56.6	Low	208 Å²	208	121.3 Å²	121.3	82%	0.816	63%	0.627	S	S	*	*			trans	-113.2	9.7	179.4	-80.9	-83.2	0	0	0	115.1
84	A	46.1	Very low	56.2	Low	135 Å²	135	127.3 Å²	127.3	100%	1.116	65%	0.654	S	S	*	*			trans	-110.2	0	172.3	0	0	0	0	0	110.9	F80	F80-A84 WeakPolarHBondContact O-CB 3.25Å; F80-A84 PolarHBondContact O-N 2.65Å

Retrieved 84 of 84 residues in 24.2 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).