A0A078BPJ1_CAEEL Loading...

TSC22 domain family protein 1

AlphaFold DB , UniProt , Accession A0A078BPJ1, Species CAEEL (Caenorhabditis elegans), Gene n/a, Length 56 aa.

						>A0A078BPJ1_CAEEL|A0A078BPJ1
MDLVKTHLMFAVREEVDGLRGKIFDLENHVRRLEAENSILKRTIPNDTLKQLHLKL
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	61.4	Low	81.9	Confident	212 Å²	212	118.4 Å²	118.4	100%	1.044	61%	0.61	S	S	*	*				0	-32.2	0	-150.9	-172.8	-165.7	0	0	111.9
2	D	77.4	Confident	82.5	Confident	113 Å²	113	114.6 Å²	114.6	60%	0.604	60%	0.596	S	S	*	*	H	α-helix	trans	-73.4	-29.5	-176.9	-65.5	-53.2	0	0	0	116.1	V4 K5 T6	D2-V4 PolarHBondContact O-N 3.35Å; D2-K5 PolarHBondContact O-N 3.46Å; D2-T6 WeakPolarHBondContact O-CB 3.47Å; D2-T6 PolarHBondContact O-N 2.96Å; D2-T6 PolarHBondContact O-OG1 3.16Å
3	L	81.9	Confident	83.2	Confident	146 Å²	146	118.5 Å²	118.5	76%	0.764	60%	0.599	S	S	*	*	H	α-helix	trans	-65	-43.9	-177.2	-172.1	64.7	0	0	0	113	T6 H7	L3-T6 PolarHBondContact O-N 3.04Å; L3-H7 WeakPolarHBondContact O-CB 3.24Å; L3-H7 PolarHBondContact O-N 3.06Å
4	V	79.2	Confident	83.9	Confident	115 Å²	115	120.6 Å²	120.6	70%	0.697	61%	0.605	S	S	*	*	H	α-helix	trans	-67.5	-39	178.9	178.4	0	0	0	0	111	D2 H7 L8	D2-V4 PolarHBondContact O-N 3.35Å; V4-H7 PolarHBondContact O-N 3.45Å; V4-L8 WeakPolarHBondContact O-CB 3.31Å; V4-L8 PolarHBondContact O-N 3.07Å
5	K	83.4	Confident	84.5	Confident	113 Å²	113	121.6 Å²	121.6	49%	0.491	61%	0.607	S	S	.	*	H	α-helix	trans	-61.7	-46.9	175.5	180	-174.3	-75	173.3	0	110.9	D2 L8 M9	D2-K5 PolarHBondContact O-N 3.46Å; K5-L8 PolarHBondContact O-N 3.14Å; K5-M9 HydrophobicContact CD-CE 3.91Å; K5-M9 HydrophobicContact CG-CE 3.68Å; K5-M9 HydrophobicContact CG-SD 4.42Å; K5-M9 WeakPolarHBondContact O-CG 3.31Å; K5-M9 PolarHBondContact O-N 3.18Å
6	T	82.8	Confident	85.1	Confident	65 Å²	65	117.6 Å²	117.6	40%	0.399	59%	0.591	S	S	.	*	H	α-helix	trans	-63.4	-45.1	177.4	-62	0	0	0	0	111.5	D2 L3 L8 M9 F10	D2-T6 WeakPolarHBondContact O-CB 3.47Å; D2-T6 PolarHBondContact O-N 2.96Å; D2-T6 PolarHBondContact O-OG1 3.16Å; L3-T6 PolarHBondContact O-N 3.04Å; T6-L8 VanDerWaalsContact C-N 3.35Å; T6-L8 PolarHBondContact O-N 3.34Å; T6-M9 PolarHBondContact O-N 3.27Å; T6-F10 HydrophobicContact CG2-CD2 3.71Å; T6-F10 HydrophobicContact CG2-CE2 3.44Å; T6-F10 VanDerWaalsContact CG2-CE2 3.44Å; T6-F10 WeakPolarHBondContact O-CD2 3.25Å; T6-F10 PolarHBondContact O-N 3.2Å
7	H	84.6	Confident	85.6	Confident	142 Å²	142	114.9 Å²	114.9	66%	0.657	58%	0.579	S	S	*	*	H	α-helix	trans	-63.4	-40.3	179.2	-154	72.4	0	0	0	112.3	L3 V4 F10 A11	L3-H7 WeakPolarHBondContact O-CB 3.24Å; L3-H7 PolarHBondContact O-N 3.06Å; V4-H7 PolarHBondContact O-N 3.45Å; H7-F10 PolarHBondContact O-N 3.11Å; H7-A11 PolarHBondContact O-N 3.34Å
8	L	86.3	Confident	86.1	Confident	113 Å²	113	111.2 Å²	111.2	59%	0.592	57%	0.574	S	S	*	*	H	α-helix	trans	-66.7	-40.5	175.2	-171.3	66.5	0	0	0	111.9	V4 K5 T6 F10 A11 V12	V4-L8 WeakPolarHBondContact O-CB 3.31Å; V4-L8 PolarHBondContact O-N 3.07Å; K5-L8 PolarHBondContact O-N 3.14Å; T6-L8 VanDerWaalsContact C-N 3.35Å; T6-L8 PolarHBondContact O-N 3.34Å; L8-F10 VanDerWaalsContact C-N 3.31Å; L8-F10 PolarHBondContact O-N 3.14Å; L8-A11 PolarHBondContact O-N 3.07Å; L8-V12 HydrophobicContact CD1-CG2 4.2Å; L8-V12 HydrophobicContact CG-CG2 4.23Å; L8-V12 VanDerWaalsContact O-CB 3.31Å; L8-V12 WeakPolarHBondContact O-CB 3.31Å; L8-V12 WeakPolarHBondContact O-CG2 3.43Å; L8-V12 PolarHBondContact O-N 3.32Å
9	M	87.6	Confident	86.7	Confident	122 Å²	122	111.2 Å²	111.2	60%	0.601	57%	0.574	S	S	*	*	H	α-helix	trans	-61.2	-39.7	174.9	-76.8	178.3	-174.7	0	0	112.2	K5 T6 R13	K5-M9 HydrophobicContact CD-CE 3.91Å; K5-M9 HydrophobicContact CG-CE 3.68Å; K5-M9 HydrophobicContact CG-SD 4.42Å; K5-M9 WeakPolarHBondContact O-CG 3.31Å; K5-M9 PolarHBondContact O-N 3.18Å; T6-M9 PolarHBondContact O-N 3.27Å; M9-R13 WeakPolarHBondContact O-CB 3.36Å; M9-R13 PolarHBondContact O-N 2.96Å
10	F	88.4	Confident	87.2	Confident	120 Å²	120	113.6 Å²	113.6	53%	0.526	58%	0.575	S	S	.	*	H	α-helix	trans	-65.9	-51	175.5	-81.5	-68.5	0	0	0	111.8	T6 H7 L8 V12 R13 E14	T6-F10 HydrophobicContact CG2-CD2 3.71Å; T6-F10 HydrophobicContact CG2-CE2 3.44Å; T6-F10 VanDerWaalsContact CG2-CE2 3.44Å; T6-F10 WeakPolarHBondContact O-CD2 3.25Å; T6-F10 PolarHBondContact O-N 3.2Å; H7-F10 PolarHBondContact O-N 3.11Å; L8-F10 VanDerWaalsContact C-N 3.31Å; L8-F10 PolarHBondContact O-N 3.14Å; F10-V12 PolarHBondContact O-N 3.4Å; F10-R13 PolarHBondContact O-N 2.86Å; F10-R13 VanDerWaalsContact O-N 3.13Å; F10-E14 PolarHBondContact O-N 3.41Å
11	A	87.9	Confident	87.6	Confident	41 Å²	41	109.7 Å²	109.7	34%	0.339	56%	0.564	S	S	.	*	H	α-helix	trans	-58.7	-45.8	179.8	0	0	0	0	0	112.1	H7 L8 R13 E14 E15	H7-A11 PolarHBondContact O-N 3.34Å; L8-A11 PolarHBondContact O-N 3.07Å; A11-R13 VanDerWaalsContact C-N 3.33Å; A11-R13 PolarHBondContact O-N 3.26Å; A11-E14 PolarHBondContact O-N 3.42Å; A11-E15 WeakPolarHBondContact O-CG 3.07Å; A11-E15 PolarHBondContact O-N 2.86Å
12	V	89.6	Confident	89.2	Confident	73 Å²	73	106.2 Å²	106.2	44%	0.442	54%	0.543	S	S	.	.	H	α-helix	trans	-64.3	-38.9	177.7	172	0	0	0	0	111.3	L8 F10 E15 V16	L8-V12 HydrophobicContact CD1-CG2 4.2Å; L8-V12 HydrophobicContact CG-CG2 4.23Å; L8-V12 VanDerWaalsContact O-CB 3.31Å; L8-V12 WeakPolarHBondContact O-CB 3.31Å; L8-V12 WeakPolarHBondContact O-CG2 3.43Å; L8-V12 PolarHBondContact O-N 3.32Å; F10-V12 PolarHBondContact O-N 3.4Å; V12-E15 PolarHBondContact O-N 2.91Å; V12-V16 HydrophobicContact CG1-CG2 4.42Å; V12-V16 WeakPolarHBondContact O-CB 3.37Å; V12-V16 VanDerWaalsContact O-CG2 3.24Å; V12-V16 WeakPolarHBondContact O-CG2 3.26Å; V12-V16 PolarHBondContact O-N 3.21Å
13	R	91.4	Very high	90.1	Very high	166 Å²	166	105.4 Å²	105.4	63%	0.626	54%	0.537	S	S	*	.	H	α-helix	trans	-65.1	-45.7	177.4	-177.9	175	179.6	172.3	2.2	111.7	M9 F10 A11 V16 D17	M9-R13 WeakPolarHBondContact O-CB 3.36Å; M9-R13 PolarHBondContact O-N 2.96Å; F10-R13 PolarHBondContact O-N 2.86Å; F10-R13 VanDerWaalsContact O-N 3.13Å; A11-R13 VanDerWaalsContact C-N 3.33Å; A11-R13 PolarHBondContact O-N 3.26Å; R13-V16 PolarHBondContact O-N 3.5Å; R13-D17 IonicContact NE-OD2 3.88Å; R13-D17 WeakPolarHBondContact O-CB 3.49Å; R13-D17 PolarHBondContact O-N 2.98Å
14	E	92.3	Very high	90.8	Very high	147 Å²	147	104 Å²	104	69%	0.687	53%	0.526	S	S	*	.	H	α-helix	trans	-62.2	-42.5	177.2	-72.4	-172.6	113.3	0	0	111.7	F10 A11 D17 G18	F10-E14 PolarHBondContact O-N 3.41Å; A11-E14 PolarHBondContact O-N 3.42Å; E14-D17 PolarHBondContact O-N 3.24Å; E14-G18 PolarHBondContact O-N 2.98Å
15	E	92.9	Very high	91.7	Very high	136 Å²	136	103.6 Å²	103.6	64%	0.636	52%	0.52	S	S	*	.	H	α-helix	trans	-61.9	-44.3	174.9	-76.3	-173.9	174.5	0	0	112	A11 V12 G18 L19	A11-E15 WeakPolarHBondContact O-CG 3.07Å; A11-E15 PolarHBondContact O-N 2.86Å; V12-E15 PolarHBondContact O-N 2.91Å; E15-G18 PolarHBondContact O-N 3.47Å; E15-L19 WeakPolarHBondContact O-CB 3.28Å; E15-L19 VanDerWaalsContact O-CG 3.26Å; E15-L19 WeakPolarHBondContact O-CG 3.44Å; E15-L19 PolarHBondContact O-N 3.41Å
16	V	94.3	Very high	92.3	Very high	57 Å²	57	103 Å²	103	35%	0.345	52%	0.521	S	S	.	.	H	α-helix	trans	-64.1	-44.3	178	168.3	0	0	0	0	111.5	V12 R13 G18 L19 R20	V12-V16 HydrophobicContact CG1-CG2 4.42Å; V12-V16 WeakPolarHBondContact O-CB 3.37Å; V12-V16 VanDerWaalsContact O-CG2 3.24Å; V12-V16 WeakPolarHBondContact O-CG2 3.26Å; V12-V16 PolarHBondContact O-N 3.21Å; R13-V16 PolarHBondContact O-N 3.5Å; V16-G18 VanDerWaalsContact C-N 3.35Å; V16-L19 PolarHBondContact O-N 2.86Å; V16-R20 WeakPolarHBondContact O-CB 3.49Å; V16-R20 VanDerWaalsContact O-CG 3.3Å; V16-R20 WeakPolarHBondContact O-CG 3.49Å; V16-R20 PolarHBondContact O-N 2.86Å
17	D	94.5	Very high	93	Very high	73 Å²	73	104.6 Å²	104.6	39%	0.39	52%	0.524	S	S	.	.	H	α-helix	trans	-67.4	-37.6	179	-71.6	-20.6	0	0	0	111	R13 E14 R20 G21	R13-D17 IonicContact NE-OD2 3.88Å; R13-D17 WeakPolarHBondContact O-CB 3.49Å; R13-D17 PolarHBondContact O-N 2.98Å; E14-D17 PolarHBondContact O-N 3.24Å; D17-R20 PolarHBondContact O-N 2.82Å; D17-R20 IonicContact OD1-NH1 3.95Å; D17-R20 PolarHBondContact OD1-NH1 3.42Å; D17-G21 PolarHBondContact O-N 3.09Å
18	G	94.8	Very high	93.5	Very high	47 Å²	47	100.3 Å²	100.3	49%	0.485	51%	0.506	S	S	.	.	H	α-helix	trans	-63.8	-43.6	172.5	0	0	0	0	0	113.3	E14 E15 V16 G21 K22	E14-G18 PolarHBondContact O-N 2.98Å; E15-G18 PolarHBondContact O-N 3.47Å; V16-G18 VanDerWaalsContact C-N 3.35Å; G18-G21 PolarHBondContact O-N 2.96Å; G18-K22 PolarHBondContact O-N 3.25Å
19	L	96.5	Very high	94	Very high	112 Å²	112	98.9 Å²	98.9	59%	0.586	50%	0.496	S	S	*	.	H	α-helix	trans	-64.2	-41.4	175.6	-73.3	174.6	0	0	0	111.8	E15 V16 K22 I23	E15-L19 WeakPolarHBondContact O-CB 3.28Å; E15-L19 VanDerWaalsContact O-CG 3.26Å; E15-L19 WeakPolarHBondContact O-CG 3.44Å; E15-L19 PolarHBondContact O-N 3.41Å; V16-L19 PolarHBondContact O-N 2.86Å; L19-K22 PolarHBondContact O-N 2.89Å; L19-I23 VanDerWaalsContact O-CG1 3.32Å; L19-I23 WeakPolarHBondContact O-CG1 3.46Å; L19-I23 PolarHBondContact O-N 3.3Å
20	R	96.1	Very high	94.4	Very high	158 Å²	158	96.5 Å²	96.5	60%	0.596	49%	0.488	S	S	*	.	H	α-helix	trans	-60.3	-44.3	175	-76.8	170.8	174.6	164.5	-3.6	112.1	V16 D17 K22 I23 F24	V16-R20 WeakPolarHBondContact O-CB 3.49Å; V16-R20 VanDerWaalsContact O-CG 3.3Å; V16-R20 WeakPolarHBondContact O-CG 3.49Å; V16-R20 PolarHBondContact O-N 2.86Å; D17-R20 PolarHBondContact O-N 2.82Å; D17-R20 IonicContact OD1-NH1 3.95Å; D17-R20 PolarHBondContact OD1-NH1 3.42Å; R20-K22 VanDerWaalsContact C-N 3.35Å; R20-I23 PolarHBondContact O-N 3Å; R20-F24 PolarHBondContact O-N 3.26Å
21	G	96.4	Very high	94.8	Very high	32 Å²	32	97 Å²	97	33%	0.33	49%	0.487	S	S	.	.	H	α-helix	trans	-59	-46.5	174.5	0	0	0	0	0	111.8	D17 G18 I23 F24 D25	D17-G21 PolarHBondContact O-N 3.09Å; G18-G21 PolarHBondContact O-N 2.96Å; G21-I23 VanDerWaalsContact C-N 3.35Å; G21-I23 PolarHBondContact O-N 3.06Å; G21-F24 WeakPolarHBondContact O-CB 3.48Å; G21-F24 PolarHBondContact O-N 3.08Å; G21-F24 VanDerWaalsContact O-N 3.16Å; G21-D25 PolarHBondContact O-N 3.04Å
22	K	95.6	Very high	95.1	Very high	139 Å²	139	101.7 Å²	101.7	60%	0.604	50%	0.496	S	S	*	.	H	α-helix	trans	-63	-38.9	178.4	-169.6	164.4	-177	174	0	113.1	G18 L19 R20 L26	G18-K22 PolarHBondContact O-N 3.25Å; L19-K22 PolarHBondContact O-N 2.89Å; R20-K22 VanDerWaalsContact C-N 3.35Å; K22-L26 HydrophobicContact CG-CD1 4.17Å; K22-L26 WeakPolarHBondContact O-CB 3.37Å; K22-L26 VanDerWaalsContact O-CG 3.25Å; K22-L26 WeakPolarHBondContact O-CG 3.4Å; K22-L26 PolarHBondContact O-N 2.97Å
23	I	96.5	Very high	95.3	Very high	96 Å²	96	101.5 Å²	101.5	49%	0.492	49%	0.491	S	S	.	.	H	α-helix	trans	-60.9	-48.8	173.4	-70.3	165	0	0	0	109.8	L19 R20 G21 D25 L26 E27	L19-I23 VanDerWaalsContact O-CG1 3.32Å; L19-I23 WeakPolarHBondContact O-CG1 3.46Å; L19-I23 PolarHBondContact O-N 3.3Å; R20-I23 PolarHBondContact O-N 3Å; G21-I23 VanDerWaalsContact C-N 3.35Å; G21-I23 PolarHBondContact O-N 3.06Å; I23-D25 VanDerWaalsContact C-N 3.34Å; I23-D25 PolarHBondContact O-N 3.47Å; I23-L26 PolarHBondContact O-N 2.95Å; I23-E27 HydrophobicContact CG2-CG 4.34Å; I23-E27 WeakPolarHBondContact O-CG 3.43Å; I23-E27 PolarHBondContact O-N 2.93Å
24	F	96.6	Very high	95.4	Very high	118 Å²	118	99.4 Å²	99.4	52%	0.518	49%	0.489	S	S	.	.	H	α-helix	trans	-58.9	-43.9	179.9	-178.4	-101.4	0	0	0	112.5	R20 G21 E27 N28	R20-F24 PolarHBondContact O-N 3.26Å; G21-F24 WeakPolarHBondContact O-CB 3.48Å; G21-F24 PolarHBondContact O-N 3.08Å; G21-F24 VanDerWaalsContact O-N 3.16Å; F24-E27 PolarHBondContact O-N 3.16Å; F24-N28 VanDerWaalsContact CD1-ND2 3.28Å; F24-N28 WeakPolarHBondContact CD1-ND2 3.32Å; F24-N28 WeakPolarHBondContact CE1-ND2 3.38Å; F24-N28 VanDerWaalsContact CZ-ND2 3.31Å; F24-N28 WeakPolarHBondContact CZ-ND2 3.47Å; F24-N28 VanDerWaalsContact O-CG 3.3Å; F24-N28 PolarHBondContact O-N 3.01Å; F24-N28 PolarHBondContact O-ND2 3.24Å; F24-N28 VanDerWaalsContact O-ND2 3.08Å
25	D	96.7	Very high	95.4	Very high	106 Å²	106	94.8 Å²	94.8	57%	0.567	48%	0.476	S	S	*	.	H	α-helix	trans	-64.9	-42.4	178.1	-70.8	-20.8	0	0	0	112.2	G21 I23 N28 H29	G21-D25 PolarHBondContact O-N 3.04Å; I23-D25 VanDerWaalsContact C-N 3.34Å; I23-D25 PolarHBondContact O-N 3.47Å; D25-N28 PolarHBondContact O-N 3.38Å; D25-H29 WeakPolarHBondContact O-CB 3.32Å; D25-H29 PolarHBondContact O-N 3.4Å
26	L	97	Very high	95.2	Very high	99 Å²	99	92.7 Å²	92.7	52%	0.518	47%	0.466	S	S	.	.	H	α-helix	trans	-64.3	-42.8	176.7	-74.3	170.6	0	0	0	111.6	K22 I23 N28 H29 V30	K22-L26 HydrophobicContact CG-CD1 4.17Å; K22-L26 WeakPolarHBondContact O-CB 3.37Å; K22-L26 VanDerWaalsContact O-CG 3.25Å; K22-L26 WeakPolarHBondContact O-CG 3.4Å; K22-L26 PolarHBondContact O-N 2.97Å; I23-L26 PolarHBondContact O-N 2.95Å; L26-N28 VanDerWaalsContact C-N 3.34Å; L26-N28 PolarHBondContact O-N 2.89Å; L26-H29 WeakPolarHBondContact O-CB 3.41Å; L26-H29 PolarHBondContact O-N 3.35Å; L26-V30 WeakPolarHBondContact O-CG2 3.48Å; L26-V30 PolarHBondContact O-N 2.91Å
27	E	96.6	Very high	94.9	Very high	100 Å²	100	93.8 Å²	93.8	47%	0.467	47%	0.47	S	S	.	.	H	α-helix	trans	-61.6	-41.6	175.8	-74.5	-178.2	165.7	0	0	112.1	I23 F24 H29 V30 R31	I23-E27 HydrophobicContact CG2-CG 4.34Å; I23-E27 WeakPolarHBondContact O-CG 3.43Å; I23-E27 PolarHBondContact O-N 2.93Å; F24-E27 PolarHBondContact O-N 3.16Å; E27-H29 VanDerWaalsContact C-N 3.33Å; E27-V30 PolarHBondContact O-N 3.21Å; E27-R31 WeakPolarHBondContact O-CB 3.4Å; E27-R31 WeakPolarHBondContact O-CG 3.25Å; E27-R31 PolarHBondContact O-N 2.92Å; E27-R31 IonicContact OE2-NH2 3.26Å
28	N	96.4	Very high	94.5	Very high	52 Å²	52	92.6 Å²	92.6	28%	0.278	47%	0.468	S	S	.	.	H	α-helix	trans	-65.6	-38.7	175.5	-71.6	-37.2	0	0	0	111.6	F24 D25 L26 R31 R32	F24-N28 VanDerWaalsContact CD1-ND2 3.28Å; F24-N28 WeakPolarHBondContact CD1-ND2 3.32Å; F24-N28 WeakPolarHBondContact CE1-ND2 3.38Å; F24-N28 VanDerWaalsContact CZ-ND2 3.31Å; F24-N28 WeakPolarHBondContact CZ-ND2 3.47Å; F24-N28 VanDerWaalsContact O-CG 3.3Å; F24-N28 PolarHBondContact O-N 3.01Å; F24-N28 PolarHBondContact O-ND2 3.24Å; F24-N28 VanDerWaalsContact O-ND2 3.08Å; D25-N28 PolarHBondContact O-N 3.38Å; L26-N28 VanDerWaalsContact C-N 3.34Å; L26-N28 PolarHBondContact O-N 2.89Å; N28-R31 PolarHBondContact O-N 3.46Å; N28-R31 VanDerWaalsContact OD1-CZ 3.23Å; N28-R31 PolarHBondContact OD1-NH1 3.02Å; N28-R31 PolarHBondContact OD1-NH2 3.42Å; N28-R32 WeakPolarHBondContact O-CB 3.41Å; N28-R32 PolarHBondContact O-N 3.03Å
29	H	96.9	Very high	94.1	Very high	83 Å²	83	95.3 Å²	95.3	38%	0.384	47%	0.47	S	S	.	.	H	α-helix	trans	-63.8	-45.8	176.4	-170.4	68.9	0	0	0	111.8	D25 L26 E27 R32 L33	D25-H29 WeakPolarHBondContact O-CB 3.32Å; D25-H29 PolarHBondContact O-N 3.4Å; L26-H29 WeakPolarHBondContact O-CB 3.41Å; L26-H29 PolarHBondContact O-N 3.35Å; E27-H29 VanDerWaalsContact C-N 3.33Å; H29-R32 PolarHBondContact CE1-NH2 3.08Å; H29-R32 PolarHBondContact ND1-NH2 3.26Å; H29-R32 VanDerWaalsContact ND1-NH2 3.13Å; H29-R32 PolarHBondContact O-N 3.39Å; H29-L33 WeakPolarHBondContact NE2-CD1 3.31Å; H29-L33 WeakPolarHBondContact O-CG 3.43Å; H29-L33 PolarHBondContact O-N 3.39Å
30	V	95.9	Very high	93.5	Very high	71 Å²	71	94.6 Å²	94.6	43%	0.43	47%	0.466	S	S	.	.	H	α-helix	trans	-59.4	-50.4	175	170.4	0	0	0	0	110.4	L26 E27 R32 L33 E34	L26-V30 WeakPolarHBondContact O-CG2 3.48Å; L26-V30 PolarHBondContact O-N 2.91Å; E27-V30 PolarHBondContact O-N 3.21Å; V30-R32 VanDerWaalsContact C-N 3.26Å; V30-R32 PolarHBondContact O-N 3.13Å; V30-L33 PolarHBondContact O-N 2.94Å; V30-L33 VanDerWaalsContact O-N 3.09Å; V30-E34 HydrophobicContact CG1-CG 4.16Å; V30-E34 WeakPolarHBondContact O-CB 2.98Å; V30-E34 WeakPolarHBondContact O-CG 3.28Å; V30-E34 PolarHBondContact O-N 3.37Å
31	R	95.5	Very high	92.7	Very high	132 Å²	132	93.9 Å²	93.9	50%	0.498	47%	0.467	S	S	.	.	H	α-helix	trans	-56.7	-40.1	178.5	-82	-173.9	-98.3	132.4	-1.9	112.5	E27 N28 A35	E27-R31 WeakPolarHBondContact O-CB 3.4Å; E27-R31 WeakPolarHBondContact O-CG 3.25Å; E27-R31 PolarHBondContact O-N 2.92Å; E27-R31 IonicContact OE2-NH2 3.26Å; N28-R31 PolarHBondContact O-N 3.46Å; N28-R31 VanDerWaalsContact OD1-CZ 3.23Å; N28-R31 PolarHBondContact OD1-NH1 3.02Å; N28-R31 PolarHBondContact OD1-NH2 3.42Å; R31-A35 WeakPolarHBondContact O-CB 3.24Å; R31-A35 PolarHBondContact O-N 3.36Å
32	R	95	Very high	91.8	Very high	139 Å²	139	102.2 Å²	102.2	53%	0.525	49%	0.489	S	S	.	.	H	α-helix	trans	-64.9	-48.1	175.7	-172.6	177.9	69.4	-156	3.1	111.4	N28 H29 V30 E34 A35 E36	N28-R32 WeakPolarHBondContact O-CB 3.41Å; N28-R32 PolarHBondContact O-N 3.03Å; H29-R32 PolarHBondContact CE1-NH2 3.08Å; H29-R32 PolarHBondContact ND1-NH2 3.26Å; H29-R32 VanDerWaalsContact ND1-NH2 3.13Å; H29-R32 PolarHBondContact O-N 3.39Å; V30-R32 VanDerWaalsContact C-N 3.26Å; V30-R32 PolarHBondContact O-N 3.13Å; R32-E34 VanDerWaalsContact C-N 3.31Å; R32-E34 PolarHBondContact O-N 3.41Å; R32-A35 PolarHBondContact O-N 3.26Å; R32-E36 WeakPolarHBondContact CG-OE1 3.3Å; R32-E36 IonicContact NE-OE1 3.89Å; R32-E36 WeakPolarHBondContact O-CG 3.44Å; R32-E36 PolarHBondContact O-N 2.95Å
33	L	94.3	Very high	90.7	Very high	68 Å²	68	100.8 Å²	100.8	36%	0.356	49%	0.492	S	S	.	.	H	α-helix	trans	-63.7	-35.1	178.6	-73.6	176.5	0	0	0	112.8	H29 V30 N37	H29-L33 WeakPolarHBondContact NE2-CD1 3.31Å; H29-L33 WeakPolarHBondContact O-CG 3.43Å; H29-L33 PolarHBondContact O-N 3.39Å; V30-L33 PolarHBondContact O-N 2.94Å; V30-L33 VanDerWaalsContact O-N 3.09Å; L33-N37 VanDerWaalsContact O-CB 3.26Å; L33-N37 WeakPolarHBondContact O-CB 3.26Å; L33-N37 PolarHBondContact O-N 3.01Å; L33-N37 PolarHBondContact O-ND2 3.01Å; L33-N37 VanDerWaalsContact O-ND2 3.08Å
34	E	93.1	Very high	89.5	Confident	122 Å²	122	99 Å²	99	57%	0.57	48%	0.482	S	S	*	.	H	α-helix	trans	-67.1	-42.9	174.9	-74.6	179.2	157.1	0	0	111.6	V30 R32 N37 S38	V30-E34 HydrophobicContact CG1-CG 4.16Å; V30-E34 WeakPolarHBondContact O-CB 2.98Å; V30-E34 WeakPolarHBondContact O-CG 3.28Å; V30-E34 PolarHBondContact O-N 3.37Å; R32-E34 VanDerWaalsContact C-N 3.31Å; R32-E34 PolarHBondContact O-N 3.41Å; E34-N37 PolarHBondContact O-N 2.88Å; E34-S38 WeakPolarHBondContact O-CB 3.42Å; E34-S38 PolarHBondContact O-N 3.44Å
35	A	91.2	Very high	88.1	Confident	51 Å²	51	97.2 Å²	97.2	42%	0.421	48%	0.483	S	S	.	.	H	α-helix	trans	-62.1	-47.8	174.8	0	0	0	0	0	111.3	R31 R32 N37 S38 I39	R31-A35 WeakPolarHBondContact O-CB 3.24Å; R31-A35 PolarHBondContact O-N 3.36Å; R32-A35 PolarHBondContact O-N 3.26Å; A35-N37 PolarHBondContact O-N 3.13Å; A35-S38 PolarHBondContact O-N 3.5Å; A35-I39 VanDerWaalsContact O-CG1 3.32Å; A35-I39 WeakPolarHBondContact O-CG1 3.31Å; A35-I39 PolarHBondContact O-N 2.89Å
36	E	89.9	Confident	86.8	Confident	91 Å²	91	98.4 Å²	98.4	43%	0.425	49%	0.489	S	S	.	.	H	α-helix	trans	-59.1	-47	175.5	-73.3	174	-160.2	0	0	111.3	R32 S38 I39 L40	R32-E36 WeakPolarHBondContact CG-OE1 3.3Å; R32-E36 IonicContact NE-OE1 3.89Å; R32-E36 WeakPolarHBondContact O-CG 3.44Å; R32-E36 PolarHBondContact O-N 2.95Å; E36-S38 VanDerWaalsContact C-N 3.34Å; E36-S38 PolarHBondContact O-N 2.97Å; E36-I39 PolarHBondContact O-N 3.43Å; E36-L40 WeakPolarHBondContact O-CB 3.48Å; E36-L40 VanDerWaalsContact O-CG 3.28Å; E36-L40 WeakPolarHBondContact O-CG 3.45Å; E36-L40 PolarHBondContact O-N 2.92Å
37	N	87.6	Confident	85.3	Confident	81 Å²	81	99.6 Å²	99.6	43%	0.433	50%	0.496	S	S	.	.	H	α-helix	trans	-60.6	-42	176.2	-96.4	-64.4	0	0	0	112.7	L33 E34 A35 I39 L40 K41	L33-N37 VanDerWaalsContact O-CB 3.26Å; L33-N37 WeakPolarHBondContact O-CB 3.26Å; L33-N37 PolarHBondContact O-N 3.01Å; L33-N37 PolarHBondContact O-ND2 3.01Å; L33-N37 VanDerWaalsContact O-ND2 3.08Å; E34-N37 PolarHBondContact O-N 2.88Å; A35-N37 PolarHBondContact O-N 3.13Å; N37-I39 VanDerWaalsContact C-N 3.33Å; N37-L40 PolarHBondContact O-N 3.03Å; N37-K41 VanDerWaalsContact O-CB 3.31Å; N37-K41 WeakPolarHBondContact O-CB 3.44Å; N37-K41 VanDerWaalsContact O-CG 3.24Å; N37-K41 WeakPolarHBondContact O-CG 3.33Å; N37-K41 PolarHBondContact O-N 3.4Å
38	S	86.6	Confident	83.9	Confident	48 Å²	48	98 Å²	98	34%	0.336	49%	0.494	S	S	.	.	H	α-helix	trans	-63.6	-41.5	177.9	175.3	0	0	0	0	111.2	E34 A35 E36 R42	E34-S38 WeakPolarHBondContact O-CB 3.42Å; E34-S38 PolarHBondContact O-N 3.44Å; A35-S38 PolarHBondContact O-N 3.5Å; E36-S38 VanDerWaalsContact C-N 3.34Å; E36-S38 PolarHBondContact O-N 2.97Å; S38-R42 VanDerWaalsContact O-CG 3.25Å; S38-R42 WeakPolarHBondContact O-CG 3.14Å; S38-R42 PolarHBondContact O-N 2.92Å; S38-R42 VanDerWaalsContact O-N 3.14Å
39	I	85.7	Confident	82.4	Confident	104 Å²	104	98.4 Å²	98.4	53%	0.533	50%	0.495	S	S	.	.	H	α-helix	trans	-64.6	-49.4	175.9	-67.2	164.8	0	0	0	110.1	A35 E36 N37 K41 R42 T43	A35-I39 VanDerWaalsContact O-CG1 3.32Å; A35-I39 WeakPolarHBondContact O-CG1 3.31Å; A35-I39 PolarHBondContact O-N 2.89Å; E36-I39 PolarHBondContact O-N 3.43Å; N37-I39 VanDerWaalsContact C-N 3.33Å; I39-K41 VanDerWaalsContact C-N 3.35Å; I39-K41 PolarHBondContact O-N 3.42Å; I39-R42 PolarHBondContact O-N 2.97Å; I39-R42 VanDerWaalsContact O-N 3.11Å; I39-T43 WeakPolarHBondContact O-CB 3.22Å; I39-T43 PolarHBondContact O-N 3.41Å; I39-T43 PolarHBondContact O-OG1 3.31Å
40	L	82.9	Confident	80.9	Confident	96 Å²	96	101.1 Å²	101.1	50%	0.503	51%	0.506	S	S	.	.	H	α-helix	trans	-57.6	-47.3	178.6	-71.7	171	0	0	0	111.2	E36 N37 R42 T43 I44	E36-L40 WeakPolarHBondContact O-CB 3.48Å; E36-L40 VanDerWaalsContact O-CG 3.28Å; E36-L40 WeakPolarHBondContact O-CG 3.45Å; E36-L40 PolarHBondContact O-N 2.92Å; N37-L40 PolarHBondContact O-N 3.03Å; L40-R42 VanDerWaalsContact C-N 3.26Å; L40-R42 PolarHBondContact O-N 2.98Å; L40-T43 PolarHBondContact O-N 3.38Å; L40-I44 HydrophobicContact CB-CD1 4.08Å; L40-I44 VanDerWaalsContact O-CB 3.31Å; L40-I44 WeakPolarHBondContact O-CB 3.44Å; L40-I44 VanDerWaalsContact O-CD1 3.31Å; L40-I44 WeakPolarHBondContact O-CD1 3.36Å; L40-I44 WeakPolarHBondContact O-CG1 3.18Å; L40-I44 PolarHBondContact O-N 2.86Å
41	K	79.7	Confident	79.3	Confident	143 Å²	143	104.5 Å²	104.5	62%	0.622	52%	0.517	S	S	*	.	H	α-helix	trans	-60.8	-31.3	177.4	-75.4	174.1	176.5	180	0	113.6	N37 I39	N37-K41 VanDerWaalsContact O-CB 3.31Å; N37-K41 WeakPolarHBondContact O-CB 3.44Å; N37-K41 VanDerWaalsContact O-CG 3.24Å; N37-K41 WeakPolarHBondContact O-CG 3.33Å; N37-K41 PolarHBondContact O-N 3.4Å; I39-K41 VanDerWaalsContact C-N 3.35Å; I39-K41 PolarHBondContact O-N 3.42Å
42	R	77.2	Confident	77.8	Confident	208 Å²	208	103.6 Å²	103.6	79%	0.785	52%	0.521	S	S	*	.	H	α-helix	trans	-79	-34.5	177	-72.1	172.9	-173.5	-163.8	1.1	112.7	S38 I39 L40	S38-R42 VanDerWaalsContact O-CG 3.25Å; S38-R42 WeakPolarHBondContact O-CG 3.14Å; S38-R42 PolarHBondContact O-N 2.92Å; S38-R42 VanDerWaalsContact O-N 3.14Å; I39-R42 PolarHBondContact O-N 2.97Å; I39-R42 VanDerWaalsContact O-N 3.11Å; L40-R42 VanDerWaalsContact C-N 3.26Å; L40-R42 PolarHBondContact O-N 2.98Å
43	T	73.5	Confident	76.1	Confident	108 Å²	108	104.2 Å²	104.2	66%	0.663	53%	0.53	S	S	*	.	H	α-helix	trans	-85.7	-25.3	-175.7	-53.2	0	0	0	0	112.3	I39 L40 P45	I39-T43 WeakPolarHBondContact O-CB 3.22Å; I39-T43 PolarHBondContact O-N 3.41Å; I39-T43 PolarHBondContact O-OG1 3.31Å; L40-T43 PolarHBondContact O-N 3.38Å; T43-P45 WeakPolarHBondContact O-CD 3.42Å
44	I	72.1	Confident	74.5	Confident	58 Å²	58	108 Å²	108	30%	0.297	55%	0.55	S	S	.	.	S	Bend	trans	-80.4	124	-178.1	-66.2	165.7	0	0	0	110.1	L40 T48 L49	L40-I44 HydrophobicContact CB-CD1 4.08Å; L40-I44 VanDerWaalsContact O-CB 3.31Å; L40-I44 WeakPolarHBondContact O-CB 3.44Å; L40-I44 VanDerWaalsContact O-CD1 3.31Å; L40-I44 WeakPolarHBondContact O-CD1 3.36Å; L40-I44 WeakPolarHBondContact O-CG1 3.18Å; L40-I44 PolarHBondContact O-N 2.86Å; I44-T48 HydrophobicContact CG2-CG2 4.14Å; I44-L49 HydrophobicContact CB-CD1 4.47Å; I44-L49 HydrophobicContact CG2-CB 4.29Å; I44-L49 HydrophobicContact CG2-CD1 4.18Å
45	P	67.2	Low	72.6	Confident	82 Å²	82	111.4 Å²	111.4	53%	0.532	56%	0.563	S	S	.	*			trans	-59.1	143.6	172.4	-21.9	32.9	0	0	0	111.9	T43 D47 T48 L49	T43-P45 WeakPolarHBondContact O-CD 3.42Å; P45-D47 PolarHBondContact O-N 3.25Å; P45-T48 PolarHBondContact O-N 2.97Å; P45-L49 PolarHBondContact O-N 3.44Å; P45-L49 VanDerWaalsContact O-N 3.14Å
46	N	67.4	Low	70.5	Confident	130 Å²	130	119 Å²	119	70%	0.695	60%	0.595	S	S	*	*	H	α-helix	trans	-53.6	-30.9	-177.2	-75.3	-60.5	0	0	0	114	K50	N46-K50 WeakPolarHBondContact O-CG 3.45Å; N46-K50 PolarHBondContact O-N 3Å; N46-K50 VanDerWaalsContact O-N 3.07Å
47	D	66.6	Low	69.5	Low	124 Å²	124	120.4 Å²	120.4	66%	0.663	60%	0.604	S	S	*	*	H	α-helix	trans	-68.3	-39.9	176.6	-79.4	-48.2	0	0	0	113	P45 K50 Q51	P45-D47 PolarHBondContact O-N 3.25Å; D47-K50 PolarHBondContact O-N 3.46Å; D47-Q51 PolarHBondContact O-N 2.95Å
48	T	66.1	Low	68.6	Low	68 Å²	68	122.5 Å²	122.5	42%	0.417	61%	0.613	S	S	.	*	H	α-helix	trans	-70.8	-36	176.5	-42.2	0	0	0	0	111	I44 P45 Q51 L52	I44-T48 HydrophobicContact CG2-CG2 4.14Å; P45-T48 PolarHBondContact O-N 2.97Å; T48-Q51 PolarHBondContact O-N 3.43Å; T48-L52 PolarHBondContact O-N 2.98Å
49	L	66.7	Low	67.6	Low	60 Å²	60	126.6 Å²	126.6	31%	0.314	63%	0.628	S	S	.	*	H	α-helix	trans	-63.7	-40.3	175.5	-155.6	89.2	0	0	0	111.8	I44 P45 L52 H53	I44-L49 HydrophobicContact CB-CD1 4.47Å; I44-L49 HydrophobicContact CG2-CB 4.29Å; I44-L49 HydrophobicContact CG2-CD1 4.18Å; P45-L49 PolarHBondContact O-N 3.44Å; P45-L49 VanDerWaalsContact O-N 3.14Å; L49-L52 PolarHBondContact O-N 2.93Å; L49-H53 PolarHBondContact O-N 3.39Å
50	K	64.8	Low	66.5	Low	139 Å²	139	127.9 Å²	127.9	60%	0.604	63%	0.634	S	S	*	*	H	α-helix	trans	-62.9	-42.3	174.3	-82.1	178.1	177.1	176.7	0	112.3	N46 D47 L52 H53 L54	N46-K50 WeakPolarHBondContact O-CG 3.45Å; N46-K50 PolarHBondContact O-N 3Å; N46-K50 VanDerWaalsContact O-N 3.07Å; D47-K50 PolarHBondContact O-N 3.46Å; K50-L52 VanDerWaalsContact C-N 3.31Å; K50-L52 PolarHBondContact O-N 3.39Å; K50-H53 PolarHBondContact O-N 3.36Å; K50-L54 PolarHBondContact O-N 3.44Å; K50-L54 VanDerWaalsContact O-N 3.16Å
51	Q	62.3	Low	65.5	Low	143 Å²	143	129.9 Å²	129.9	67%	0.668	64%	0.642	S	S	*	*	H	α-helix	trans	-65.6	-33.3	176.3	-75.2	-168	-17.3	0	0	113	D47 T48	D47-Q51 PolarHBondContact O-N 2.95Å; T48-Q51 PolarHBondContact O-N 3.43Å
52	L	62.8	Low	64.5	Low	112 Å²	112	129.1 Å²	129.1	59%	0.586	64%	0.643	S	S	*	*	H	α-helix	trans	-68.4	-42.9	174.7	-133.4	89.9	0	0	0	111.7	T48 L49 K50 L54 K55	T48-L52 PolarHBondContact O-N 2.98Å; L49-L52 PolarHBondContact O-N 2.93Å; K50-L52 VanDerWaalsContact C-N 3.31Å; K50-L52 PolarHBondContact O-N 3.39Å; L52-L54 PolarHBondContact O-N 3.02Å; L52-K55 PolarHBondContact O-N 3.49Å
53	H	59.9	Low	63.6	Low	152 Å²	152	123.4 Å²	123.4	70%	0.704	63%	0.633	S	S	*	*	H	α-helix	trans	-64.9	-26.2	178.4	-117.9	107.8	0	0	0	113.6	L49 K50 K55	L49-H53 PolarHBondContact O-N 3.39Å; K50-H53 PolarHBondContact O-N 3.36Å; H53-K55 VanDerWaalsContact C-N 3.34Å
54	L	60.6	Low	62.9	Low	148 Å²	148	124.6 Å²	124.6	78%	0.775	63%	0.631	S	S	*	*	T	Hydrogen-bonded Turn	trans	-83	-8.8	178.1	-84.1	158.5	0	0	0	113.6	K50 L52	K50-L54 PolarHBondContact O-N 3.44Å; K50-L54 VanDerWaalsContact O-N 3.16Å; L52-L54 PolarHBondContact O-N 3.02Å
55	K	54.6	Low	62.1	Low	194 Å²	194	130.2 Å²	130.2	84%	0.843	66%	0.659	S	S	*	*			trans	-105.9	-6	-176.5	-97.5	-175.3	175.6	-179.2	0	114.6	L52 H53	L52-K55 PolarHBondContact O-N 3.49Å; H53-K55 VanDerWaalsContact C-N 3.34Å
56	L	46.4	Very low	61.7	Low	210 Å²	210	134.5 Å²	134.5	100%	1.099	67%	0.67	S	S	*	*			trans	-100.6	0	171.6	-92.4	142.6	0	0	0	109.5

Retrieved 56 of 56 residues in 76.9 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).