A0A078BS90_HUMAN Loading...

A29 protein

AlphaFold DB , UniProt , Accession A0A078BS90, Species HUMAN (Homo sapiens, Human), Gene HLA-A*29, Length 112 aa.

						>A0A078BS90_HUMAN|A0A078BS90|HLA-A*29
MAVMAPRTLLLLLLGALALTQTWAGSHSMRYFTTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDLQTRNVKAQSQTDRANLGTLRGYYNQS
					

Structure Viewer

Loading PAE data...

(Predicted Aligned Error values between residue pairs)

Download Structure PDB PAE Table

Site	Residue	pLDDT	pLDDT confidence	pLDDT₁₀	pLDDT10 confidence	SASA	SASA [Å²]	SASA₁₀	SASA10 [Å²]	RSA	RSA unformatted	RSA₁₀	RSA10 unformatted	Surface	Surface10 (not used)	Disorder (not used)	Disorder	Sec. str.	Secondary structure	Isomer	Phi (φ)	Psi (ψ)	Omega (ω)	Chi 1 (χ₁)	Chi 2 (χ₂)	Chi 3 (χ₃)	Chi 4 (χ₄)	Chi 5 (χ₅)	Tau (τ)	Contacts (colored by PAE)	Contact details
1	M	44.2	Very low	72.2	Confident	246 Å²	246	119.6 Å²	119.6	100%	1.212	66%	0.662	S	S	*	*				0	102.9	0	-84.1	178.8	-107.8	0	0	107.9
2	A	53.2	Low	73.5	Confident	105 Å²	105	118.6 Å²	118.6	87%	0.868	65%	0.654	S	S	*	*	P	Polyproline II helix	trans	-78.5	119.8	176.6	0	0	0	0	0	108.7	M4	A2-M4 PolarHBondContact O-N 2.87Å
3	V	63.7	Low	74.3	Confident	137 Å²	137	117.8 Å²	117.8	83%	0.83	65%	0.647	S	S	*	*	P	Polyproline II helix	trans	-62.7	124.1	171.6	175.8	0	0	0	0	107.3	A5	V3-A5 PolarHBondContact O-N 2.95Å; V3-A5 VanDerWaalsContact O-N 3.09Å
4	M	62	Low	74.9	Confident	109 Å²	109	116.2 Å²	116.2	54%	0.537	64%	0.637	S	S	.	*	P	Polyproline II helix	trans	-54.2	118.9	176.4	-159.3	-157.7	-53.2	0	0	108.2	A2 T8 L9 L12	A2-M4 PolarHBondContact O-N 2.87Å; M4-T8 HydrophobicContact CG-CG2 4.46Å; M4-T8 HydrophobicContact SD-CG2 4.34Å; M4-L9 HydrophobicContact CE-CD1 4.36Å; M4-L9 HydrophobicContact SD-CD1 4.19Å; M4-L12 HydrophobicContact SD-CD1 4.13Å
5	A	70.1	Confident	75.3	Confident	52 Å²	52	111.1 Å²	111.1	43%	0.43	62%	0.621	S	S	.	*	P	Polyproline II helix	trans	-56.9	138	-173.4	0	0	0	0	0	110.5	V3 R7 T8 L9	V3-A5 PolarHBondContact O-N 2.95Å; V3-A5 VanDerWaalsContact O-N 3.09Å; A5-R7 PolarHBondContact O-N 3.47Å; A5-T8 WeakPolarHBondContact O-CB 3.49Å; A5-T8 PolarHBondContact O-N 3.34Å; A5-T8 PolarHBondContact O-OG1 2.86Å; A5-L9 PolarHBondContact O-N 3.5Å
6	P	78.3	Confident	75.5	Confident	110 Å²	110	107.7 Å²	107.7	71%	0.714	61%	0.612	S	S	*	*	H	α-helix	trans	-56.4	-24.9	-172	16	-28.6	0	0	0	113.8	L10	P6-L10 WeakPolarHBondContact O-CB 3.41Å; P6-L10 PolarHBondContact O-N 2.98Å; P6-L10 VanDerWaalsContact O-N 3.08Å
7	R	79.2	Confident	75.4	Confident	192 Å²	192	107.6 Å²	107.6	73%	0.725	61%	0.609	S	S	*	*	H	α-helix	trans	-67.9	-38.4	174.6	-168.5	178.9	177.7	99.8	-0.4	113.1	A5 L10 L11	A5-R7 PolarHBondContact O-N 3.47Å; R7-L10 PolarHBondContact O-N 3.09Å; R7-L11 HydrophobicContact CG-CD1 4.33Å; R7-L11 VanDerWaalsContact O-CG 3.24Å; R7-L11 WeakPolarHBondContact O-CG 3.38Å; R7-L11 PolarHBondContact O-N 3.43Å
8	T	84.8	Confident	75	Confident	67 Å²	67	104.9 Å²	104.9	41%	0.411	60%	0.602	S	S	.	*	H	α-helix	trans	-69.6	-40.9	179.8	-42.3	0	0	0	0	110.6	M4 A5 L11 L12	M4-T8 HydrophobicContact CG-CG2 4.46Å; M4-T8 HydrophobicContact SD-CG2 4.34Å; A5-T8 WeakPolarHBondContact O-CB 3.49Å; A5-T8 PolarHBondContact O-N 3.34Å; A5-T8 PolarHBondContact O-OG1 2.86Å; T8-L11 PolarHBondContact O-N 2.89Å; T8-L12 WeakPolarHBondContact O-CG 3.28Å; T8-L12 PolarHBondContact O-N 2.98Å
9	L	84.1	Confident	74.3	Confident	89 Å²	89	107.2 Å²	107.2	47%	0.466	61%	0.611	S	S	.	*	H	α-helix	trans	-63	-43.3	174.7	-164.9	79.5	0	0	0	111.3	M4 A5 L11 L12 L13	M4-L9 HydrophobicContact CE-CD1 4.36Å; M4-L9 HydrophobicContact SD-CD1 4.19Å; A5-L9 PolarHBondContact O-N 3.5Å; L9-L11 PolarHBondContact O-N 3.33Å; L9-L12 PolarHBondContact O-N 3.5Å; L9-L13 HydrophobicContact CD2-CD1 4.37Å; L9-L13 HydrophobicContact CG-CD1 4.09Å; L9-L13 WeakPolarHBondContact O-CB 3.24Å; L9-L13 WeakPolarHBondContact O-CG 3.32Å; L9-L13 PolarHBondContact O-N 3.48Å
10	L	86.3	Confident	73.4	Confident	102 Å²	102	106.7 Å²	106.7	53%	0.534	61%	0.61	S	S	.	*	H	α-helix	trans	-63	-40	176.8	-175.4	65.9	0	0	0	112.2	P6 R7 L13 L14	P6-L10 WeakPolarHBondContact O-CB 3.41Å; P6-L10 PolarHBondContact O-N 2.98Å; P6-L10 VanDerWaalsContact O-N 3.08Å; R7-L10 PolarHBondContact O-N 3.09Å; L10-L13 PolarHBondContact O-N 3.34Å; L10-L14 HydrophobicContact CD1-CD1 4.42Å; L10-L14 HydrophobicContact CG-CD1 4Å; L10-L14 WeakPolarHBondContact O-CB 3.39Å; L10-L14 VanDerWaalsContact O-CG 3.28Å; L10-L14 WeakPolarHBondContact O-CG 3.24Å; L10-L14 PolarHBondContact O-N 2.83Å
11	L	88.2	Confident	72.5	Confident	107 Å²	107	108.6 Å²	108.6	56%	0.56	61%	0.614	S	S	*	*	H	α-helix	trans	-67.6	-38.8	176.4	-72.1	169.4	0	0	0	112.2	R7 T8 L9 L14 G15	R7-L11 HydrophobicContact CG-CD1 4.33Å; R7-L11 VanDerWaalsContact O-CG 3.24Å; R7-L11 WeakPolarHBondContact O-CG 3.38Å; R7-L11 PolarHBondContact O-N 3.43Å; T8-L11 PolarHBondContact O-N 2.89Å; L9-L11 PolarHBondContact O-N 3.33Å; L11-L14 PolarHBondContact O-N 3.43Å; L11-G15 PolarHBondContact O-N 3.08Å
12	L	88.4	Confident	73.1	Confident	107 Å²	107	102.1 Å²	102.1	56%	0.56	59%	0.588	S	S	*	*	H	α-helix	trans	-65.8	-41.9	173.9	-72	169.9	0	0	0	111.5	M4 T8 L9 G15 A16	M4-L12 HydrophobicContact SD-CD1 4.13Å; T8-L12 WeakPolarHBondContact O-CG 3.28Å; T8-L12 PolarHBondContact O-N 2.98Å; L9-L12 PolarHBondContact O-N 3.5Å; L12-G15 PolarHBondContact O-N 3.38Å; L12-A16 WeakPolarHBondContact O-CB 3.33Å; L12-A16 PolarHBondContact O-N 3.4Å
13	L	83.3	Confident	73.5	Confident	108 Å²	108	108.2 Å²	108.2	57%	0.565	59%	0.589	S	S	*	*	H	α-helix	trans	-65.2	-42.7	175.4	-80.5	160.1	0	0	0	112	L9 L10 A16 L17	L9-L13 HydrophobicContact CD2-CD1 4.37Å; L9-L13 HydrophobicContact CG-CD1 4.09Å; L9-L13 WeakPolarHBondContact O-CB 3.24Å; L9-L13 WeakPolarHBondContact O-CG 3.32Å; L9-L13 PolarHBondContact O-N 3.48Å; L10-L13 PolarHBondContact O-N 3.34Å; L13-A16 PolarHBondContact O-N 2.84Å; L13-L17 VanDerWaalsContact O-CB 3.24Å; L13-L17 WeakPolarHBondContact O-CB 3.25Å; L13-L17 PolarHBondContact O-N 2.88Å
14	L	83.3	Confident	73.7	Confident	96 Å²	96	105.6 Å²	105.6	50%	0.503	58%	0.582	S	S	.	*	H	α-helix	trans	-65.5	-38.7	174.6	-77.4	165.8	0	0	0	111.8	L10 L11 L17 A18	L10-L14 HydrophobicContact CD1-CD1 4.42Å; L10-L14 HydrophobicContact CG-CD1 4Å; L10-L14 WeakPolarHBondContact O-CB 3.39Å; L10-L14 VanDerWaalsContact O-CG 3.28Å; L10-L14 WeakPolarHBondContact O-CG 3.24Å; L10-L14 PolarHBondContact O-N 2.83Å; L11-L14 PolarHBondContact O-N 3.43Å; L14-L17 PolarHBondContact O-N 3.43Å; L14-A18 VanDerWaalsContact O-CB 3.25Å; L14-A18 WeakPolarHBondContact O-CB 3.48Å; L14-A18 PolarHBondContact O-N 3.06Å
15	G	80.5	Confident	74.7	Confident	39 Å²	39	102.8 Å²	102.8	40%	0.402	58%	0.581	S	S	.	*	H	α-helix	trans	-64.7	-43.6	174.7	0	0	0	0	0	112.5	L11 L12 L19	L11-G15 PolarHBondContact O-N 3.08Å; L12-G15 PolarHBondContact O-N 3.38Å; G15-L19 PolarHBondContact O-N 2.84Å
16	A	78.9	Confident	75.7	Confident	57 Å²	57	106.6 Å²	106.6	47%	0.471	60%	0.604	S	S	.	*	H	α-helix	trans	-64	-43.1	173.6	0	0	0	0	0	111.5	L12 L13 L19 T20	L12-A16 WeakPolarHBondContact O-CB 3.33Å; L12-A16 PolarHBondContact O-N 3.4Å; L13-A16 PolarHBondContact O-N 2.84Å; A16-L19 WeakPolarHBondContact O-CB 3.4Å; A16-L19 PolarHBondContact O-N 3.23Å; A16-T20 WeakPolarHBondContact O-CG2 3.41Å; A16-T20 PolarHBondContact O-N 2.97Å; A16-T20 PolarHBondContact O-OG1 3.05Å
17	L	73.1	Confident	76.5	Confident	107 Å²	107	106.9 Å²	106.9	56%	0.56	60%	0.596	S	S	*	*	H	α-helix	trans	-67.8	-38.4	-179.8	-163.3	71.7	0	0	0	112.1	L13 L14 L19 T20 Q21	L13-L17 VanDerWaalsContact O-CB 3.24Å; L13-L17 WeakPolarHBondContact O-CB 3.25Å; L13-L17 PolarHBondContact O-N 2.88Å; L14-L17 PolarHBondContact O-N 3.43Å; L17-L19 VanDerWaalsContact C-N 3.33Å; L17-T20 VanDerWaalsContact CA-OG1 3.26Å; L17-T20 WeakPolarHBondContact CA-OG1 3.38Å; L17-T20 CarbonylContact O-C 3.57Å; L17-T20 WeakPolarHBondContact O-CA 3.26Å; L17-T20 PolarHBondContact O-N 3.42Å; L17-T20 VanDerWaalsContact O-N 3.1Å; L17-T20 PolarHBondContact O-OG1 3.22Å; L17-Q21 PolarHBondContact O-N 2.71Å
18	A	68.1	Low	77.3	Confident	59 Å²	59	99.6 Å²	99.6	49%	0.488	57%	0.574	S	S	.	*	H	α-helix	trans	-64.7	-35.8	172.6	0	0	0	0	0	111.9	L14 T20 Q21	L14-A18 VanDerWaalsContact O-CB 3.25Å; L14-A18 WeakPolarHBondContact O-CB 3.48Å; L14-A18 PolarHBondContact O-N 3.06Å; A18-T20 PolarHBondContact O-N 3.1Å; A18-Q21 PolarHBondContact O-N 3.49Å
19	L	61.9	Low	77.9	Confident	147 Å²	147	102 Å²	102	77%	0.77	58%	0.582	S	S	*	*	H	α-helix	trans	-64.9	-31.4	171.1	-125.9	85.4	0	0	0	112.3	G15 A16 L17	G15-L19 PolarHBondContact O-N 2.84Å; A16-L19 WeakPolarHBondContact O-CB 3.4Å; A16-L19 PolarHBondContact O-N 3.23Å; L17-L19 VanDerWaalsContact C-N 3.33Å
20	T	56.8	Low	78.6	Confident	98 Å²	98	102.9 Å²	102.9	60%	0.601	58%	0.579	S	S	*	*	T	Hydrogen-bonded Turn	trans	-87.1	-2.5	176.3	62.9	0	0	0	0	113.9	A16 L17 A18 T22	A16-T20 WeakPolarHBondContact O-CG2 3.41Å; A16-T20 PolarHBondContact O-N 2.97Å; A16-T20 PolarHBondContact O-OG1 3.05Å; L17-T20 VanDerWaalsContact CA-OG1 3.26Å; L17-T20 WeakPolarHBondContact CA-OG1 3.38Å; L17-T20 CarbonylContact O-C 3.57Å; L17-T20 WeakPolarHBondContact O-CA 3.26Å; L17-T20 PolarHBondContact O-N 3.42Å; L17-T20 VanDerWaalsContact O-N 3.1Å; L17-T20 PolarHBondContact O-OG1 3.22Å; A18-T20 PolarHBondContact O-N 3.1Å; T20-T22 PolarHBondContact O-N 2.84Å
21	Q	54.4	Low	79.1	Confident	147 Å²	147	103.1 Å²	103.1	69%	0.687	57%	0.574	S	S	*	*	S	Bend	trans	-68.7	83.4	173.6	-85.6	-170.9	-22.3	0	0	109.3	L17 A18	L17-Q21 PolarHBondContact O-N 2.71Å; A18-Q21 PolarHBondContact O-N 3.49Å
22	T	57.2	Low	79.6	Confident	110 Å²	110	103 Å²	103	68%	0.675	57%	0.569	S	S	*	*			trans	50.7	88	151.2	61.5	0	0	0	0	115.3	T20 A24	T20-T22 PolarHBondContact O-N 2.84Å; T22-A24 PolarHBondContact O-N 2.72Å
23	W	60.9	Low	80.1	Confident	232 Å²	232	101.4 Å²	101.4	88%	0.879	56%	0.564	S	S	*	*			trans	-60.9	33.6	144.4	-76.1	73.8	0	0	0	112.1	G25 H27	W23-G25 PolarHBondContact O-N 3.28Å; W23-H27 PolarHBondContact O-NE2 3.35Å
24	A	68.6	Low	80.8	Confident	82 Å²	82	99.8 Å²	99.8	68%	0.678	56%	0.559	S	S	*	*			trans	-97.4	47.1	178.9	0	0	0	0	0	109.5	T22	T22-A24 PolarHBondContact O-N 2.72Å
25	G	83.5	Confident	81.4	Confident	51 Å²	51	96.6 Å²	96.6	53%	0.526	54%	0.544	S	S	.	.	S	Bend	trans	-73.5	171.1	166.6	0	0	0	0	0	110.5	W23 H27	W23-G25 PolarHBondContact O-N 3.28Å; G25-H27 PolarHBondContact O-CD2 3.44Å; G25-H27 PolarHBondContact O-NE2 3.11Å
26	S	91.1	Very high	82.1	Confident	131 Å²	131	98.2 Å²	98.2	92%	0.916	55%	0.546	S	S	*	.			trans	-70.9	132.3	165.5	-62.5	0	0	0	0	109.5
27	H	93.4	Very high	82.8	Confident	117 Å²	117	99 Å²	99	54%	0.542	55%	0.548	S	S	.	.			trans	-108.1	153.9	175.5	-62.5	-85.7	0	0	0	110.1	W23 G25 D53	W23-H27 PolarHBondContact O-NE2 3.35Å; G25-H27 PolarHBondContact O-CD2 3.44Å; G25-H27 PolarHBondContact O-NE2 3.11Å; H27-D53 WeakPolarHBondContact CA-OD1 3.34Å; H27-D53 WeakPolarHBondContact CB-OD1 3.33Å; H27-D53 IonicContact CE1-OD2 2.82Å; H27-D53 IonicContact CG-OD1 2.77Å; H27-D53 IonicContact CG-OD2 3.15Å; H27-D53 IonicContact ND1-OD1 3.15Å; H27-D53 IonicContact ND1-OD2 2.72Å; H27-D53 PolarHBondContact ND1-OD2 2.96Å
28	S	96.4	Very high	83.6	Confident	38 Å²	38	97.2 Å²	97.2	27%	0.266	53%	0.534	S	S	.	.			trans	-134.9	141.4	177.4	66.7	0	0	0	0	111.9	R30 V52 D53	S28-R30 PolarHBondContact OG-NH1 3.43Å; S28-R30 PolarHBondContact OG-NH2 2.92Å; S28-V52 WeakPolarHBondContact O-CA 3.14Å; S28-D53 PolarHBondContact N-OD1 3.01Å; S28-D53 PolarHBondContact O-N 2.9Å
29	M	97.6	Very high	84.2	Confident	118 Å²	118	99.5 Å²	99.5	58%	0.581	54%	0.544	S	S	*	.	E	Extended strand (participates in β ladder)	trans	-118.5	132	170	-178.4	175.8	-81.8	0	0	108.9	Y31 Y51 V52 F57	M29-Y31 HydrophobicContact CG-CD2 4.38Å; M29-Y31 HydrophobicContact CG-CE2 4Å; M29-Y31 HydrophobicContact SD-CE2 3.76Å; M29-Y51 VanDerWaalsContact CA-O 3.29Å; M29-Y51 WeakPolarHBondContact CA-O 3.46Å; M29-V52 HydrophobicContact CE-CG2 3.61Å; M29-F57 HydrophobicContact CE-CE1 4.31Å; M29-F57 HydrophobicContact CE-CZ 4Å
30	R	98.4	Very high	85.2	Confident	107 Å²	107	96.8 Å²	96.8	40%	0.404	55%	0.552	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-135.1	137.4	179.8	-57.2	-174.3	-167.1	96.7	1.2	110.4	S28 F32 G50 Y51 D54	S28-R30 PolarHBondContact OG-NH1 3.43Å; S28-R30 PolarHBondContact OG-NH2 2.92Å; R30-F32 HydrophobicContact CB-CE2 3.78Å; R30-F32 HydrophobicContact CB-CZ 4.2Å; R30-G50 CarbonylContact O-C 3.55Å; R30-G50 WeakPolarHBondContact O-CA 3.09Å; R30-Y51 PolarHBondContact N-O 2.74Å; R30-Y51 PolarHBondContact O-N 2.9Å; R30-D54 IonicContact CZ-OD1 3.82Å; R30-D54 IonicContact NH1-OD1 3.41Å; R30-D54 PolarHBondContact NH1-OD1 3.42Å
31	Y	98.1	Very high	86.4	Confident	107 Å²	107	102.2 Å²	102.2	42%	0.42	56%	0.561	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-116.7	135.9	168.6	-76.2	-91.3	0	0	0	109.4	M29 V49 F57 V58	M29-Y31 HydrophobicContact CG-CD2 4.38Å; M29-Y31 HydrophobicContact CG-CE2 4Å; M29-Y31 HydrophobicContact SD-CE2 3.76Å; Y31-V49 WeakPolarHBondContact CA-O 3.43Å; Y31-F57 AromaticContact CZ-CZ 3.91Å; Y31-F57 WeakPolarHBondContact OH-CZ 3.41Å; Y31-V58 HydrophobicContact CE1-CG2 3.91Å
32	F	98.3	Very high	87.9	Confident	106 Å²	106	98.1 Å²	98.1	47%	0.465	56%	0.558	S	S	.	*	E	Extended strand (participates in β ladder)	trans	-119.7	125.1	172.1	-56.9	-93.4	0	0	0	108.1	R30 A48 V49 Y51	R30-F32 HydrophobicContact CB-CE2 3.78Å; R30-F32 HydrophobicContact CB-CZ 4.2Å; F32-A48 CarbonylContact O-C 3.59Å; F32-A48 VanDerWaalsContact O-CA 3.32Å; F32-A48 WeakPolarHBondContact O-CA 3.48Å; F32-V49 HydrophobicContact CB-CG2 3.75Å; F32-V49 HydrophobicContact CD2-CG2 4.17Å; F32-V49 HydrophobicContact CG-CG2 4.41Å; F32-V49 PolarHBondContact N-O 3.24Å; F32-V49 PolarHBondContact O-N 2.69Å; F32-Y51 AromaticContact CD2-CD2 3.93Å; F32-Y51 HydrophobicContact CD2-CD2 3.93Å; F32-Y51 HydrophobicContact CD2-CE2 4.07Å; F32-Y51 AromaticContact CE2-CD2 3.9Å; F32-Y51 HydrophobicContact CE2-CD2 3.9Å; F32-Y51 HydrophobicContact CE2-CE2 4.22Å
33	T	97.9	Very high	89.4	Confident	72 Å²	72	97 Å²	97	44%	0.442	55%	0.545	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-107.7	143.3	168.9	57.9	0	0	0	0	109	F46 I47 A48 Q94	T33-F46 HydrophobicContact CG2-CE2 4.4Å; T33-F46 HydrophobicContact CG2-CZ 3.77Å; T33-I47 CarbonylContact C-O 3.49Å; T33-I47 WeakPolarHBondContact CA-O 3.29Å; T33-A48 HydrophobicContact CG2-CB 4.1Å; T33-Q94 HydrophobicContact CG2-CG 4.46Å
34	T	98.1	Very high	91	Very high	75 Å²	75	87.4 Å²	87.4	46%	0.46	51%	0.512	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-141.6	124.1	179.2	-56.1	0	0	0	0	108.7	V36 F46 I47	T34-V36 HydrophobicContact CG2-CG2 4Å; T34-F46 CarbonylContact O-C 3.59Å; T34-F46 WeakPolarHBondContact O-CA 3.23Å; T34-I47 PolarHBondContact N-O 2.78Å; T34-I47 PolarHBondContact O-N 3.31Å
35	S	96.9	Very high	92.3	Very high	28 Å²	28	87.6 Å²	87.6	20%	0.196	50%	0.496	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-120.4	117	-178.7	-65.9	0	0	0	0	109	R45 F46 D98	S35-R45 WeakPolarHBondContact CA-O 3.39Å; S35-F46 WeakPolarHBondContact OG-CD2 3.36Å; S35-D98 WeakPolarHBondContact OG-CB 3.48Å; S35-D98 PolarHBondContact OG-OD2 3.32Å
36	V	95.5	Very high	93	Very high	74 Å²	74	85.2 Å²	85.2	45%	0.448	47%	0.471	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-114.3	115.1	-174.2	-173	0	0	0	0	108.8	T34 P44 R45	T34-V36 HydrophobicContact CG2-CG2 4Å; V36-P44 CarbonylContact O-C 3.52Å; V36-P44 WeakPolarHBondContact O-CA 3.49Å; V36-P44 WeakPolarHBondContact O-CB 3.29Å; V36-R45 PolarHBondContact N-O 2.95Å; V36-R45 PolarHBondContact O-N 3.29Å
37	S	91.8	Very high	93.4	Very high	73 Å²	73	80.5 Å²	80.5	51%	0.51	44%	0.435	S	S	.	.			trans	-62.7	145.4	174.2	61	0	0	0	0	110.7
38	R	90.5	Very high	93.6	Very high	70 Å²	70	75.1 Å²	75.1	26%	0.264	41%	0.411	S	S	.	.			trans	-133.4	73.4	-178.9	-68.9	-167.4	-67.5	-163	-12.7	111.5	G40 R41 E43 D63	R38-G40 PolarHBondContact O-N 3.48Å; R38-R41 HydrophobicContact CB-CB 4.18Å; R38-R41 PolarHBondContact O-N 2.9Å; R38-E43 PolarHBondContact NE-O 3.03Å; R38-E43 PolarHBondContact NH2-O 3.19Å; R38-D63 IonicContact CZ-OD1 3.69Å; R38-D63 IonicContact CZ-OD2 3.98Å; R38-D63 VanDerWaalsContact NH1-CG 3.32Å; R38-D63 IonicContact NH1-OD1 3.01Å; R38-D63 PolarHBondContact NH1-OD1 2.88Å; R38-D63 VanDerWaalsContact NH1-OD1 3.15Å; R38-D63 IonicContact NH1-OD2 3.42Å; R38-D63 PolarHBondContact NH1-OD2 3.22Å; R38-D63 IonicContact NH2-OD1 3.64Å; R38-D63 PolarHBondContact NH2-OD1 2.96Å; R38-D63 IonicContact NH2-OD2 2.69Å
39	P	81.5	Confident	93.7	Very high	106 Å²	106	74.2 Å²	74.2	69%	0.688	40%	0.404	S	S	*	.	T	Hydrogen-bonded Turn	trans	-53.4	126.4	-179.9	-23.7	33.6	0	0	0	111.4	R41	P39-R41 PolarHBondContact O-N 2.8Å
40	G	81.7	Confident	93.8	Very high	91 Å²	91	68.6 Å²	68.6	94%	0.938	38%	0.376	S	S	*	.	T	Hydrogen-bonded Turn	trans	72	2.5	179.5	0	0	0	0	0	116.1	R38	R38-G40 PolarHBondContact O-N 3.48Å
41	R	82.7	Confident	93.8	Very high	212 Å²	212	66.8 Å²	66.8	80%	0.8	37%	0.37	S	S	*	.	S	Bend	trans	-122.7	21.7	-179.8	-59.2	-176.7	-179.7	-171.2	0.2	113.4	R38 P39	R38-R41 HydrophobicContact CB-CB 4.18Å; R38-R41 PolarHBondContact O-N 2.9Å; P39-R41 PolarHBondContact O-N 2.8Å
42	G	85	Confident	93.8	Very high	60 Å²	60	63.4 Å²	63.4	62%	0.619	36%	0.36	S	S	*	.	S	Bend	trans	92.5	-149.1	175.6	0	0	0	0	0	113.8
43	E	89.9	Confident	93.6	Very high	88 Å²	88	61.3 Å²	61.3	41%	0.411	35%	0.354	S	S	.	.	S	Bend	trans	-63.6	147.9	-176.7	-66.7	-60.3	161.4	0	0	112.7	R38 R45 R99	R38-E43 PolarHBondContact NE-O 3.03Å; R38-E43 PolarHBondContact NH2-O 3.19Å; E43-R45 PolarHBondContact O-N 2.78Å; E43-R99 VanDerWaalsContact CD-NH2 3.26Å; E43-R99 IonicContact OE1-CZ 3.57Å; E43-R99 IonicContact OE1-NH1 2.75Å; E43-R99 PolarHBondContact OE1-NH1 3.23Å; E43-R99 IonicContact OE1-NH2 3.64Å; E43-R99 PolarHBondContact OE1-NH2 2.93Å; E43-R99 WeakPolarHBondContact OE2-CD 3.48Å; E43-R99 IonicContact OE2-CZ 2.69Å; E43-R99 IonicContact OE2-NE 3.61Å; E43-R99 PolarHBondContact OE2-NE 3.41Å; E43-R99 VanDerWaalsContact OE2-NE 3.15Å; E43-R99 IonicContact OE2-NH1 2.87Å; E43-R99 PolarHBondContact OE2-NH1 3.05Å; E43-R99 IonicContact OE2-NH2 3.72Å; E43-R99 PolarHBondContact OE2-NH2 3.23Å; E43-R99 VanDerWaalsContact OE2-NH2 3.08Å
44	P	93.8	Very high	93.5	Very high	29 Å²	29	63.6 Å²	63.6	19%	0.188	36%	0.363	C	S	.	.	P	Polyproline II helix	trans	-52.8	141.4	169.6	-24.4	34.7	0	0	0	111.4	V36 R99 L102	V36-P44 CarbonylContact O-C 3.52Å; V36-P44 WeakPolarHBondContact O-CA 3.49Å; V36-P44 WeakPolarHBondContact O-CB 3.29Å; P44-R99 HydrophobicContact CG-CG 4.28Å; P44-L102 HydrophobicContact CB-CD1 3.65Å; P44-L102 HydrophobicContact CG-CD1 3.86Å
45	R	96.5	Very high	93.5	Very high	86 Å²	86	63.7 Å²	63.7	33%	0.325	36%	0.364	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-79.3	128.9	171.5	-175.1	-179.8	-178.7	-177.4	-1.8	108.6	S35 V36 E43 I47 D61 S62 D63	S35-R45 WeakPolarHBondContact CA-O 3.39Å; V36-R45 PolarHBondContact N-O 2.95Å; V36-R45 PolarHBondContact O-N 3.29Å; E43-R45 PolarHBondContact O-N 2.78Å; R45-I47 HydrophobicContact CG-CG1 4.35Å; R45-D61 IonicContact CZ-OD1 2.98Å; R45-D61 IonicContact CZ-OD2 3.68Å; R45-D61 IonicContact NE-OD1 2.69Å; R45-D61 PolarHBondContact NE-OD1 2.88Å; R45-D61 IonicContact NE-OD2 2.86Å; R45-D61 IonicContact NH2-OD1 3.08Å; R45-D61 PolarHBondContact NH2-OD1 2.86Å; R45-D61 IonicContact NH2-OD2 3.97Å; R45-D61 PolarHBondContact NH2-OD2 2.86Å; R45-S62 WeakPolarHBondContact CA-OG 3.39Å; R45-D63 VanDerWaalsContact CD-OD2 3.25Å; R45-D63 WeakPolarHBondContact CD-OD2 3.4Å; R45-D63 IonicContact NE-OD2 3.83Å
46	F	97.9	Very high	93.6	Very high	2 Å²	2	65 Å²	65	1%	0.009	37%	0.367	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-113.7	130.6	176.1	-179.7	-80.7	0	0	0	110	T33 T34 S35 A48 F60 S62 V91 Q94 S95 D98	T33-F46 HydrophobicContact CG2-CE2 4.4Å; T33-F46 HydrophobicContact CG2-CZ 3.77Å; T34-F46 CarbonylContact O-C 3.59Å; T34-F46 WeakPolarHBondContact O-CA 3.23Å; S35-F46 WeakPolarHBondContact OG-CD2 3.36Å; F46-A48 HydrophobicContact CE1-CB 3.81Å; F46-A48 HydrophobicContact CZ-CB 4.29Å; F46-F60 AromaticContact CD1-CD1 3.76Å; F46-F60 HydrophobicContact CD1-CD1 3.76Å; F46-F60 AromaticContact CD1-CE1 3.85Å; F46-F60 HydrophobicContact CD1-CE1 3.85Å; F46-F60 HydrophobicContact CE1-CD1 4.1Å; F46-F60 HydrophobicContact CE1-CE1 4.47Å; F46-S62 PolarHBondContact N-OG 2.69Å; F46-S62 PolarHBondContact O-N 3.01Å; F46-S62 PolarHBondContact O-OG 3.48Å; F46-V91 HydrophobicContact CD1-CG2 4.36Å; F46-V91 HydrophobicContact CE1-CG2 3.44Å; F46-V91 VanDerWaalsContact CE1-CG2 3.44Å; F46-V91 HydrophobicContact CZ-CG2 4.13Å; F46-Q94 HydrophobicContact CE2-CG 4.05Å; F46-Q94 HydrophobicContact CZ-CB 4.2Å; F46-Q94 HydrophobicContact CZ-CG 3.92Å; F46-S95 WeakPolarHBondContact CB-OG 3.32Å; F46-S95 VanDerWaalsContact CD2-CA 3.47Å; F46-D98 HydrophobicContact CD2-CB 4.11Å; F46-D98 HydrophobicContact CE2-CB 4.15Å; F46-D98 VanDerWaalsContact CE2-OD2 3.31Å; F46-D98 WeakPolarHBondContact CE2-OD2 3.46Å
47	I	98.4	Very high	93.7	Very high	32 Å²	32	61.6 Å²	61.6	16%	0.164	35%	0.346	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-126.8	134.5	175.7	-60.3	170.7	0	0	0	107.9	T33 T34 R45 V49 F60	T33-I47 CarbonylContact C-O 3.49Å; T33-I47 WeakPolarHBondContact CA-O 3.29Å; T34-I47 PolarHBondContact N-O 2.78Å; T34-I47 PolarHBondContact O-N 3.31Å; R45-I47 HydrophobicContact CG-CG1 4.35Å; I47-V49 HydrophobicContact CG2-CG1 4.15Å; I47-F60 WeakPolarHBondContact CA-O 3.34Å
48	A	98.6	Very high	94	Very high	4 Å²	4	58.2 Å²	58.2	3%	0.033	32%	0.322	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.2	138.9	165.1	0	0	0	0	0	110.2	F32 T33 F46 R59 F60 V91	F32-A48 CarbonylContact O-C 3.59Å; F32-A48 VanDerWaalsContact O-CA 3.32Å; F32-A48 WeakPolarHBondContact O-CA 3.48Å; T33-A48 HydrophobicContact CG2-CB 4.1Å; F46-A48 HydrophobicContact CE1-CB 3.81Å; F46-A48 HydrophobicContact CZ-CB 4.29Å; A48-R59 CarbonylContact O-C 3.56Å; A48-R59 WeakPolarHBondContact O-CA 3.15Å; A48-F60 HydrophobicContact CB-CB 4.31Å; A48-F60 PolarHBondContact N-O 3.21Å; A48-F60 PolarHBondContact O-N 3.3Å; A48-V91 HydrophobicContact CB-CG2 3.6Å
49	V	98.7	Very high	94.4	Very high	19 Å²	19	57.7 Å²	57.7	12%	0.115	32%	0.32	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-133.7	137.7	175.5	-65.6	0	0	0	0	109.9	Y31 F32 I47 Y51 R59	Y31-V49 WeakPolarHBondContact CA-O 3.43Å; F32-V49 HydrophobicContact CB-CG2 3.75Å; F32-V49 HydrophobicContact CD2-CG2 4.17Å; F32-V49 HydrophobicContact CG-CG2 4.41Å; F32-V49 PolarHBondContact N-O 3.24Å; F32-V49 PolarHBondContact O-N 2.69Å; I47-V49 HydrophobicContact CG2-CG1 4.15Å; V49-Y51 HydrophobicContact CB-CE2 4.16Å; V49-Y51 HydrophobicContact CG2-CE2 3.81Å; V49-R59 HydrophobicContact CG1-CG 4.11Å
50	G	98.6	Very high	95.3	Very high	0 Å²	0	52.9 Å²	52.9	0%	0	29%	0.288	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-116.3	138.3	177.3	0	0	0	0	0	111.2	R30 Q56 F57 V58	R30-G50 CarbonylContact O-C 3.55Å; R30-G50 WeakPolarHBondContact O-CA 3.09Å; G50-Q56 WeakPolarHBondContact O-CA 3.32Å; G50-F57 VanDerWaalsContact C-CE1 3.49Å; G50-F57 VanDerWaalsContact O-CD1 3.23Å; G50-F57 WeakPolarHBondContact O-CD1 3.4Å; G50-F57 PolarHBondContact O-N 3.13Å; G50-V58 PolarHBondContact N-O 3.11Å; G50-V58 PolarHBondContact O-N 2.82Å
51	Y	98.7	Very high	96	Very high	69 Å²	69	49.5 Å²	49.5	27%	0.271	25%	0.249	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-123.7	140.6	177.9	-70.2	-96	0	0	0	110.9	M29 R30 F32 V49 D54 T55 Q56	M29-Y51 VanDerWaalsContact CA-O 3.29Å; M29-Y51 WeakPolarHBondContact CA-O 3.46Å; R30-Y51 PolarHBondContact N-O 2.74Å; R30-Y51 PolarHBondContact O-N 2.9Å; F32-Y51 AromaticContact CD2-CD2 3.93Å; F32-Y51 HydrophobicContact CD2-CD2 3.93Å; F32-Y51 HydrophobicContact CD2-CE2 4.07Å; F32-Y51 AromaticContact CE2-CD2 3.9Å; F32-Y51 HydrophobicContact CE2-CD2 3.9Å; F32-Y51 HydrophobicContact CE2-CE2 4.22Å; V49-Y51 HydrophobicContact CB-CE2 4.16Å; V49-Y51 HydrophobicContact CG2-CE2 3.81Å; Y51-D54 WeakPolarHBondContact CD1-O 3.4Å; Y51-T55 VanDerWaalsContact CA-O 3.29Å; Y51-T55 WeakPolarHBondContact CA-O 3.43Å; Y51-Q56 HydrophobicContact CD1-CB 3.97Å; Y51-Q56 VanDerWaalsContact CD1-N 3.35Å; Y51-Q56 HydrophobicContact CE1-CB 3.59Å; Y51-Q56 HydrophobicContact CE1-CG 4.29Å; Y51-Q56 HydrophobicContact CE2-CG 4.49Å
52	V	98.1	Very high	96.7	Very high	36 Å²	36	40.1 Å²	40.1	22%	0.218	22%	0.216	C	C	.	.	E	Extended strand (participates in β ladder)	trans	-120	121.7	162.1	174.2	0	0	0	0	106.7	S28 M29 D54 T55 F57 W75	S28-V52 WeakPolarHBondContact O-CA 3.14Å; M29-V52 HydrophobicContact CE-CG2 3.61Å; V52-D54 VanDerWaalsContact C-N 3.28Å; V52-D54 PolarHBondContact O-N 2.83Å; V52-T55 PolarHBondContact N-O 2.69Å; V52-T55 WeakPolarHBondContact O-CA 3.35Å; V52-T55 WeakPolarHBondContact O-CB 3.33Å; V52-T55 PolarHBondContact O-N 3.01Å; V52-F57 HydrophobicContact CB-CD1 4.48Å; V52-F57 HydrophobicContact CG2-CD1 3.79Å; V52-F57 HydrophobicContact CG2-CE1 3.82Å; V52-F57 HydrophobicContact CG2-CG 4.33Å; V52-F57 HydrophobicContact CG2-CZ 4.4Å; V52-W75 HydrophobicContact CB-CH2 4.28Å; V52-W75 HydrophobicContact CB-CZ2 4.28Å; V52-W75 HydrophobicContact CG2-CH2 3.95Å; V52-W75 HydrophobicContact CG2-CZ2 4.43Å
53	D	95	Very high	97.2	Very high	62 Å²	62	40.8 Å²	40.8	33%	0.332	21%	0.205	S	C	.	.	T	Hydrogen-bonded Turn	trans	47.6	49.2	180	-55.1	-32.9	0	0	0	113.4	H27 S28 T55	H27-D53 WeakPolarHBondContact CA-OD1 3.34Å; H27-D53 WeakPolarHBondContact CB-OD1 3.33Å; H27-D53 IonicContact CE1-OD2 2.82Å; H27-D53 IonicContact CG-OD1 2.77Å; H27-D53 IonicContact CG-OD2 3.15Å; H27-D53 IonicContact ND1-OD1 3.15Å; H27-D53 IonicContact ND1-OD2 2.72Å; H27-D53 PolarHBondContact ND1-OD2 2.96Å; S28-D53 PolarHBondContact N-OD1 3.01Å; S28-D53 PolarHBondContact O-N 2.9Å; D53-T55 PolarHBondContact O-N 3.19Å
54	D	96	Very high	97.6	Very high	120 Å²	120	38 Å²	38	64%	0.642	20%	0.197	S	C	*	.	T	Hydrogen-bonded Turn	trans	64.5	4.8	-178.8	-51.3	-40	0	0	0	115.4	R30 Y51 V52	R30-D54 IonicContact CZ-OD1 3.82Å; R30-D54 IonicContact NH1-OD1 3.41Å; R30-D54 PolarHBondContact NH1-OD1 3.42Å; Y51-D54 WeakPolarHBondContact CD1-O 3.4Å; V52-D54 VanDerWaalsContact C-N 3.28Å; V52-D54 PolarHBondContact O-N 2.83Å
55	T	97.7	Very high	97.7	Very high	76 Å²	76	42.1 Å²	42.1	47%	0.466	23%	0.234	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-93.1	119.8	170	-59.1	0	0	0	0	110.3	Y51 V52 D53 F57	Y51-T55 VanDerWaalsContact CA-O 3.29Å; Y51-T55 WeakPolarHBondContact CA-O 3.43Å; V52-T55 PolarHBondContact N-O 2.69Å; V52-T55 WeakPolarHBondContact O-CA 3.35Å; V52-T55 WeakPolarHBondContact O-CB 3.33Å; V52-T55 PolarHBondContact O-N 3.01Å; D53-T55 PolarHBondContact O-N 3.19Å; T55-F57 PolarHBondContact O-N 2.82Å
56	Q	98.5	Very high	97.6	Very high	55 Å²	55	40.2 Å²	40.2	26%	0.257	23%	0.234	S	C	.	.	E	Extended strand (participates in β ladder)	trans	-66.8	123.4	174	-169.1	-176.8	-2.8	0	0	109.6	G50 Y51 V58 R72	G50-Q56 WeakPolarHBondContact O-CA 3.32Å; Y51-Q56 HydrophobicContact CD1-CB 3.97Å; Y51-Q56 VanDerWaalsContact CD1-N 3.35Å; Y51-Q56 HydrophobicContact CE1-CB 3.59Å; Y51-Q56 HydrophobicContact CE1-CG 4.29Å; Y51-Q56 HydrophobicContact CE2-CG 4.49Å; Q56-V58 PolarHBondContact NE2-O 3.3Å; Q56-R72 HydrophobicContact CG-CB 4.16Å; Q56-R72 HydrophobicContact CG-CG 4.33Å; Q56-R72 CarbonylContact O-C 3.39Å; Q56-R72 WeakPolarHBondContact O-CB 3.25Å
57	F	98.6	Very high	97.5	Very high	4 Å²	4	44.2 Å²	44.2	2%	0.018	25%	0.253	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-115.7	-21.5	-178.2	81.2	-79.4	0	0	0	113.7	M29 Y31 G50 V52 T55 R72 A73 W75 I76	M29-F57 HydrophobicContact CE-CE1 4.31Å; M29-F57 HydrophobicContact CE-CZ 4Å; Y31-F57 AromaticContact CZ-CZ 3.91Å; Y31-F57 WeakPolarHBondContact OH-CZ 3.41Å; G50-F57 VanDerWaalsContact C-CE1 3.49Å; G50-F57 VanDerWaalsContact O-CD1 3.23Å; G50-F57 WeakPolarHBondContact O-CD1 3.4Å; G50-F57 PolarHBondContact O-N 3.13Å; V52-F57 HydrophobicContact CB-CD1 4.48Å; V52-F57 HydrophobicContact CG2-CD1 3.79Å; V52-F57 HydrophobicContact CG2-CE1 3.82Å; V52-F57 HydrophobicContact CG2-CG 4.33Å; V52-F57 HydrophobicContact CG2-CZ 4.4Å; T55-F57 PolarHBondContact O-N 2.82Å; F57-R72 PolarHBondContact O-N 3.11Å; F57-A73 HydrophobicContact CB-CB 4.33Å; F57-W75 HydrophobicContact CB-CH2 3.26Å; F57-W75 HydrophobicContact CB-CZ2 3.21Å; F57-W75 HydrophobicContact CB-CZ3 4.25Å; F57-W75 HydrophobicContact CD1-CH2 4.25Å; F57-W75 AromaticContact CD2-CH2 3.45Å; F57-W75 HydrophobicContact CD2-CH2 3.45Å; F57-W75 VanDerWaalsContact CD2-CH2 3.45Å; F57-W75 HydrophobicContact CD2-CZ2 4.31Å; F57-W75 AromaticContact CD2-CZ3 3.92Å; F57-W75 HydrophobicContact CD2-CZ3 3.92Å; F57-W75 HydrophobicContact CE2-CH2 4.33Å; F57-W75 AromaticContact CG-CH2 3.41Å; F57-W75 HydrophobicContact CG-CH2 3.41Å; F57-W75 VanDerWaalsContact CG-CH2 3.41Å; F57-W75 AromaticContact CG-CZ2 3.89Å; F57-W75 HydrophobicContact CG-CZ2 3.89Å; F57-W75 HydrophobicContact CG-CZ3 4.32Å; F57-I76 HydrophobicContact CD2-CB 4.32Å; F57-I76 HydrophobicContact CD2-CD1 4.03Å; F57-I76 HydrophobicContact CD2-CG1 3.97Å; F57-I76 HydrophobicContact CE2-CD1 4.19Å; F57-I76 HydrophobicContact CE2-CG1 4.45Å; F57-I76 WeakPolarHBondContact O-CG2 3.36Å
58	V	98.7	Very high	97.5	Very high	1 Å²	1	49.7 Å²	49.7	1%	0.006	27%	0.271	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-140.5	153.7	175.3	-71.3	0	0	0	0	112.8	Y31 G50 Q56 M69 E70 I76 W84	Y31-V58 HydrophobicContact CE1-CG2 3.91Å; G50-V58 PolarHBondContact N-O 3.11Å; G50-V58 PolarHBondContact O-N 2.82Å; Q56-V58 PolarHBondContact NE2-O 3.3Å; V58-M69 HydrophobicContact CB-CG 4.17Å; V58-M69 HydrophobicContact CB-SD 3.8Å; V58-M69 HydrophobicContact CG1-CG 4.31Å; V58-M69 HydrophobicContact CG2-SD 4.19Å; V58-E70 WeakPolarHBondContact CA-O 3.31Å; V58-I76 HydrophobicContact CG1-CG1 4.41Å; V58-W84 HydrophobicContact CG1-CH2 3.99Å; V58-W84 HydrophobicContact CG1-CZ3 3.84Å
59	R	98.6	Very high	97.5	Very high	59 Å²	59	50 Å²	50	22%	0.223	27%	0.272	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-145.7	141.1	172.9	-174.9	173.5	173.6	83.6	6	111.4	A48 V49 D61 M69 E70 R72	A48-R59 CarbonylContact O-C 3.56Å; A48-R59 WeakPolarHBondContact O-CA 3.15Å; V49-R59 HydrophobicContact CG1-CG 4.11Å; R59-D61 IonicContact CZ-OD2 2.74Å; R59-D61 IonicContact NE-OD2 3.67Å; R59-D61 IonicContact NH2-OD2 3.89Å; R59-D61 PolarHBondContact NH2-OD2 2.91Å; R59-M69 VanDerWaalsContact C-SD 3.51Å; R59-E70 PolarHBondContact N-O 2.79Å; R59-E70 PolarHBondContact O-N 2.72Å; R59-R72 HydrophobicContact CB-CG 3.85Å
60	F	98.8	Very high	97.4	Very high	5 Å²	5	52 Å²	52	2%	0.022	28%	0.28	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-123.1	142.7	161.7	176.6	-88.1	0	0	0	109.6	F46 I47 A48 Q67 R68 M69 V91 K92	F46-F60 AromaticContact CD1-CD1 3.76Å; F46-F60 HydrophobicContact CD1-CD1 3.76Å; F46-F60 AromaticContact CD1-CE1 3.85Å; F46-F60 HydrophobicContact CD1-CE1 3.85Å; F46-F60 HydrophobicContact CE1-CD1 4.1Å; F46-F60 HydrophobicContact CE1-CE1 4.47Å; I47-F60 WeakPolarHBondContact CA-O 3.34Å; A48-F60 HydrophobicContact CB-CB 4.31Å; A48-F60 PolarHBondContact N-O 3.21Å; A48-F60 PolarHBondContact O-N 3.3Å; F60-Q67 HydrophobicContact CE2-CB 4.39Å; F60-Q67 WeakPolarHBondContact CE2-O 3.09Å; F60-Q67 HydrophobicContact CZ-CB 4.46Å; F60-R68 WeakPolarHBondContact CD2-O 3.35Å; F60-M69 HydrophobicContact CB-CE 4.19Å; F60-M69 HydrophobicContact CB-SD 3.96Å; F60-V91 HydrophobicContact CB-CB 4.48Å; F60-V91 HydrophobicContact CB-CG1 3.94Å; F60-V91 HydrophobicContact CB-CG2 3.81Å; F60-V91 HydrophobicContact CD1-CG1 4.09Å; F60-V91 HydrophobicContact CD1-CG2 3.81Å; F60-V91 HydrophobicContact CD2-CB 4.49Å; F60-V91 HydrophobicContact CD2-CG1 3.28Å; F60-V91 HydrophobicContact CD2-CG2 4.41Å; F60-V91 HydrophobicContact CE1-CG1 4.44Å; F60-V91 HydrophobicContact CE1-CG2 4.5Å; F60-V91 HydrophobicContact CE2-CG1 3.68Å; F60-V91 HydrophobicContact CG-CB 4.3Å; F60-V91 HydrophobicContact CG-CG1 3.5Å; F60-V91 VanDerWaalsContact CG-CG1 3.5Å; F60-V91 HydrophobicContact CG-CG2 3.76Å; F60-V91 HydrophobicContact CZ-CG1 4.26Å; F60-K92 HydrophobicContact CE2-CG 4.13Å; F60-K92 HydrophobicContact CZ-CG 4.04Å
61	D	98.3	Very high	97.4	Very high	20 Å²	20	54.2 Å²	54.2	11%	0.107	30%	0.295	C	S	.	.	E	Extended strand (participates in β ladder)	trans	-138.1	121.5	173.7	-159.8	-36	0	0	0	109.2	R45 R59 D63 A64	R45-D61 IonicContact CZ-OD1 2.98Å; R45-D61 IonicContact CZ-OD2 3.68Å; R45-D61 IonicContact NE-OD1 2.69Å; R45-D61 PolarHBondContact NE-OD1 2.88Å; R45-D61 IonicContact NE-OD2 2.86Å; R45-D61 IonicContact NH2-OD1 3.08Å; R45-D61 PolarHBondContact NH2-OD1 2.86Å; R45-D61 IonicContact NH2-OD2 3.97Å; R45-D61 PolarHBondContact NH2-OD2 2.86Å; R59-D61 IonicContact CZ-OD2 2.74Å; R59-D61 IonicContact NE-OD2 3.67Å; R59-D61 IonicContact NH2-OD2 3.89Å; R59-D61 PolarHBondContact NH2-OD2 2.91Å; D61-D63 PolarHBondContact O-N 2.82Å; D61-D63 PolarHBondContact OD1-N 3.4Å; D61-A64 HydrophobicContact CB-CB 4.11Å; D61-A64 WeakPolarHBondContact O-CB 3.34Å; D61-A64 PolarHBondContact O-N 2.84Å; D61-A64 VanDerWaalsContact O-N 3.13Å
62	S	97	Very high	97.4	Very high	16 Å²	16	56.5 Å²	56.5	11%	0.112	30%	0.303	C	S	.	.	T	Hydrogen-bonded Turn	trans	-65.3	-21.6	-179.4	67	0	0	0	0	113	R45 F46 Q67	R45-S62 WeakPolarHBondContact CA-OG 3.39Å; F46-S62 PolarHBondContact N-OG 2.69Å; F46-S62 PolarHBondContact O-N 3.01Å; F46-S62 PolarHBondContact O-OG 3.48Å; S62-Q67 PolarHBondContact O-NE2 3.21Å
63	D	96	Very high	97.4	Very high	73 Å²	73	55.1 Å²	55.1	39%	0.39	30%	0.295	S	S	.	.	T	Hydrogen-bonded Turn	trans	-88.7	-8.5	178.8	-72.8	0.7	0	0	0	112.4	R38 R45 D61	R38-D63 IonicContact CZ-OD1 3.69Å; R38-D63 IonicContact CZ-OD2 3.98Å; R38-D63 VanDerWaalsContact NH1-CG 3.32Å; R38-D63 IonicContact NH1-OD1 3.01Å; R38-D63 PolarHBondContact NH1-OD1 2.88Å; R38-D63 VanDerWaalsContact NH1-OD1 3.15Å; R38-D63 IonicContact NH1-OD2 3.42Å; R38-D63 PolarHBondContact NH1-OD2 3.22Å; R38-D63 IonicContact NH2-OD1 3.64Å; R38-D63 PolarHBondContact NH2-OD1 2.96Å; R38-D63 IonicContact NH2-OD2 2.69Å; R45-D63 VanDerWaalsContact CD-OD2 3.25Å; R45-D63 WeakPolarHBondContact CD-OD2 3.4Å; R45-D63 IonicContact NE-OD2 3.83Å; D61-D63 PolarHBondContact O-N 2.82Å; D61-D63 PolarHBondContact OD1-N 3.4Å
64	A	96.6	Very high	97.5	Very high	30 Å²	30	57.2 Å²	57.2	25%	0.248	31%	0.312	C	S	.	.	S	Bend	trans	-70.4	142.9	175.3	0	0	0	0	0	110.7	D61 S66 Q67	D61-A64 HydrophobicContact CB-CB 4.11Å; D61-A64 WeakPolarHBondContact O-CB 3.34Å; D61-A64 PolarHBondContact O-N 2.84Å; D61-A64 VanDerWaalsContact O-N 3.13Å; A64-S66 VanDerWaalsContact C-N 3.25Å; A64-S66 PolarHBondContact O-N 2.82Å; A64-Q67 WeakPolarHBondContact O-CG 3.18Å; A64-Q67 PolarHBondContact O-N 2.72Å; A64-Q67 VanDerWaalsContact O-N 3.09Å
65	A	96.1	Very high	97.5	Very high	116 Å²	116	57.1 Å²	57.1	96%	0.959	30%	0.302	S	S	*	.	T	Hydrogen-bonded Turn	trans	-60.7	-33.6	-179.6	0	0	0	0	0	113.3
66	S	94.4	Very high	97.6	Very high	45 Å²	45	53.8 Å²	53.8	32%	0.315	28%	0.282	S	S	.	.	T	Hydrogen-bonded Turn	trans	-70.3	-34.7	177.6	59.6	0	0	0	0	112	A64 R68 E70	A64-S66 VanDerWaalsContact C-N 3.25Å; A64-S66 PolarHBondContact O-N 2.82Å; S66-R68 WeakPolarHBondContact O-CG 3.42Å; S66-R68 PolarHBondContact O-N 2.81Å; S66-E70 PolarHBondContact OG-OE1 3.37Å
67	Q	96.1	Very high	97.5	Very high	87 Å²	87	57.2 Å²	57.2	41%	0.407	30%	0.298	S	S	.	.			trans	39.6	50.5	-166.2	-59	-173.3	-36.4	0	0	111.5	F60 S62 A64 K92	F60-Q67 HydrophobicContact CE2-CB 4.39Å; F60-Q67 WeakPolarHBondContact CE2-O 3.09Å; F60-Q67 HydrophobicContact CZ-CB 4.46Å; S62-Q67 PolarHBondContact O-NE2 3.21Å; A64-Q67 WeakPolarHBondContact O-CG 3.18Å; A64-Q67 PolarHBondContact O-N 2.72Å; A64-Q67 VanDerWaalsContact O-N 3.09Å; Q67-K92 WeakPolarHBondContact O-CE 3.49Å; Q67-K92 PolarHBondContact O-NZ 3.15Å; Q67-K92 VanDerWaalsContact O-NZ 3.13Å
68	R	98	Very high	97.4	Very high	146 Å²	146	64.7 Å²	64.7	55%	0.551	33%	0.333	S	S	*	.	S	Bend	trans	-120.8	157.3	177.3	-75.2	-169.7	170.1	109.3	-2.8	110.7	F60 S66 T88	F60-R68 WeakPolarHBondContact CD2-O 3.35Å; S66-R68 WeakPolarHBondContact O-CG 3.42Å; S66-R68 PolarHBondContact O-N 2.81Å; R68-T88 HydrophobicContact CB-CG2 4.44Å; R68-T88 HydrophobicContact CG-CG2 4.17Å
69	M	98.4	Very high	97.4	Very high	12 Å²	12	68.3 Å²	68.3	6%	0.059	35%	0.35	C	S	.	.			trans	-70	126.7	164.5	-171.8	66.9	78.6	0	0	107.9	V58 R59 F60 W84 Q87 T88 V91	V58-M69 HydrophobicContact CB-CG 4.17Å; V58-M69 HydrophobicContact CB-SD 3.8Å; V58-M69 HydrophobicContact CG1-CG 4.31Å; V58-M69 HydrophobicContact CG2-SD 4.19Å; R59-M69 VanDerWaalsContact C-SD 3.51Å; F60-M69 HydrophobicContact CB-CE 4.19Å; F60-M69 HydrophobicContact CB-SD 3.96Å; M69-W84 HydrophobicContact CB-CE3 4.29Å; M69-W84 HydrophobicContact CG-CE3 4.2Å; M69-W84 HydrophobicContact CG-CZ3 4.01Å; M69-Q87 HydrophobicContact CB-CB 3.96Å; M69-Q87 HydrophobicContact CE-CB 4.46Å; M69-Q87 HydrophobicContact CG-CB 3.97Å; M69-T88 PolarHBondContact N-OG1 3.23Å; M69-V91 HydrophobicContact CE-CB 3.94Å; M69-V91 HydrophobicContact CE-CG1 4.08Å; M69-V91 HydrophobicContact CE-CG2 4.16Å
70	E	98.1	Very high	97.4	Very high	60 Å²	60	66.9 Å²	66.9	28%	0.28	35%	0.353	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-117.7	139.9	-173.7	-68.3	175.4	173.7	0	0	111	V58 R59 S66 R72	V58-E70 WeakPolarHBondContact CA-O 3.31Å; R59-E70 PolarHBondContact N-O 2.79Å; R59-E70 PolarHBondContact O-N 2.72Å; S66-E70 PolarHBondContact OG-OE1 3.37Å; E70-R72 IonicContact OE2-CZ 2.69Å; E70-R72 IonicContact OE2-NH2 3.63Å; E70-R72 PolarHBondContact OE2-NH2 2.87Å
71	P	98.3	Very high	97.4	Very high	47 Å²	47	70.6 Å²	70.6	31%	0.305	38%	0.378	S	S	.	.	E	Extended strand (participates in β ladder)	trans	-65.2	145.9	172.6	28.6	-34.5	0	0	0	110.8	I76 E77 W84	P71-I76 HydrophobicContact CB-CG2 3.54Å; P71-E77 HydrophobicContact CB-CG 3.83Å; P71-E77 HydrophobicContact CG-CG 3.99Å; P71-W84 HydrophobicContact CB-CH2 3.65Å; P71-W84 HydrophobicContact CB-CZ2 3.89Å; P71-W84 HydrophobicContact CG-CH2 4.26Å; P71-W84 HydrophobicContact CG-CZ2 4.28Å
72	R	98.4	Very high	97.4	Very high	117 Å²	117	76.5 Å²	76.5	44%	0.442	41%	0.405	S	S	.	.			trans	-128	0.7	176.2	-59.9	-64.6	169.1	170.6	-2.6	113.4	Q56 F57 R59 E70	Q56-R72 HydrophobicContact CG-CB 4.16Å; Q56-R72 HydrophobicContact CG-CG 4.33Å; Q56-R72 CarbonylContact O-C 3.39Å; Q56-R72 WeakPolarHBondContact O-CB 3.25Å; F57-R72 PolarHBondContact O-N 3.11Å; R59-R72 HydrophobicContact CB-CG 3.85Å; E70-R72 IonicContact OE2-CZ 2.69Å; E70-R72 IonicContact OE2-NH2 3.63Å; E70-R72 PolarHBondContact OE2-NH2 2.87Å
73	A	97.6	Very high	97.4	Very high	6 Å²	6	78.3 Å²	78.3	5%	0.05	41%	0.41	C	S	.	.	S	Bend	trans	-140.3	145.7	172.4	0	0	0	0	0	110.5	F57 W75 I76	F57-A73 HydrophobicContact CB-CB 4.33Å; A73-W75 VanDerWaalsContact C-N 3.26Å; A73-W75 HydrophobicContact CB-CD2 4.36Å; A73-W75 HydrophobicContact CB-CG 4.38Å; A73-W75 HydrophobicContact CB-CZ2 4.27Å; A73-W75 VanDerWaalsContact CB-NE1 3.29Å; A73-W75 PolarHBondContact O-N 3.13Å; A73-I76 WeakPolarHBondContact O-CG2 3.37Å; A73-I76 PolarHBondContact O-N 2.96Å
74	P	97.8	Very high	97.5	Very high	106 Å²	106	76.5 Å²	76.5	69%	0.688	40%	0.397	S	S	*	.	G	3₁₀ helix	trans	-60.2	-32.8	-174.1	-26.7	35	0	0	0	114.3	I76 E77	P74-I76 VanDerWaalsContact C-N 3.26Å; P74-I76 PolarHBondContact O-N 2.74Å; P74-E77 WeakPolarHBondContact O-CB 3.35Å; P74-E77 PolarHBondContact O-N 3.49Å
75	W	96.6	Very high	97.6	Very high	118 Å²	118	79.2 Å²	79.2	45%	0.447	41%	0.408	S	S	.	.	G	3₁₀ helix	trans	-69.6	-20.4	-175.8	54.9	-103	0	0	0	113.8	V52 F57 A73 Q78	V52-W75 HydrophobicContact CB-CH2 4.28Å; V52-W75 HydrophobicContact CB-CZ2 4.28Å; V52-W75 HydrophobicContact CG2-CH2 3.95Å; V52-W75 HydrophobicContact CG2-CZ2 4.43Å; F57-W75 HydrophobicContact CB-CH2 3.26Å; F57-W75 HydrophobicContact CB-CZ2 3.21Å; F57-W75 HydrophobicContact CB-CZ3 4.25Å; F57-W75 HydrophobicContact CD1-CH2 4.25Å; F57-W75 AromaticContact CD2-CH2 3.45Å; F57-W75 HydrophobicContact CD2-CH2 3.45Å; F57-W75 VanDerWaalsContact CD2-CH2 3.45Å; F57-W75 HydrophobicContact CD2-CZ2 4.31Å; F57-W75 AromaticContact CD2-CZ3 3.92Å; F57-W75 HydrophobicContact CD2-CZ3 3.92Å; F57-W75 HydrophobicContact CE2-CH2 4.33Å; F57-W75 AromaticContact CG-CH2 3.41Å; F57-W75 HydrophobicContact CG-CH2 3.41Å; F57-W75 VanDerWaalsContact CG-CH2 3.41Å; F57-W75 AromaticContact CG-CZ2 3.89Å; F57-W75 HydrophobicContact CG-CZ2 3.89Å; F57-W75 HydrophobicContact CG-CZ3 4.32Å; A73-W75 VanDerWaalsContact C-N 3.26Å; A73-W75 HydrophobicContact CB-CD2 4.36Å; A73-W75 HydrophobicContact CB-CG 4.38Å; A73-W75 HydrophobicContact CB-CZ2 4.27Å; A73-W75 VanDerWaalsContact CB-NE1 3.29Å; A73-W75 PolarHBondContact O-N 3.13Å; W75-Q78 WeakPolarHBondContact O-CG 3.41Å
76	I	98.1	Very high	97.7	Very high	7 Å²	7	77.6 Å²	77.6	4%	0.036	38%	0.382	C	S	.	.	G	3₁₀ helix	trans	-86.4	-16.1	176.9	-165.8	69.1	0	0	0	111.7	F57 V58 P71 A73 P74 Q78 E79 Y83 W84	F57-I76 HydrophobicContact CD2-CB 4.32Å; F57-I76 HydrophobicContact CD2-CD1 4.03Å; F57-I76 HydrophobicContact CD2-CG1 3.97Å; F57-I76 HydrophobicContact CE2-CD1 4.19Å; F57-I76 HydrophobicContact CE2-CG1 4.45Å; F57-I76 WeakPolarHBondContact O-CG2 3.36Å; V58-I76 HydrophobicContact CG1-CG1 4.41Å; P71-I76 HydrophobicContact CB-CG2 3.54Å; A73-I76 WeakPolarHBondContact O-CG2 3.37Å; A73-I76 PolarHBondContact O-N 2.96Å; P74-I76 VanDerWaalsContact C-N 3.26Å; P74-I76 PolarHBondContact O-N 2.74Å; I76-Q78 PolarHBondContact O-N 3.23Å; I76-Q78 VanDerWaalsContact O-N 3.13Å; I76-E79 HydrophobicContact CD1-CG 3.68Å; I76-E79 HydrophobicContact CG1-CG 4.23Å; I76-E79 WeakPolarHBondContact O-CB 3.34Å; I76-E79 WeakPolarHBondContact O-CG 3.48Å; I76-E79 PolarHBondContact O-N 2.89Å; I76-E79 VanDerWaalsContact O-N 3.11Å; I76-Y83 HydrophobicContact CD1-CE1 4.36Å; I76-W84 HydrophobicContact CB-CH2 4.44Å; I76-W84 HydrophobicContact CG1-CH2 3.65Å; I76-W84 HydrophobicContact CG1-CZ2 3.91Å; I76-W84 HydrophobicContact CG2-CH2 4.07Å; I76-W84 HydrophobicContact CG2-CZ2 4.4Å; I76-W84 WeakPolarHBondContact O-CZ2 3.21Å
77	E	97	Very high	97.9	Very high	126 Å²	126	77.3 Å²	77.3	59%	0.589	38%	0.376	S	S	*	.	T	Hydrogen-bonded Turn	trans	-65.5	-17.5	-179.4	-63.5	178.8	-166.8	0	0	113.2	P71 P74 E79	P71-E77 HydrophobicContact CB-CG 3.83Å; P71-E77 HydrophobicContact CG-CG 3.99Å; P74-E77 WeakPolarHBondContact O-CB 3.35Å; P74-E77 PolarHBondContact O-N 3.49Å; E77-E79 PolarHBondContact O-N 3.44Å
78	Q	97.8	Very high	98.1	Very high	162 Å²	162	73.7 Å²	73.7	76%	0.757	36%	0.36	S	S	*	.	T	Hydrogen-bonded Turn	trans	-67.7	-16	174.9	74.2	-175.4	13	0	0	113.5	W75 I76	W75-Q78 WeakPolarHBondContact O-CG 3.41Å; I76-Q78 PolarHBondContact O-N 3.23Å; I76-Q78 VanDerWaalsContact O-N 3.13Å
79	E	98.3	Very high	98.1	Very high	76 Å²	76	75 Å²	75	36%	0.355	37%	0.365	S	S	.	.	S	Bend	trans	-67.3	139.9	178.9	-69	-62.6	158.5	0	0	111.9	I76 E77 Y83 W84	I76-E79 HydrophobicContact CD1-CG 3.68Å; I76-E79 HydrophobicContact CG1-CG 4.23Å; I76-E79 WeakPolarHBondContact O-CB 3.34Å; I76-E79 WeakPolarHBondContact O-CG 3.48Å; I76-E79 PolarHBondContact O-N 2.89Å; I76-E79 VanDerWaalsContact O-N 3.11Å; E77-E79 PolarHBondContact O-N 3.44Å; E79-Y83 HydrophobicContact CB-CD1 3.63Å; E79-Y83 HydrophobicContact CB-CE1 4.26Å; E79-Y83 HydrophobicContact CB-CG 3.91Å; E79-Y83 HydrophobicContact CG-CD1 3.91Å; E79-Y83 HydrophobicContact CG-CD2 4.48Å; E79-Y83 HydrophobicContact CG-CE1 4.13Å; E79-Y83 HydrophobicContact CG-CG 4.11Å; E79-W84 HydrophobicContact CB-CZ2 4.3Å; E79-W84 PolarHBondContact O-NE1 2.79Å; E79-W84 VanDerWaalsContact O-NE1 3.11Å
80	G	98.1	Very high	98.1	Very high	29 Å²	29	78.4 Å²	78.4	30%	0.299	38%	0.383	S	S	.	.			trans	-71.3	165.7	-178.3	0	0	0	0	0	114.1	E82 Y83 W84	G80-E82 PolarHBondContact O-N 3.25Å; G80-Y83 WeakPolarHBondContact O-CB 3.45Å; G80-Y83 PolarHBondContact O-N 3.38Å; G80-Y83 VanDerWaalsContact O-N 3.12Å; G80-W84 PolarHBondContact O-N 3.09Å
81	P	97.7	Very high	98.1	Very high	84 Å²	84	76 Å²	76	55%	0.545	37%	0.373	S	S	.	.	H	α-helix	trans	-58.6	-32.4	179.9	23.7	-32.4	0	0	0	113.1	Y83 W84 D85	P81-Y83 VanDerWaalsContact C-N 3.3Å; P81-Y83 PolarHBondContact O-N 3.12Å; P81-W84 PolarHBondContact O-N 3.25Å; P81-D85 WeakPolarHBondContact O-CB 3.4Å; P81-D85 PolarHBondContact O-N 3.44Å
82	E	98.4	Very high	98.1	Very high	143 Å²	143	77.7 Å²	77.7	67%	0.668	38%	0.375	S	S	*	.	H	α-helix	trans	-62.3	-37.3	178.4	-62.2	75.4	-165.2	0	0	112.1	G80 L86	G80-E82 PolarHBondContact O-N 3.25Å; E82-L86 VanDerWaalsContact O-CB 3.29Å; E82-L86 WeakPolarHBondContact O-CB 3.41Å; E82-L86 PolarHBondContact O-N 3.22Å
83	Y	98.3	Very high	98.1	Very high	54 Å²	54	74.9 Å²	74.9	21%	0.212	38%	0.377	C	S	.	.	H	α-helix	trans	-63.3	-50.6	174.8	172.3	-92.2	0	0	0	110.3	I76 E79 G80 P81 D85 L86 Q87	I76-Y83 HydrophobicContact CD1-CE1 4.36Å; E79-Y83 HydrophobicContact CB-CD1 3.63Å; E79-Y83 HydrophobicContact CB-CE1 4.26Å; E79-Y83 HydrophobicContact CB-CG 3.91Å; E79-Y83 HydrophobicContact CG-CD1 3.91Å; E79-Y83 HydrophobicContact CG-CD2 4.48Å; E79-Y83 HydrophobicContact CG-CE1 4.13Å; E79-Y83 HydrophobicContact CG-CG 4.11Å; G80-Y83 WeakPolarHBondContact O-CB 3.45Å; G80-Y83 PolarHBondContact O-N 3.38Å; G80-Y83 VanDerWaalsContact O-N 3.12Å; P81-Y83 VanDerWaalsContact C-N 3.3Å; P81-Y83 PolarHBondContact O-N 3.12Å; Y83-D85 PolarHBondContact O-N 2.9Å; Y83-L86 PolarHBondContact O-N 3.21Å; Y83-Q87 HydrophobicContact CD1-CG 4.14Å; Y83-Q87 HydrophobicContact CD2-CG 4.34Å; Y83-Q87 HydrophobicContact CE1-CG 3.73Å; Y83-Q87 HydrophobicContact CE2-CG 3.95Å; Y83-Q87 HydrophobicContact CG-CG 4.42Å; Y83-Q87 WeakPolarHBondContact O-CG 3.45Å; Y83-Q87 PolarHBondContact O-N 2.91Å
84	W	98.4	Very high	98.1	Very high	36 Å²	36	78.5 Å²	78.5	14%	0.136	39%	0.393	C	S	.	.	H	α-helix	trans	-64.5	-38.8	-177.8	-65.7	113.2	0	0	0	112.8	V58 M69 P71 I76 E79 G80 P81 T88	V58-W84 HydrophobicContact CG1-CH2 3.99Å; V58-W84 HydrophobicContact CG1-CZ3 3.84Å; M69-W84 HydrophobicContact CB-CE3 4.29Å; M69-W84 HydrophobicContact CG-CE3 4.2Å; M69-W84 HydrophobicContact CG-CZ3 4.01Å; P71-W84 HydrophobicContact CB-CH2 3.65Å; P71-W84 HydrophobicContact CB-CZ2 3.89Å; P71-W84 HydrophobicContact CG-CH2 4.26Å; P71-W84 HydrophobicContact CG-CZ2 4.28Å; I76-W84 HydrophobicContact CB-CH2 4.44Å; I76-W84 HydrophobicContact CG1-CH2 3.65Å; I76-W84 HydrophobicContact CG1-CZ2 3.91Å; I76-W84 HydrophobicContact CG2-CH2 4.07Å; I76-W84 HydrophobicContact CG2-CZ2 4.4Å; I76-W84 WeakPolarHBondContact O-CZ2 3.21Å; E79-W84 HydrophobicContact CB-CZ2 4.3Å; E79-W84 PolarHBondContact O-NE1 2.79Å; E79-W84 VanDerWaalsContact O-NE1 3.11Å; G80-W84 PolarHBondContact O-N 3.09Å; P81-W84 PolarHBondContact O-N 3.25Å; W84-T88 WeakPolarHBondContact O-CB 3.39Å; W84-T88 PolarHBondContact O-N 3.05Å; W84-T88 PolarHBondContact O-OG1 3.42Å
85	D	98.4	Very high	98.1	Very high	86 Å²	86	74.3 Å²	74.3	46%	0.46	37%	0.366	S	S	.	.	H	α-helix	trans	-66.3	-41.3	175.6	-80.4	-16.4	0	0	0	111.6	P81 Y83 T88 R89	P81-D85 WeakPolarHBondContact O-CB 3.4Å; P81-D85 PolarHBondContact O-N 3.44Å; Y83-D85 PolarHBondContact O-N 2.9Å; D85-T88 PolarHBondContact O-N 3.35Å; D85-R89 WeakPolarHBondContact O-CB 3.04Å; D85-R89 PolarHBondContact O-N 3.35Å
86	L	98.6	Very high	98.1	Very high	82 Å²	82	74 Å²	74	43%	0.429	37%	0.369	S	S	.	.	H	α-helix	trans	-63.9	-49.7	175.3	179.9	63.5	0	0	0	111.5	E82 Y83 T88 R89 N90	E82-L86 VanDerWaalsContact O-CB 3.29Å; E82-L86 WeakPolarHBondContact O-CB 3.41Å; E82-L86 PolarHBondContact O-N 3.22Å; Y83-L86 PolarHBondContact O-N 3.21Å; L86-T88 VanDerWaalsContact C-N 3.3Å; L86-T88 PolarHBondContact O-N 3.13Å; L86-R89 PolarHBondContact O-N 3.18Å; L86-N90 VanDerWaalsContact O-CG 3.26Å; L86-N90 PolarHBondContact O-N 2.96Å
87	Q	98.4	Very high	98	Very high	40 Å²	40	77 Å²	77	19%	0.187	39%	0.389	C	S	.	.	H	α-helix	trans	-61.6	-40.5	178.5	-66.6	-50.1	-44.6	0	0	111.4	M69 Y83 N90 V91	M69-Q87 HydrophobicContact CB-CB 3.96Å; M69-Q87 HydrophobicContact CE-CB 4.46Å; M69-Q87 HydrophobicContact CG-CB 3.97Å; Y83-Q87 HydrophobicContact CD1-CG 4.14Å; Y83-Q87 HydrophobicContact CD2-CG 4.34Å; Y83-Q87 HydrophobicContact CE1-CG 3.73Å; Y83-Q87 HydrophobicContact CE2-CG 3.95Å; Y83-Q87 HydrophobicContact CG-CG 4.42Å; Y83-Q87 WeakPolarHBondContact O-CG 3.45Å; Y83-Q87 PolarHBondContact O-N 2.91Å; Q87-N90 PolarHBondContact O-N 3.15Å; Q87-V91 WeakPolarHBondContact O-CG1 3.24Å; Q87-V91 PolarHBondContact O-N 3.26Å
88	T	98.6	Very high	98	Very high	10 Å²	10	72.2 Å²	72.2	6%	0.061	37%	0.367	C	S	.	.	H	α-helix	trans	-62	-43.2	175.1	-63.2	0	0	0	0	111.8	R68 M69 W84 D85 L86 V91 K92	R68-T88 HydrophobicContact CB-CG2 4.44Å; R68-T88 HydrophobicContact CG-CG2 4.17Å; M69-T88 PolarHBondContact N-OG1 3.23Å; W84-T88 WeakPolarHBondContact O-CB 3.39Å; W84-T88 PolarHBondContact O-N 3.05Å; W84-T88 PolarHBondContact O-OG1 3.42Å; D85-T88 PolarHBondContact O-N 3.35Å; L86-T88 VanDerWaalsContact C-N 3.3Å; L86-T88 PolarHBondContact O-N 3.13Å; T88-V91 WeakPolarHBondContact O-CG1 3.28Å; T88-K92 HydrophobicContact CG2-CD 4.17Å; T88-K92 WeakPolarHBondContact O-CB 3.41Å; T88-K92 VanDerWaalsContact O-CG 3.31Å; T88-K92 WeakPolarHBondContact O-CG 3.25Å; T88-K92 PolarHBondContact O-N 3.2Å; T88-K92 VanDerWaalsContact O-N 3.07Å
89	R	98.6	Very high	97.9	Very high	174 Å²	174	69.7 Å²	69.7	66%	0.657	35%	0.35	S	S	*	.	H	α-helix	trans	-63.5	-46	177.6	-175.3	-177.3	-62.1	162.1	3.1	111.4	D85 L86 K92 A93	D85-R89 WeakPolarHBondContact O-CB 3.04Å; D85-R89 PolarHBondContact O-N 3.35Å; L86-R89 PolarHBondContact O-N 3.18Å; R89-K92 PolarHBondContact O-N 3.34Å; R89-A93 PolarHBondContact O-N 3.21Å
90	N	98.3	Very high	97.8	Very high	83 Å²	83	69 Å²	69	44%	0.444	36%	0.357	S	S	.	.	H	α-helix	trans	-62.1	-46.2	-178.7	-69.5	-12.4	0	0	0	111.5	L86 Q87 K92 A93 Q94	L86-N90 VanDerWaalsContact O-CG 3.26Å; L86-N90 PolarHBondContact O-N 2.96Å; Q87-N90 PolarHBondContact O-N 3.15Å; N90-K92 VanDerWaalsContact C-N 3.35Å; N90-K92 PolarHBondContact O-N 3.42Å; N90-A93 WeakPolarHBondContact O-CB 3.49Å; N90-A93 PolarHBondContact O-N 3.41Å; N90-Q94 PolarHBondContact O-N 3.4Å
91	V	98.1	Very high	97.7	Very high	10 Å²	10	71.3 Å²	71.3	6%	0.061	36%	0.363	C	S	.	.	H	α-helix	trans	-69.6	-32.6	-179.6	75	0	0	0	0	112.5	F46 A48 F60 M69 Q87 T88 Q94 S95	F46-V91 HydrophobicContact CD1-CG2 4.36Å; F46-V91 HydrophobicContact CE1-CG2 3.44Å; F46-V91 VanDerWaalsContact CE1-CG2 3.44Å; F46-V91 HydrophobicContact CZ-CG2 4.13Å; A48-V91 HydrophobicContact CB-CG2 3.6Å; F60-V91 HydrophobicContact CB-CB 4.48Å; F60-V91 HydrophobicContact CB-CG1 3.94Å; F60-V91 HydrophobicContact CB-CG2 3.81Å; F60-V91 HydrophobicContact CD1-CG1 4.09Å; F60-V91 HydrophobicContact CD1-CG2 3.81Å; F60-V91 HydrophobicContact CD2-CB 4.49Å; F60-V91 HydrophobicContact CD2-CG1 3.28Å; F60-V91 HydrophobicContact CD2-CG2 4.41Å; F60-V91 HydrophobicContact CE1-CG1 4.44Å; F60-V91 HydrophobicContact CE1-CG2 4.5Å; F60-V91 HydrophobicContact CE2-CG1 3.68Å; F60-V91 HydrophobicContact CG-CB 4.3Å; F60-V91 HydrophobicContact CG-CG1 3.5Å; F60-V91 VanDerWaalsContact CG-CG1 3.5Å; F60-V91 HydrophobicContact CG-CG2 3.76Å; F60-V91 HydrophobicContact CZ-CG1 4.26Å; M69-V91 HydrophobicContact CE-CB 3.94Å; M69-V91 HydrophobicContact CE-CG1 4.08Å; M69-V91 HydrophobicContact CE-CG2 4.16Å; Q87-V91 WeakPolarHBondContact O-CG1 3.24Å; Q87-V91 PolarHBondContact O-N 3.26Å; T88-V91 WeakPolarHBondContact O-CG1 3.28Å; V91-Q94 PolarHBondContact O-N 2.83Å; V91-S95 WeakPolarHBondContact O-CB 3.37Å; V91-S95 PolarHBondContact O-N 3.3Å
92	K	98.1	Very high	97.5	Very high	83 Å²	83	69.3 Å²	69.3	36%	0.361	35%	0.348	S	S	.	.	H	α-helix	trans	-65.4	-40.6	171.1	-77.3	-177.3	179.2	-177.3	0	112	F60 Q67 T88 R89 N90 S95 Q96	F60-K92 HydrophobicContact CE2-CG 4.13Å; F60-K92 HydrophobicContact CZ-CG 4.04Å; Q67-K92 WeakPolarHBondContact O-CE 3.49Å; Q67-K92 PolarHBondContact O-NZ 3.15Å; Q67-K92 VanDerWaalsContact O-NZ 3.13Å; T88-K92 HydrophobicContact CG2-CD 4.17Å; T88-K92 WeakPolarHBondContact O-CB 3.41Å; T88-K92 VanDerWaalsContact O-CG 3.31Å; T88-K92 WeakPolarHBondContact O-CG 3.25Å; T88-K92 PolarHBondContact O-N 3.2Å; T88-K92 VanDerWaalsContact O-N 3.07Å; R89-K92 PolarHBondContact O-N 3.34Å; N90-K92 VanDerWaalsContact C-N 3.35Å; N90-K92 PolarHBondContact O-N 3.42Å; K92-S95 WeakPolarHBondContact O-CB 3.48Å; K92-S95 PolarHBondContact O-N 3.49Å; K92-Q96 PolarHBondContact O-N 2.79Å
93	A	98.3	Very high	97.2	Very high	57 Å²	57	64.7 Å²	64.7	47%	0.471	34%	0.338	S	S	.	.	H	α-helix	trans	-62.9	-45.5	174.3	0	0	0	0	0	111.2	R89 N90 S95 Q96 T97	R89-A93 PolarHBondContact O-N 3.21Å; N90-A93 WeakPolarHBondContact O-CB 3.49Å; N90-A93 PolarHBondContact O-N 3.41Å; A93-S95 VanDerWaalsContact C-N 3.29Å; A93-S95 PolarHBondContact O-N 2.88Å; A93-Q96 PolarHBondContact O-N 3.2Å; A93-Q96 VanDerWaalsContact O-N 3.14Å; A93-T97 PolarHBondContact O-N 3.35Å; A93-T97 VanDerWaalsContact O-N 3.14Å; A93-T97 PolarHBondContact O-OG1 3.05Å
94	Q	97.9	Very high	97.1	Very high	82 Å²	82	65.3 Å²	65.3	38%	0.383	35%	0.347	S	S	.	.	H	α-helix	trans	-58.4	-40.9	174.7	-172.2	62.2	53.4	0	0	112	T33 F46 N90 V91 Q96 T97 D98	T33-Q94 HydrophobicContact CG2-CG 4.46Å; F46-Q94 HydrophobicContact CE2-CG 4.05Å; F46-Q94 HydrophobicContact CZ-CB 4.2Å; F46-Q94 HydrophobicContact CZ-CG 3.92Å; N90-Q94 PolarHBondContact O-N 3.4Å; V91-Q94 PolarHBondContact O-N 2.83Å; Q94-Q96 VanDerWaalsContact C-N 3.3Å; Q94-Q96 PolarHBondContact O-N 3.24Å; Q94-T97 WeakPolarHBondContact O-CB 3.33Å; Q94-T97 PolarHBondContact O-N 3.4Å; Q94-D98 PolarHBondContact NE2-OD1 3.14Å; Q94-D98 PolarHBondContact O-N 3Å
95	S	97.3	Very high	96.9	Very high	18 Å²	18	67.5 Å²	67.5	13%	0.126	36%	0.362	C	S	.	.	H	α-helix	trans	-59.2	-38	176.6	175.2	0	0	0	0	113.2	F46 V91 K92 A93 R99	F46-S95 WeakPolarHBondContact CB-OG 3.32Å; F46-S95 VanDerWaalsContact CD2-CA 3.47Å; V91-S95 WeakPolarHBondContact O-CB 3.37Å; V91-S95 PolarHBondContact O-N 3.3Å; K92-S95 WeakPolarHBondContact O-CB 3.48Å; K92-S95 PolarHBondContact O-N 3.49Å; A93-S95 VanDerWaalsContact C-N 3.29Å; A93-S95 PolarHBondContact O-N 2.88Å; S95-R99 WeakPolarHBondContact O-CB 3.44Å; S95-R99 PolarHBondContact O-N 3.36Å
96	Q	96.9	Very high	96.6	Very high	111 Å²	111	69.7 Å²	69.7	52%	0.519	36%	0.363	S	S	.	.	H	α-helix	trans	-69.8	-40.8	175.9	-62.5	-52.3	-48.5	0	0	112.1	K92 A93 Q94 R99 A100	K92-Q96 PolarHBondContact O-N 2.79Å; A93-Q96 PolarHBondContact O-N 3.2Å; A93-Q96 VanDerWaalsContact O-N 3.14Å; Q94-Q96 VanDerWaalsContact C-N 3.3Å; Q94-Q96 PolarHBondContact O-N 3.24Å; Q96-R99 WeakPolarHBondContact O-CB 3.49Å; Q96-R99 PolarHBondContact O-N 2.93Å; Q96-A100 PolarHBondContact O-N 2.97Å; Q96-A100 VanDerWaalsContact O-N 3.08Å
97	T	97.6	Very high	96.3	Very high	72 Å²	72	67.9 Å²	67.9	44%	0.442	37%	0.365	S	S	.	.	H	α-helix	trans	-60	-47	174.2	-60.5	0	0	0	0	111.2	A93 Q94 R99 A100 N101	A93-T97 PolarHBondContact O-N 3.35Å; A93-T97 VanDerWaalsContact O-N 3.14Å; A93-T97 PolarHBondContact O-OG1 3.05Å; Q94-T97 WeakPolarHBondContact O-CB 3.33Å; Q94-T97 PolarHBondContact O-N 3.4Å; T97-R99 VanDerWaalsContact C-N 3.33Å; T97-R99 PolarHBondContact O-N 3.3Å; T97-A100 PolarHBondContact O-N 3.47Å; T97-N101 VanDerWaalsContact O-CG 3.29Å; T97-N101 PolarHBondContact O-N 3.35Å; T97-N101 PolarHBondContact O-ND2 2.88Å
98	D	96.2	Very high	96.2	Very high	24 Å²	24	74.4 Å²	74.4	13%	0.128	39%	0.389	C	S	.	.	H	α-helix	trans	-64.5	-37.4	178.8	-82.3	25.6	0	0	0	112.4	S35 F46 Q94 A100 N101 L102	S35-D98 WeakPolarHBondContact OG-CB 3.48Å; S35-D98 PolarHBondContact OG-OD2 3.32Å; F46-D98 HydrophobicContact CD2-CB 4.11Å; F46-D98 HydrophobicContact CE2-CB 4.15Å; F46-D98 VanDerWaalsContact CE2-OD2 3.31Å; F46-D98 WeakPolarHBondContact CE2-OD2 3.46Å; Q94-D98 PolarHBondContact NE2-OD1 3.14Å; Q94-D98 PolarHBondContact O-N 3Å; D98-A100 VanDerWaalsContact C-N 3.34Å; D98-A100 PolarHBondContact O-N 3.34Å; D98-N101 PolarHBondContact O-N 3.23Å; D98-L102 WeakPolarHBondContact O-CG 3.29Å; D98-L102 PolarHBondContact O-N 3.19Å
99	R	95.2	Very high	96.1	Very high	110 Å²	110	81.6 Å²	81.6	42%	0.415	42%	0.416	S	S	.	.	H	α-helix	trans	-58.1	-47.2	172.5	174.7	-168.8	170.7	155.4	18.1	111.2	E43 P44 S95 Q96 T97 N101 L102 G103	E43-R99 VanDerWaalsContact CD-NH2 3.26Å; E43-R99 IonicContact OE1-CZ 3.57Å; E43-R99 IonicContact OE1-NH1 2.75Å; E43-R99 PolarHBondContact OE1-NH1 3.23Å; E43-R99 IonicContact OE1-NH2 3.64Å; E43-R99 PolarHBondContact OE1-NH2 2.93Å; E43-R99 WeakPolarHBondContact OE2-CD 3.48Å; E43-R99 IonicContact OE2-CZ 2.69Å; E43-R99 IonicContact OE2-NE 3.61Å; E43-R99 PolarHBondContact OE2-NE 3.41Å; E43-R99 VanDerWaalsContact OE2-NE 3.15Å; E43-R99 IonicContact OE2-NH1 2.87Å; E43-R99 PolarHBondContact OE2-NH1 3.05Å; E43-R99 IonicContact OE2-NH2 3.72Å; E43-R99 PolarHBondContact OE2-NH2 3.23Å; E43-R99 VanDerWaalsContact OE2-NH2 3.08Å; P44-R99 HydrophobicContact CG-CG 4.28Å; S95-R99 WeakPolarHBondContact O-CB 3.44Å; S95-R99 PolarHBondContact O-N 3.36Å; Q96-R99 WeakPolarHBondContact O-CB 3.49Å; Q96-R99 PolarHBondContact O-N 2.93Å; T97-R99 VanDerWaalsContact C-N 3.33Å; T97-R99 PolarHBondContact O-N 3.3Å; R99-N101 VanDerWaalsContact C-N 3.35Å; R99-L102 PolarHBondContact O-N 3.4Å; R99-G103 PolarHBondContact O-N 3.22Å
100	A	95.6	Very high	95.8	Very high	60 Å²	60	80.7 Å²	80.7	50%	0.496	42%	0.424	S	S	.	.	H	α-helix	trans	-62.7	-44.6	177.5	0	0	0	0	0	111	Q96 T97 D98 L102 G103 T104	Q96-A100 PolarHBondContact O-N 2.97Å; Q96-A100 VanDerWaalsContact O-N 3.08Å; T97-A100 PolarHBondContact O-N 3.47Å; D98-A100 VanDerWaalsContact C-N 3.34Å; D98-A100 PolarHBondContact O-N 3.34Å; A100-L102 VanDerWaalsContact C-N 3.34Å; A100-L102 PolarHBondContact O-N 3.02Å; A100-G103 WeakPolarHBondContact O-CA 2.93Å; A100-G103 PolarHBondContact O-N 2.92Å; A100-G103 VanDerWaalsContact O-N 3.08Å; A100-T104 PolarHBondContact O-N 3.03Å; A100-T104 PolarHBondContact O-OG1 2.95Å
101	N	95.9	Very high	95.3	Very high	79 Å²	79	82.6 Å²	82.6	42%	0.422	43%	0.431	S	S	.	.	H	α-helix	trans	-61.3	-39.6	177.6	-71.1	-21.6	0	0	0	112.6	T97 D98 R99 G103 T104 L105	T97-N101 VanDerWaalsContact O-CG 3.29Å; T97-N101 PolarHBondContact O-N 3.35Å; T97-N101 PolarHBondContact O-ND2 2.88Å; D98-N101 PolarHBondContact O-N 3.23Å; R99-N101 VanDerWaalsContact C-N 3.35Å; N101-G103 VanDerWaalsContact C-N 3.28Å; N101-G103 PolarHBondContact O-N 3.07Å; N101-T104 PolarHBondContact O-N 2.96Å; N101-L105 WeakPolarHBondContact O-CB 3.31Å; N101-L105 VanDerWaalsContact O-CG 3.28Å; N101-L105 WeakPolarHBondContact O-CG 3.41Å; N101-L105 PolarHBondContact O-N 3.13Å
102	L	94.3	Very high	94.2	Very high	42 Å²	42	88.7 Å²	88.7	22%	0.22	47%	0.474	C	S	.	.	H	α-helix	trans	-58.9	-41.5	173.8	-77.7	177	0	0	0	111.4	P44 D98 R99 A100 R106	P44-L102 HydrophobicContact CB-CD1 3.65Å; P44-L102 HydrophobicContact CG-CD1 3.86Å; D98-L102 WeakPolarHBondContact O-CG 3.29Å; D98-L102 PolarHBondContact O-N 3.19Å; R99-L102 PolarHBondContact O-N 3.4Å; A100-L102 VanDerWaalsContact C-N 3.34Å; A100-L102 PolarHBondContact O-N 3.02Å; L102-R106 WeakPolarHBondContact O-CB 3.41Å; L102-R106 PolarHBondContact O-N 3.45Å
103	G	92.7	Very high	94	Very high	46 Å²	46	89 Å²	89	47%	0.474	48%	0.479	S	S	.	.	H	α-helix	trans	-61.6	-47.2	174.4	0	0	0	0	0	112.6	R99 A100 N101 R106 G107	R99-G103 PolarHBondContact O-N 3.22Å; A100-G103 WeakPolarHBondContact O-CA 2.93Å; A100-G103 PolarHBondContact O-N 2.92Å; A100-G103 VanDerWaalsContact O-N 3.08Å; N101-G103 VanDerWaalsContact C-N 3.28Å; N101-G103 PolarHBondContact O-N 3.07Å; G103-R106 WeakPolarHBondContact O-CB 3.49Å; G103-R106 PolarHBondContact O-N 3.17Å; G103-G107 PolarHBondContact O-N 3.26Å; G103-G107 VanDerWaalsContact O-N 3.1Å
104	T	95.2	Very high	93.7	Very high	66 Å²	66	90.7 Å²	90.7	41%	0.405	48%	0.48	S	S	.	.	H	α-helix	trans	-61.8	-47.6	177.5	-62.5	0	0	0	0	111.9	A100 N101 R106 G107 Y108	A100-T104 PolarHBondContact O-N 3.03Å; A100-T104 PolarHBondContact O-OG1 2.95Å; N101-T104 PolarHBondContact O-N 2.96Å; T104-R106 VanDerWaalsContact C-N 3.31Å; T104-R106 PolarHBondContact O-N 3.02Å; T104-G107 PolarHBondContact O-N 2.91Å; T104-G107 VanDerWaalsContact O-N 3.13Å; T104-Y108 HydrophobicContact CG2-CD2 4.13Å; T104-Y108 HydrophobicContact CG2-CE1 4.06Å; T104-Y108 HydrophobicContact CG2-CE2 3.61Å; T104-Y108 PolarHBondContact O-N 3.19Å
105	L	95	Very high	93.5	Very high	83 Å²	83	91.2 Å²	91.2	44%	0.435	49%	0.485	S	S	.	.	H	α-helix	trans	-60.7	-42.2	177.9	-71.5	170.6	0	0	0	111.1	N101 G107 Y108 Y109	N101-L105 WeakPolarHBondContact O-CB 3.31Å; N101-L105 VanDerWaalsContact O-CG 3.28Å; N101-L105 WeakPolarHBondContact O-CG 3.41Å; N101-L105 PolarHBondContact O-N 3.13Å; L105-G107 VanDerWaalsContact C-N 3.26Å; L105-G107 PolarHBondContact O-N 3.1Å; L105-Y108 PolarHBondContact O-N 2.83Å; L105-Y109 HydrophobicContact CD2-CE2 4.16Å; L105-Y109 VanDerWaalsContact O-CD2 3.24Å; L105-Y109 WeakPolarHBondContact O-CD2 3.42Å; L105-Y109 PolarHBondContact O-N 3.08Å
106	R	91.9	Very high	93.3	Very high	131 Å²	131	95.5 Å²	95.5	49%	0.494	51%	0.506	S	S	.	.	H	α-helix	trans	-57.4	-42.5	175.8	-153.5	-171	79.3	-170.8	3.5	111.5	L102 G103 T104 N110 Q111 S112	L102-R106 WeakPolarHBondContact O-CB 3.41Å; L102-R106 PolarHBondContact O-N 3.45Å; G103-R106 WeakPolarHBondContact O-CB 3.49Å; G103-R106 PolarHBondContact O-N 3.17Å; T104-R106 VanDerWaalsContact C-N 3.31Å; T104-R106 PolarHBondContact O-N 3.02Å; R106-N110 PolarHBondContact O-N 3.39Å; R106-Q111 HydrophobicContact CG-CB 3.62Å; R106-Q111 VanDerWaalsContact CG-O 3.25Å; R106-Q111 WeakPolarHBondContact CG-O 3.47Å; R106-Q111 PolarHBondContact NE-O 2.69Å; R106-Q111 PolarHBondContact O-N 3.15Å; R106-S112 PolarHBondContact NE-OXT 3.08Å; R106-S112 VanDerWaalsContact NE-OXT 3.17Å; R106-S112 PolarHBondContact NH1-OXT 2.87Å; R106-S112 PolarHBondContact NH2-OXT 2.75Å
107	G	93.1	Very high	93	Very high	45 Å²	45	94.5 Å²	94.5	46%	0.464	51%	0.506	S	S	.	.	H	α-helix	trans	-63.1	-46.9	174.7	0	0	0	0	0	113.3	G103 T104 L105 Y109 N110	G103-G107 PolarHBondContact O-N 3.26Å; G103-G107 VanDerWaalsContact O-N 3.1Å; T104-G107 PolarHBondContact O-N 2.91Å; T104-G107 VanDerWaalsContact O-N 3.13Å; L105-G107 VanDerWaalsContact C-N 3.26Å; L105-G107 PolarHBondContact O-N 3.1Å; G107-Y109 VanDerWaalsContact C-N 3.3Å; G107-Y109 PolarHBondContact O-N 3.43Å; G107-N110 PolarHBondContact O-N 3.14Å; G107-N110 VanDerWaalsContact O-N 3.15Å
108	Y	96.1	Very high	92.7	Very high	177 Å²	177	96 Å²	96	69%	0.694	51%	0.51	S	S	*	.	H	α-helix	trans	-61.8	-36.7	179.9	-70.9	-13.7	0	0	0	113.6	T104 L105 N110	T104-Y108 HydrophobicContact CG2-CD2 4.13Å; T104-Y108 HydrophobicContact CG2-CE1 4.06Å; T104-Y108 HydrophobicContact CG2-CE2 3.61Å; T104-Y108 PolarHBondContact O-N 3.19Å; L105-Y108 PolarHBondContact O-N 2.83Å; Y108-N110 VanDerWaalsContact C-N 3.33Å
109	Y	95.3	Very high	92.5	Very high	161 Å²	161	101.1 Å²	101.1	63%	0.631	54%	0.537	S	S	*	.	T	Hydrogen-bonded Turn	trans	-92.1	9.7	179.4	-67.5	-73.5	0	0	0	113.5	L105 G107 Q111	L105-Y109 HydrophobicContact CD2-CE2 4.16Å; L105-Y109 VanDerWaalsContact O-CD2 3.24Å; L105-Y109 WeakPolarHBondContact O-CD2 3.42Å; L105-Y109 PolarHBondContact O-N 3.08Å; G107-Y109 VanDerWaalsContact C-N 3.3Å; G107-Y109 PolarHBondContact O-N 3.43Å; Y109-Q111 PolarHBondContact O-N 3.08Å
110	N	92.9	Very high	92.3	Very high	154 Å²	154	100.5 Å²	100.5	82%	0.824	55%	0.546	S	S	*	.	T	Hydrogen-bonded Turn	trans	49.9	38.4	-177	-62.3	-53	0	0	0	113	R106 G107 Y108	R106-N110 PolarHBondContact O-N 3.39Å; G107-N110 PolarHBondContact O-N 3.14Å; G107-N110 VanDerWaalsContact O-N 3.15Å; Y108-N110 VanDerWaalsContact C-N 3.33Å
111	Q	86.8	Confident	92	Very high	124 Å²	124	103.8 Å²	103.8	58%	0.579	55%	0.551	S	S	*	*			trans	-89.2	142.4	177.5	-67.6	177.2	-1.7	0	0	109.8	R106 Y109	R106-Q111 HydrophobicContact CG-CB 3.62Å; R106-Q111 VanDerWaalsContact CG-O 3.25Å; R106-Q111 WeakPolarHBondContact CG-O 3.47Å; R106-Q111 PolarHBondContact NE-O 2.69Å; R106-Q111 PolarHBondContact O-N 3.15Å; Y109-Q111 PolarHBondContact O-N 3.08Å
112	S	75	Confident	91.7	Very high	138 Å²	138	106.1 Å²	106.1	97%	0.965	56%	0.562	S	S	*	*			trans	-92	0	178	60.8	0	0	0	0	112.2	R106	R106-S112 PolarHBondContact NE-OXT 3.08Å; R106-S112 VanDerWaalsContact NE-OXT 3.17Å; R106-S112 PolarHBondContact NH1-OXT 2.87Å; R106-S112 PolarHBondContact NH2-OXT 2.75Å

Retrieved 112 of 112 residues in 34.6 ms (Link to these results)

U.S. Privacy Notice - Disclaimer / Registrations / Copyright Statement - Linking Policy - Notice of Privacy Practices (HIPAA) - Notice of Non‑Discrimination
© Copyright 2026 St. Jude Children's Research Hospital, a not-for-profit, section 501(c)(3).